FreshPorts -- The Place For Ports notbugIf you buy from Amazon USA, please support us by using this link.
Follow us
Blog
Twitter

Port details
qt5-doc Qt 5 documentation
5.9.4 misc on this many watch lists=0 search for ports that depend on this port Find issues related to this port Report an issue related to this port
Maintainer: kde@FreeBSD.org search for ports maintained by this maintainer
Port Added: 31 May 2016 20:39:07
License: not specified in port
Qt is a cross-platform application and UI framework for developers
using C++ or QML, a CSS/JavaScript-like language.

With Qt, code can be reused efficiently to target multiple platforms
with one code base. The modular C++ class library and developer tools
easily enables developers to create applications for one platform and
easily build and run to deploy on another platform.

WWW: http://qt-project.org
SVNWeb : Homepage : PortsMon
    Pseudo-pkg-plist information, but much better, from make generate-plist
    Expand this list (13031 items)
  1. share/doc/qt5/activeqt.qch
  2. share/doc/qt5/activeqt/activeqt-activeqt-comapp-comapp-pro.html
  3. share/doc/qt5/activeqt/activeqt-activeqt-comapp-example.html
  4. share/doc/qt5/activeqt/activeqt-activeqt-comapp-main-cpp.html
  5. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-example.html
  6. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-hierarchy-pro.html
  7. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-main-cpp.html
  8. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-objects-cpp.html
  9. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-objects-h.html
  10. share/doc/qt5/activeqt/activeqt-activeqt-menus-example.html
  11. share/doc/qt5/activeqt/activeqt-activeqt-menus-main-cpp.html
  12. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-cpp.html
  13. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-h.html
  14. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-pro.html
  15. share/doc/qt5/activeqt/activeqt-activeqt-multiple-ax1-h.html
  16. share/doc/qt5/activeqt/activeqt-activeqt-multiple-ax2-h.html
  17. share/doc/qt5/activeqt/activeqt-activeqt-multiple-example.html
  18. share/doc/qt5/activeqt/activeqt-activeqt-multiple-main-cpp.html
  19. share/doc/qt5/activeqt/activeqt-activeqt-multiple-multiple-pro.html
  20. share/doc/qt5/activeqt/activeqt-activeqt-opengl-example.html
  21. share/doc/qt5/activeqt/activeqt-activeqt-opengl-glbox-cpp.html
  22. share/doc/qt5/activeqt/activeqt-activeqt-opengl-glbox-h.html
  23. share/doc/qt5/activeqt/activeqt-activeqt-opengl-globjwin-cpp.html
  24. share/doc/qt5/activeqt/activeqt-activeqt-opengl-globjwin-h.html
  25. share/doc/qt5/activeqt/activeqt-activeqt-opengl-main-cpp.html
  26. share/doc/qt5/activeqt/activeqt-activeqt-opengl-opengl-pro.html
  27. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-addressview-cpp.html
  28. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-addressview-h.html
  29. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-example.html
  30. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-main-cpp.html
  31. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-qutlook-pro.html
  32. share/doc/qt5/activeqt/activeqt-activeqt-simple-example.html
  33. share/doc/qt5/activeqt/activeqt-activeqt-simple-main-cpp.html
  34. share/doc/qt5/activeqt/activeqt-activeqt-simple-simple-pro.html
  35. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-example.html
  36. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-main-cpp.html
  37. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-mainwindow-ui.html
  38. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-webaxwidget-h.html
  39. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-webbrowser-pro.html
  40. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-example.html
  41. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-main-cpp.html
  42. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-wrapper-pro.html
  43. share/doc/qt5/activeqt/activeqt-container.html
  44. share/doc/qt5/activeqt/activeqt-dotnet.html
  45. share/doc/qt5/activeqt/activeqt-dumpcpp.html
  46. share/doc/qt5/activeqt/activeqt-dumpdoc.html
  47. share/doc/qt5/activeqt/activeqt-index.html
  48. share/doc/qt5/activeqt/activeqt-server.html
  49. share/doc/qt5/activeqt/activeqt-tools.html
  50. share/doc/qt5/activeqt/activeqt.index
  51. share/doc/qt5/activeqt/activeqt.qhp
  52. share/doc/qt5/activeqt/activeqt.qhp.sha1
  53. share/doc/qt5/activeqt/activeqt.tags
  54. share/doc/qt5/activeqt/examples-manifest.xml
  55. share/doc/qt5/activeqt/images/activeqt-webbrowser-example.png
  56. share/doc/qt5/activeqt/images/arrow_bc.png
  57. share/doc/qt5/activeqt/images/bgrContent.png
  58. share/doc/qt5/activeqt/images/btn_next.png
  59. share/doc/qt5/activeqt/images/btn_prev.png
  60. share/doc/qt5/activeqt/images/bullet_dn.png
  61. share/doc/qt5/activeqt/images/bullet_sq.png
  62. share/doc/qt5/activeqt/images/home.png
  63. share/doc/qt5/activeqt/images/ico_note.png
  64. share/doc/qt5/activeqt/images/ico_note_attention.png
  65. share/doc/qt5/activeqt/images/ico_out.png
  66. share/doc/qt5/activeqt/images/logo.png
  67. share/doc/qt5/activeqt/qaxaggregated-members.html
  68. share/doc/qt5/activeqt/qaxaggregated.html
  69. share/doc/qt5/activeqt/qaxbase-members.html
  70. share/doc/qt5/activeqt/qaxbase.html
  71. share/doc/qt5/activeqt/qaxbindable-members.html
  72. share/doc/qt5/activeqt/qaxbindable.html
  73. share/doc/qt5/activeqt/qaxcontainer-module.html
  74. share/doc/qt5/activeqt/qaxfactory-members.html
  75. share/doc/qt5/activeqt/qaxfactory.html
  76. share/doc/qt5/activeqt/qaxobject-members.html
  77. share/doc/qt5/activeqt/qaxobject.html
  78. share/doc/qt5/activeqt/qaxscript-members.html
  79. share/doc/qt5/activeqt/qaxscript.html
  80. share/doc/qt5/activeqt/qaxscriptengine-members.html
  81. share/doc/qt5/activeqt/qaxscriptengine.html
  82. share/doc/qt5/activeqt/qaxscriptmanager-members.html
  83. share/doc/qt5/activeqt/qaxscriptmanager.html
  84. share/doc/qt5/activeqt/qaxselect-members.html
  85. share/doc/qt5/activeqt/qaxselect.html
  86. share/doc/qt5/activeqt/qaxserver-demo-hierarchy.html
  87. share/doc/qt5/activeqt/qaxserver-demo-menus.html
  88. share/doc/qt5/activeqt/qaxserver-demo-multiple.html
  89. share/doc/qt5/activeqt/qaxserver-demo-opengl.html
  90. share/doc/qt5/activeqt/qaxserver-demo-simple.html
  91. share/doc/qt5/activeqt/qaxserver-demo-wrapper.html
  92. share/doc/qt5/activeqt/qaxserver-module.html
  93. share/doc/qt5/activeqt/qaxwidget-members.html
  94. share/doc/qt5/activeqt/qaxwidget.html
  95. share/doc/qt5/activeqt/style/offline-simple.css
  96. share/doc/qt5/activeqt/style/offline.css
  97. share/doc/qt5/gammaray-manual.qch
  98. share/doc/qt5/gammaray-manual/examples-gammaray.html
  99. share/doc/qt5/gammaray-manual/examples-manifest.xml
  100. share/doc/qt5/gammaray-manual/gammaray-action-inspector.html
  101. share/doc/qt5/gammaray-manual/gammaray-application-attributes.html
  102. share/doc/qt5/gammaray-manual/gammaray-basic-operations.html
  103. share/doc/qt5/gammaray-manual/gammaray-client.html
  104. share/doc/qt5/gammaray-manual/gammaray-codec-browser.html
  105. share/doc/qt5/gammaray-manual/gammaray-command-line.html
  106. share/doc/qt5/gammaray-manual/gammaray-connections.html
  107. share/doc/qt5/gammaray-manual/gammaray-enums.html
  108. share/doc/qt5/gammaray-manual/gammaray-font-browser.html
  109. share/doc/qt5/gammaray-manual/gammaray-getting-started.html
  110. share/doc/qt5/gammaray-manual/gammaray-graphicsscene-inspector.html
  111. share/doc/qt5/gammaray-manual/gammaray-http-cookies.html
  112. share/doc/qt5/gammaray-manual/gammaray-install.html
  113. share/doc/qt5/gammaray-manual/gammaray-launcher-gui.html
  114. share/doc/qt5/gammaray-manual/gammaray-licenses-and-attributions.html
  115. share/doc/qt5/gammaray-manual/gammaray-locales.html
  116. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-backward-cpp.html
  117. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-kitemmodels.html
  118. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-kuserfeedback.html
  119. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-lz4.html
  120. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-stackwalker.html
  121. share/doc/qt5/gammaray-manual/gammaray-manual.qhp
  122. share/doc/qt5/gammaray-manual/gammaray-manual.qhp.sha1
  123. share/doc/qt5/gammaray-manual/gammaray-messages.html
  124. share/doc/qt5/gammaray-manual/gammaray-metaobject-browser.html
  125. share/doc/qt5/gammaray-manual/gammaray-metatype-browser.html
  126. share/doc/qt5/gammaray-manual/gammaray-methods.html
  127. share/doc/qt5/gammaray-manual/gammaray-mime-types.html
  128. share/doc/qt5/gammaray-manual/gammaray-model-inspector.html
  129. share/doc/qt5/gammaray-manual/gammaray-network.html
  130. share/doc/qt5/gammaray-manual/gammaray-object-inspection.html
  131. share/doc/qt5/gammaray-manual/gammaray-paint-analyzer.html
  132. share/doc/qt5/gammaray-manual/gammaray-properties.html
  133. share/doc/qt5/gammaray-manual/gammaray-qmlbindings.html
  134. share/doc/qt5/gammaray-manual/gammaray-qmlcontext.html
  135. share/doc/qt5/gammaray-manual/gammaray-qmltype.html
  136. share/doc/qt5/gammaray-manual/gammaray-qobject-browser.html
  137. share/doc/qt5/gammaray-manual/gammaray-qresource-browser.html
  138. share/doc/qt5/gammaray-manual/gammaray-qsggeometry.html
  139. share/doc/qt5/gammaray-manual/gammaray-qsgmaterial.html
  140. share/doc/qt5/gammaray-manual/gammaray-qsgtexture.html
  141. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-example.html
  142. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-mycylinder-cpp.html
  143. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-mycylinder-h.html
  144. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-qt3d-geometry-cpp.html
  145. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-qt3d-geometry-pro.html
  146. share/doc/qt5/gammaray-manual/gammaray-qt3d-inspector.html
  147. share/doc/qt5/gammaray-manual/gammaray-qt3dgeometry-inspector.html
  148. share/doc/qt5/gammaray-manual/gammaray-qtcreator.html
  149. share/doc/qt5/gammaray-manual/gammaray-qtquick2-inspector.html
  150. share/doc/qt5/gammaray-manual/gammaray-quick-batching-example.html
  151. share/doc/qt5/gammaray-manual/gammaray-quick-batching-quick-batching-pro.html
  152. share/doc/qt5/gammaray-manual/gammaray-quick-batching-quick-batching-qml.html
  153. share/doc/qt5/gammaray-manual/gammaray-quick-batching-slider-qml.html
  154. share/doc/qt5/gammaray-manual/gammaray-quick-event-handling-example.html
  155. share/doc/qt5/gammaray-manual/gammaray-quick-event-handling-quick-event-handling-pro.html
  156. share/doc/qt5/gammaray-manual/gammaray-quick-event-handling-quick-event-handling-qml.html
  157. share/doc/qt5/gammaray-manual/gammaray-signal-plotter.html
  158. share/doc/qt5/gammaray-manual/gammaray-signal-slot-example.html
  159. share/doc/qt5/gammaray-manual/gammaray-signal-slot-signal-slot-cpp.html
  160. share/doc/qt5/gammaray-manual/gammaray-signal-slot-signal-slot-pro.html
  161. share/doc/qt5/gammaray-manual/gammaray-stack-trace.html
  162. share/doc/qt5/gammaray-manual/gammaray-standard-paths.html
  163. share/doc/qt5/gammaray-manual/gammaray-state-machine-debugger.html
  164. share/doc/qt5/gammaray-manual/gammaray-state-machine-example.html
  165. share/doc/qt5/gammaray-manual/gammaray-state-machine-state-machine-pro.html
  166. share/doc/qt5/gammaray-manual/gammaray-state-machine-state-machine-qml.html
  167. share/doc/qt5/gammaray-manual/gammaray-styles.html
  168. share/doc/qt5/gammaray-manual/gammaray-text-documents.html
  169. share/doc/qt5/gammaray-manual/gammaray-timer-example.html
  170. share/doc/qt5/gammaray-manual/gammaray-timer-timer-cpp.html
  171. share/doc/qt5/gammaray-manual/gammaray-timer-timer-pro.html
  172. share/doc/qt5/gammaray-manual/gammaray-timertop.html
  173. share/doc/qt5/gammaray-manual/gammaray-tools.html
  174. share/doc/qt5/gammaray-manual/gammaray-translator-inspector.html
  175. share/doc/qt5/gammaray-manual/gammaray-wayland-compositors.html
  176. share/doc/qt5/gammaray-manual/gammaray-web-inspector.html
  177. share/doc/qt5/gammaray-manual/gammaray-widget-attributes.html
  178. share/doc/qt5/gammaray-manual/gammaray-widget-inspector.html
  179. share/doc/qt5/gammaray-manual/gammaray-widget-layouting-example.html
  180. share/doc/qt5/gammaray-manual/gammaray-widget-layouting-widget-layouting-cpp.html
  181. share/doc/qt5/gammaray-manual/gammaray-widget-layouting-widget-layouting-pro.html
  182. share/doc/qt5/gammaray-manual/gammaray.index
  183. share/doc/qt5/gammaray-manual/images/gammaray-action-inspector.png
  184. share/doc/qt5/gammaray-manual/images/gammaray-application-attributes.png
  185. share/doc/qt5/gammaray-manual/images/gammaray-bindings.png
  186. share/doc/qt5/gammaray-manual/images/gammaray-codec-browser.png
  187. share/doc/qt5/gammaray-manual/images/gammaray-connections.png
  188. share/doc/qt5/gammaray-manual/images/gammaray-enums.png
  189. share/doc/qt5/gammaray-manual/images/gammaray-font-browser.png
  190. share/doc/qt5/gammaray-manual/images/gammaray-graphicsitem-paint-analyzer.png
  191. share/doc/qt5/gammaray-manual/images/gammaray-graphicsscene-inspector.png
  192. share/doc/qt5/gammaray-manual/images/gammaray-http-cookies.png
  193. share/doc/qt5/gammaray-manual/images/gammaray-launcher-attach.png
  194. share/doc/qt5/gammaray-manual/images/gammaray-launcher-connect.png
  195. share/doc/qt5/gammaray-manual/images/gammaray-launcher-launch.png
  196. share/doc/qt5/gammaray-manual/images/gammaray-launcher-selftest.png
  197. share/doc/qt5/gammaray-manual/images/gammaray-locales.png
  198. share/doc/qt5/gammaray-manual/images/gammaray-logging-categories.png
  199. share/doc/qt5/gammaray-manual/images/gammaray-metaobject-browser.png
  200. share/doc/qt5/gammaray-manual/images/gammaray-metatype-browser.png
  201. share/doc/qt5/gammaray-manual/images/gammaray-method-invocation.png
  202. share/doc/qt5/gammaray-manual/images/gammaray-methods.png
  203. share/doc/qt5/gammaray-manual/images/gammaray-mime-types.png
  204. share/doc/qt5/gammaray-manual/images/gammaray-model-inspector.png
  205. share/doc/qt5/gammaray-manual/images/gammaray-network-interfaces.png
  206. share/doc/qt5/gammaray-manual/images/gammaray-object-inspector.png
  207. share/doc/qt5/gammaray-manual/images/gammaray-paint-analyzer.png
  208. share/doc/qt5/gammaray-manual/images/gammaray-properties.png
  209. share/doc/qt5/gammaray-manual/images/gammaray-qmlcontext.png
  210. share/doc/qt5/gammaray-manual/images/gammaray-qmltype.png
  211. share/doc/qt5/gammaray-manual/images/gammaray-qq2-geometry.png
  212. share/doc/qt5/gammaray-manual/images/gammaray-qq2-inspector.png
  213. share/doc/qt5/gammaray-manual/images/gammaray-qq2-qsg-visualize.png
  214. share/doc/qt5/gammaray-manual/images/gammaray-qqpainteditem-paint-analyzer.png
  215. share/doc/qt5/gammaray-manual/images/gammaray-qrc-browser.png
  216. share/doc/qt5/gammaray-manual/images/gammaray-qsggeometry.png
  217. share/doc/qt5/gammaray-manual/images/gammaray-qsgmaterial.png
  218. share/doc/qt5/gammaray-manual/images/gammaray-qsgtexture.png
  219. share/doc/qt5/gammaray-manual/images/gammaray-qsm-debugger.png
  220. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-buffers.png
  221. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-backface-culling.png
  222. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-buffers.png
  223. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-normals.png
  224. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-wireframe.png
  225. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry.png
  226. share/doc/qt5/gammaray-manual/images/gammaray-qtcreator-attach.png
  227. share/doc/qt5/gammaray-manual/images/gammaray-qtcreator-connect.png
  228. share/doc/qt5/gammaray-manual/images/gammaray-qtcreator.png
  229. share/doc/qt5/gammaray-manual/images/gammaray-signal-plotter.png
  230. share/doc/qt5/gammaray-manual/images/gammaray-stack-trace.png
  231. share/doc/qt5/gammaray-manual/images/gammaray-standard-paths.png
  232. share/doc/qt5/gammaray-manual/images/gammaray-style-controls.png
  233. share/doc/qt5/gammaray-manual/images/gammaray-text-documents.png
  234. share/doc/qt5/gammaray-manual/images/gammaray-timertop.png
  235. share/doc/qt5/gammaray-manual/images/gammaray-timezones.png
  236. share/doc/qt5/gammaray-manual/images/gammaray-translations.png
  237. share/doc/qt5/gammaray-manual/images/gammaray-wayland-compositor.png
  238. share/doc/qt5/gammaray-manual/images/gammaray-web-inspector.png
  239. share/doc/qt5/gammaray-manual/images/gammaray-widget-attributes.png
  240. share/doc/qt5/gammaray-manual/images/gammaray-widget-inspector.png
  241. share/doc/qt5/gammaray-manual/index.html
  242. share/doc/qt5/qdoc.qch
  243. share/doc/qt5/qdoc/01-qdoc-manual.html
  244. share/doc/qt5/qdoc/03-qdoc-commands-markup.html
  245. share/doc/qt5/qdoc/04-qdoc-commands-textmarkup.html
  246. share/doc/qt5/qdoc/05-qdoc-commands-documentstructure.html
  247. share/doc/qt5/qdoc/06-qdoc-commands-includecodeinline.html
  248. share/doc/qt5/qdoc/07-0-qdoc-commands-includingexternalcode.html
  249. share/doc/qt5/qdoc/08-qdoc-commands-creatinglinks.html
  250. share/doc/qt5/qdoc/09-qdoc-commands-includingimages.html
  251. share/doc/qt5/qdoc/10-qdoc-commands-tablesandlists.html
  252. share/doc/qt5/qdoc/11-qdoc-commands-specialcontent.html
  253. share/doc/qt5/qdoc/12-0-qdoc-commands-miscellaneous.html
  254. share/doc/qt5/qdoc/13-qdoc-commands-topics.html
  255. share/doc/qt5/qdoc/14-qdoc-commands-contextcommands.html
  256. share/doc/qt5/qdoc/15-qdoc-commands-navigation.html
  257. share/doc/qt5/qdoc/16-qdoc-commands-status.html
  258. share/doc/qt5/qdoc/17-qdoc-commands-thread.html
  259. share/doc/qt5/qdoc/18-qdoc-commands-relating.html
  260. share/doc/qt5/qdoc/19-qdoc-commands-grouping.html
  261. share/doc/qt5/qdoc/20-qdoc-commands-namingthings.html
  262. share/doc/qt5/qdoc/21-0-qdoc-configuration.html
  263. share/doc/qt5/qdoc/21-0-qdoc-creating-dita-maps.html
  264. share/doc/qt5/qdoc/21-1-minimum-qdocconf.html
  265. share/doc/qt5/qdoc/21-2-qtgui-qdocconf.html
  266. share/doc/qt5/qdoc/21-3-qt-dita-xml-output.html
  267. share/doc/qt5/qdoc/22-creating-help-project-files.html
  268. share/doc/qt5/qdoc/22-qdoc-configuration-generalvariables.html
  269. share/doc/qt5/qdoc/23-qdoc-configuration-cppvariables.html
  270. share/doc/qt5/qdoc/24-qdoc-configuration-htmlvariables.html
  271. share/doc/qt5/qdoc/25-qdoc-configuration-derivedprojects.html
  272. share/doc/qt5/qdoc/26-qdoc-configuration-example-manifest-files.html
  273. share/doc/qt5/qdoc/27-qdoc-commands-alphabetical.html
  274. share/doc/qt5/qdoc/28-qdoc-qa-pages.html
  275. share/doc/qt5/qdoc/corefeatures.html
  276. share/doc/qt5/qdoc/examples-manifest.xml
  277. share/doc/qt5/qdoc/images/arrow_bc.png
  278. share/doc/qt5/qdoc/images/bgrContent.png
  279. share/doc/qt5/qdoc/images/btn_next.png
  280. share/doc/qt5/qdoc/images/btn_prev.png
  281. share/doc/qt5/qdoc/images/bullet_dn.png
  282. share/doc/qt5/qdoc/images/bullet_sq.png
  283. share/doc/qt5/qdoc/images/happy.gif
  284. share/doc/qt5/qdoc/images/happyguy.jpg
  285. share/doc/qt5/qdoc/images/home.png
  286. share/doc/qt5/qdoc/images/ico_note.png
  287. share/doc/qt5/qdoc/images/ico_note_attention.png
  288. share/doc/qt5/qdoc/images/ico_out.png
  289. share/doc/qt5/qdoc/images/link-to-qquickitem.png
  290. share/doc/qt5/qdoc/images/links-to-links.png
  291. share/doc/qt5/qdoc/images/logo.png
  292. share/doc/qt5/qdoc/images/qa-table.png
  293. share/doc/qt5/qdoc/images/training.jpg
  294. share/doc/qt5/qdoc/images/windowsvista-pushbutton.png
  295. share/doc/qt5/qdoc/qdoc-categories.html
  296. share/doc/qt5/qdoc/qdoc-componentset-componentset-pro.html
  297. share/doc/qt5/qdoc/qdoc-componentset-example.html
  298. share/doc/qt5/qdoc/qdoc-componentset-progressbar-qml.html
  299. share/doc/qt5/qdoc/qdoc-componentset-switch-qml.html
  300. share/doc/qt5/qdoc/qdoc-componentset-tabwidget-qml.html
  301. share/doc/qt5/qdoc/qdoc-componentset-uicomponents-qdoc-sample.html
  302. share/doc/qt5/qdoc/qdoc-guide-conf.html
  303. share/doc/qt5/qdoc/qdoc-guide-writing.html
  304. share/doc/qt5/qdoc/qdoc-guide.html
  305. share/doc/qt5/qdoc/qdoc-index.html
  306. share/doc/qt5/qdoc/qdoc-minimum-qdocconf.html
  307. share/doc/qt5/qdoc/qdoc.index
  308. share/doc/qt5/qdoc/qdoc.qhp
  309. share/doc/qt5/qdoc/qdoc.qhp.sha1
  310. share/doc/qt5/qdoc/qdoc.tags
  311. share/doc/qt5/qdoc/qml-uicomponents-progressbar-members.html
  312. share/doc/qt5/qdoc/qml-uicomponents-progressbar.html
  313. share/doc/qt5/qdoc/qml-uicomponents-switch-members.html
  314. share/doc/qt5/qdoc/qml-uicomponents-switch.html
  315. share/doc/qt5/qdoc/qml-uicomponents-tabwidget-members.html
  316. share/doc/qt5/qdoc/qml-uicomponents-tabwidget.html
  317. share/doc/qt5/qdoc/qtgui-qdocconf.html
  318. share/doc/qt5/qdoc/qtwritingstyle-cpp.html
  319. share/doc/qt5/qdoc/qtwritingstyle-qml.html
  320. share/doc/qt5/qdoc/style/offline-simple.css
  321. share/doc/qt5/qdoc/style/offline.css
  322. share/doc/qt5/qdoc/uicomponents-qmlmodule.html
  323. share/doc/qt5/qmake.qch
  324. share/doc/qt5/qmake/images/arrow_bc.png
  325. share/doc/qt5/qmake/images/bgrContent.png
  326. share/doc/qt5/qmake/images/btn_next.png
  327. share/doc/qt5/qmake/images/btn_prev.png
  328. share/doc/qt5/qmake/images/bullet_dn.png
  329. share/doc/qt5/qmake/images/bullet_sq.png
  330. share/doc/qt5/qmake/images/home.png
  331. share/doc/qt5/qmake/images/ico_note.png
  332. share/doc/qt5/qmake/images/ico_note_attention.png
  333. share/doc/qt5/qmake/images/ico_out.png
  334. share/doc/qt5/qmake/images/logo.png
  335. share/doc/qt5/qmake/images/qmake-precompile-ui.png
  336. share/doc/qt5/qmake/qmake-advanced-usage.html
  337. share/doc/qt5/qmake/qmake-common-projects.html
  338. share/doc/qt5/qmake/qmake-environment-reference.html
  339. share/doc/qt5/qmake/qmake-function-reference.html
  340. share/doc/qt5/qmake/qmake-language.html
  341. share/doc/qt5/qmake/qmake-manual.html
  342. share/doc/qt5/qmake/qmake-overview.html
  343. share/doc/qt5/qmake/qmake-platform-notes.html
  344. share/doc/qt5/qmake/qmake-precompiledheaders.html
  345. share/doc/qt5/qmake/qmake-project-files.html
  346. share/doc/qt5/qmake/qmake-reference.html
  347. share/doc/qt5/qmake/qmake-running.html
  348. share/doc/qt5/qmake/qmake-test-function-reference.html
  349. share/doc/qt5/qmake/qmake-tutorial.html
  350. share/doc/qt5/qmake/qmake-variable-reference.html
  351. share/doc/qt5/qmake/qmake.index
  352. share/doc/qt5/qmake/qmake.qhp
  353. share/doc/qt5/qmake/qmake.qhp.sha1
  354. share/doc/qt5/qmake/style/offline-simple.css
  355. share/doc/qt5/qmake/style/offline.css
  356. share/doc/qt5/qt3d.qch
  357. share/doc/qt5/qt3d/examples-manifest.xml
  358. share/doc/qt5/qt3d/images/Space-invaders.jpg
  359. share/doc/qt5/qt3d/images/advanced-custom-material.jpg
  360. share/doc/qt5/qt3d/images/arrow_bc.png
  361. share/doc/qt5/qt3d/images/audio-visualizer-qml-example.png
  362. share/doc/qt5/qt3d/images/basicshapes-cpp-example.jpg
  363. share/doc/qt5/qt3d/images/bgrContent.png
  364. share/doc/qt5/qt3d/images/btn_next.png
  365. share/doc/qt5/qt3d/images/btn_prev.png
  366. share/doc/qt5/qt3d/images/bullet_dn.png
  367. share/doc/qt5/qt3d/images/bullet_sq.png
  368. share/doc/qt5/qt3d/images/deferred-framegraph.png
  369. share/doc/qt5/qt3d/images/ecs-1.png
  370. share/doc/qt5/qt3d/images/ecs-2.png
  371. share/doc/qt5/qt3d/images/framegraph-parallel-build.png
  372. share/doc/qt5/qt3d/images/home.png
  373. share/doc/qt5/qt3d/images/ico_note.png
  374. share/doc/qt5/qt3d/images/ico_note_attention.png
  375. share/doc/qt5/qt3d/images/ico_out.png
  376. share/doc/qt5/qt3d/images/logo.png
  377. share/doc/qt5/qt3d/images/materials-cpp.png
  378. share/doc/qt5/qt3d/images/materials.png
  379. share/doc/qt5/qt3d/images/multiviewport-1.png
  380. share/doc/qt5/qt3d/images/multiviewport-2.png
  381. share/doc/qt5/qt3d/images/multiviewport-qml-example.jpg
  382. share/doc/qt5/qt3d/images/multiviewport.png
  383. share/doc/qt5/qt3d/images/planets-qml-example.jpg
  384. share/doc/qt5/qt3d/images/qt3d-wireframe-rendering.png
  385. share/doc/qt5/qt3d/images/scene2d.png
  386. share/doc/qt5/qt3d/images/scene3d.png
  387. share/doc/qt5/qt3d/images/shadowmapping-depth.png
  388. share/doc/qt5/qt3d/images/shadowmapping-qt3d.png
  389. share/doc/qt5/qt3d/images/simple-cpp.png
  390. share/doc/qt5/qt3d/images/simple-custom-material.jpg
  391. share/doc/qt5/qt3d/images/simple-framegraph.png
  392. share/doc/qt5/qt3d/images/simple-qml.png
  393. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/albumcover.png
  394. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/demotitle.png
  395. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/normalmap.png
  396. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausehoverpressed.png
  397. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausenormal.png
  398. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/playhoverpressed.png
  399. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/playnormal.png
  400. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/songtitle.png
  401. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopdisabled.png
  402. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stophoverpressed.png
  403. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopnormal.png
  404. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/earth.png
  405. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/jupiter.png
  406. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/mars.png
  407. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/mercury.png
  408. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/nasa/uranusringcolortrans.png
  409. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/neptune.png
  410. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/saturn.png
  411. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapcolortrans.png
  412. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapspec.jpg
  413. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthmap2k.jpg
  414. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthnormal2k.jpg
  415. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthspec2k.jpg
  416. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/galaxy_starfield.jpg
  417. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/jupitermap.jpg
  418. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsmap2k.jpg
  419. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsnormal2k.jpg
  420. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurymap.jpg
  421. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurynormal.jpg
  422. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonmap2k.jpg
  423. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonnormal2k.jpg
  424. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/neptunemap.jpg
  425. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnmap.jpg
  426. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnringcolortrans.png
  427. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/sunmap.jpg
  428. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/uranusmap.jpg
  429. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusmap.jpg
  430. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusnormal.jpg
  431. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/sun.png
  432. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/uranus.png
  433. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/venus.png
  434. share/doc/qt5/qt3d/images/wave.png
  435. share/doc/qt5/qt3d/images/widgets-scene3d.png
  436. share/doc/qt5/qt3d/qml-computecommand-members.html
  437. share/doc/qt5/qt3d/qml-computecommand.html
  438. share/doc/qt5/qt3d/qml-qt3d-animation-abstractanimation-members.html
  439. share/doc/qt5/qt3d/qml-qt3d-animation-abstractanimation.html
  440. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipanimator-members.html
  441. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipanimator.html
  442. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipblendnode-members.html
  443. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipblendnode.html
  444. share/doc/qt5/qt3d/qml-qt3d-animation-additiveclipblend-members.html
  445. share/doc/qt5/qt3d/qml-qt3d-animation-additiveclipblend.html
  446. share/doc/qt5/qt3d/qml-qt3d-animation-animationcontroller-members.html
  447. share/doc/qt5/qt3d/qml-qt3d-animation-animationcontroller.html
  448. share/doc/qt5/qt3d/qml-qt3d-animation-animationgroup-members.html
  449. share/doc/qt5/qt3d/qml-qt3d-animation-animationgroup.html
  450. share/doc/qt5/qt3d/qml-qt3d-animation-blendedclipanimator-members.html
  451. share/doc/qt5/qt3d/qml-qt3d-animation-blendedclipanimator.html
  452. share/doc/qt5/qt3d/qml-qt3d-animation-clipanimator-members.html
  453. share/doc/qt5/qt3d/qml-qt3d-animation-clipanimator.html
  454. share/doc/qt5/qt3d/qml-qt3d-animation-keyframeanimation-members.html
  455. share/doc/qt5/qt3d/qml-qt3d-animation-keyframeanimation.html
  456. share/doc/qt5/qt3d/qml-qt3d-animation-lerpblend-members.html
  457. share/doc/qt5/qt3d/qml-qt3d-animation-lerpblend.html
  458. share/doc/qt5/qt3d/qml-qt3d-animation-morphinganimation-members.html
  459. share/doc/qt5/qt3d/qml-qt3d-animation-morphinganimation.html
  460. share/doc/qt5/qt3d/qml-qt3d-animation-morphtarget-members.html
  461. share/doc/qt5/qt3d/qml-qt3d-animation-morphtarget.html
  462. share/doc/qt5/qt3d/qml-qt3d-animation-vertexblendanimation-members.html
  463. share/doc/qt5/qt3d/qml-qt3d-animation-vertexblendanimation.html
  464. share/doc/qt5/qt3d/qml-qt3d-core-component3d-members.html
  465. share/doc/qt5/qt3d/qml-qt3d-core-component3d.html
  466. share/doc/qt5/qt3d/qml-qt3d-core-entity-members.html
  467. share/doc/qt5/qt3d/qml-qt3d-core-entity.html
  468. share/doc/qt5/qt3d/qml-qt3d-core-entityloader-members.html
  469. share/doc/qt5/qt3d/qml-qt3d-core-entityloader.html
  470. share/doc/qt5/qt3d/qml-qt3d-core-node-members.html
  471. share/doc/qt5/qt3d/qml-qt3d-core-node.html
  472. share/doc/qt5/qt3d/qml-qt3d-core-nodeinstantiator-members.html
  473. share/doc/qt5/qt3d/qml-qt3d-core-nodeinstantiator.html
  474. share/doc/qt5/qt3d/qml-qt3d-core-quaternionanimation-members.html
  475. share/doc/qt5/qt3d/qml-qt3d-core-quaternionanimation.html
  476. share/doc/qt5/qt3d/qml-qt3d-core-transform-members.html
  477. share/doc/qt5/qt3d/qml-qt3d-core-transform.html
  478. share/doc/qt5/qt3d/qml-qt3d-extras-conegeometry-members.html
  479. share/doc/qt5/qt3d/qml-qt3d-extras-conegeometry.html
  480. share/doc/qt5/qt3d/qml-qt3d-extras-conemesh-members.html
  481. share/doc/qt5/qt3d/qml-qt3d-extras-conemesh.html
  482. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
  483. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidgeometry.html
  484. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidmesh-members.html
  485. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidmesh.html
  486. share/doc/qt5/qt3d/qml-qt3d-extras-cylindergeometry-members.html
  487. share/doc/qt5/qt3d/qml-qt3d-extras-cylindergeometry.html
  488. share/doc/qt5/qt3d/qml-qt3d-extras-cylindermesh-members.html
  489. share/doc/qt5/qt3d/qml-qt3d-extras-cylindermesh.html
  490. share/doc/qt5/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
  491. share/doc/qt5/qt3d/qml-qt3d-extras-diffusemapmaterial.html
  492. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
  493. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
  494. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextgeometry-members.html
  495. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextgeometry.html
  496. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextmesh-members.html
  497. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextmesh.html
  498. share/doc/qt5/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
  499. share/doc/qt5/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
  500. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer-members.html
  501. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer-obsolete.html
  502. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer.html
  503. share/doc/qt5/qt3d/qml-qt3d-extras-goochmaterial-members.html
  504. share/doc/qt5/qt3d/qml-qt3d-extras-goochmaterial.html
  505. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
  506. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
  507. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
  508. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
  509. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
  510. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
  511. share/doc/qt5/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
  512. share/doc/qt5/qt3d/qml-qt3d-extras-orbitcameracontroller.html
  513. share/doc/qt5/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
  514. share/doc/qt5/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
  515. share/doc/qt5/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
  516. share/doc/qt5/qt3d/qml-qt3d-extras-phongalphamaterial.html
  517. share/doc/qt5/qt3d/qml-qt3d-extras-phongmaterial-members.html
  518. share/doc/qt5/qt3d/qml-qt3d-extras-phongmaterial.html
  519. share/doc/qt5/qt3d/qml-qt3d-extras-planegeometry-members.html
  520. share/doc/qt5/qt3d/qml-qt3d-extras-planegeometry.html
  521. share/doc/qt5/qt3d/qml-qt3d-extras-planemesh-members.html
  522. share/doc/qt5/qt3d/qml-qt3d-extras-planemesh.html
  523. share/doc/qt5/qt3d/qml-qt3d-extras-spheregeometry-members.html
  524. share/doc/qt5/qt3d/qml-qt3d-extras-spheregeometry.html
  525. share/doc/qt5/qt3d/qml-qt3d-extras-spheremesh-members.html
  526. share/doc/qt5/qt3d/qml-qt3d-extras-spheremesh.html
  527. share/doc/qt5/qt3d/qml-qt3d-extras-torusgeometry-members.html
  528. share/doc/qt5/qt3d/qml-qt3d-extras-torusgeometry.html
  529. share/doc/qt5/qt3d/qml-qt3d-extras-torusmesh-members.html
  530. share/doc/qt5/qt3d/qml-qt3d-extras-torusmesh.html
  531. share/doc/qt5/qt3d/qml-qt3d-input-abstractactioninput-members.html
  532. share/doc/qt5/qt3d/qml-qt3d-input-abstractactioninput.html
  533. share/doc/qt5/qt3d/qml-qt3d-input-abstractaxisinput-members.html
  534. share/doc/qt5/qt3d/qml-qt3d-input-abstractaxisinput.html
  535. share/doc/qt5/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
  536. share/doc/qt5/qt3d/qml-qt3d-input-abstractphysicaldevice.html
  537. share/doc/qt5/qt3d/qml-qt3d-input-action-members.html
  538. share/doc/qt5/qt3d/qml-qt3d-input-action.html
  539. share/doc/qt5/qt3d/qml-qt3d-input-actioninput-members.html
  540. share/doc/qt5/qt3d/qml-qt3d-input-actioninput.html
  541. share/doc/qt5/qt3d/qml-qt3d-input-analogaxisinput-members.html
  542. share/doc/qt5/qt3d/qml-qt3d-input-analogaxisinput.html
  543. share/doc/qt5/qt3d/qml-qt3d-input-axis-members.html
  544. share/doc/qt5/qt3d/qml-qt3d-input-axis.html
  545. share/doc/qt5/qt3d/qml-qt3d-input-axisaccumulator-members.html
  546. share/doc/qt5/qt3d/qml-qt3d-input-axisaccumulator.html
  547. share/doc/qt5/qt3d/qml-qt3d-input-axissetting-members.html
  548. share/doc/qt5/qt3d/qml-qt3d-input-axissetting.html
  549. share/doc/qt5/qt3d/qml-qt3d-input-buttonaxisinput-members.html
  550. share/doc/qt5/qt3d/qml-qt3d-input-buttonaxisinput.html
  551. share/doc/qt5/qt3d/qml-qt3d-input-inputchord-members.html
  552. share/doc/qt5/qt3d/qml-qt3d-input-inputchord.html
  553. share/doc/qt5/qt3d/qml-qt3d-input-inputsequence-members.html
  554. share/doc/qt5/qt3d/qml-qt3d-input-inputsequence.html
  555. share/doc/qt5/qt3d/qml-qt3d-input-inputsettings-members.html
  556. share/doc/qt5/qt3d/qml-qt3d-input-inputsettings.html
  557. share/doc/qt5/qt3d/qml-qt3d-input-keyboarddevice-members.html
  558. share/doc/qt5/qt3d/qml-qt3d-input-keyboarddevice.html
  559. share/doc/qt5/qt3d/qml-qt3d-input-keyboardhandler-members.html
  560. share/doc/qt5/qt3d/qml-qt3d-input-keyboardhandler.html
  561. share/doc/qt5/qt3d/qml-qt3d-input-keyevent-members.html
  562. share/doc/qt5/qt3d/qml-qt3d-input-keyevent.html
  563. share/doc/qt5/qt3d/qml-qt3d-input-logicaldevice-members.html
  564. share/doc/qt5/qt3d/qml-qt3d-input-logicaldevice.html
  565. share/doc/qt5/qt3d/qml-qt3d-input-mousedevice-members.html
  566. share/doc/qt5/qt3d/qml-qt3d-input-mousedevice.html
  567. share/doc/qt5/qt3d/qml-qt3d-input-mouseevent-members.html
  568. share/doc/qt5/qt3d/qml-qt3d-input-mouseevent.html
  569. share/doc/qt5/qt3d/qml-qt3d-input-mousehandler-members.html
  570. share/doc/qt5/qt3d/qml-qt3d-input-mousehandler.html
  571. share/doc/qt5/qt3d/qml-qt3d-input-wheelevent-members.html
  572. share/doc/qt5/qt3d/qml-qt3d-input-wheelevent.html
  573. share/doc/qt5/qt3d/qml-qt3d-logic-frameaction-members.html
  574. share/doc/qt5/qt3d/qml-qt3d-logic-frameaction.html
  575. share/doc/qt5/qt3d/qml-qt3d-render-abstracttextureimage-members.html
  576. share/doc/qt5/qt3d/qml-qt3d-render-abstracttextureimage.html
  577. share/doc/qt5/qt3d/qml-qt3d-render-alphacoverage-members.html
  578. share/doc/qt5/qt3d/qml-qt3d-render-alphacoverage.html
  579. share/doc/qt5/qt3d/qml-qt3d-render-alphatest-members.html
  580. share/doc/qt5/qt3d/qml-qt3d-render-alphatest.html
  581. share/doc/qt5/qt3d/qml-qt3d-render-attribute-members.html
  582. share/doc/qt5/qt3d/qml-qt3d-render-attribute.html
  583. share/doc/qt5/qt3d/qml-qt3d-render-blendequation-members.html
  584. share/doc/qt5/qt3d/qml-qt3d-render-blendequation.html
  585. share/doc/qt5/qt3d/qml-qt3d-render-blendequationarguments-members.html
  586. share/doc/qt5/qt3d/qml-qt3d-render-blendequationarguments.html
  587. share/doc/qt5/qt3d/qml-qt3d-render-buffer-members.html
  588. share/doc/qt5/qt3d/qml-qt3d-render-buffer.html
  589. share/doc/qt5/qt3d/qml-qt3d-render-camera-members.html
  590. share/doc/qt5/qt3d/qml-qt3d-render-camera.html
  591. share/doc/qt5/qt3d/qml-qt3d-render-cameralens-members.html
  592. share/doc/qt5/qt3d/qml-qt3d-render-cameralens.html
  593. share/doc/qt5/qt3d/qml-qt3d-render-cameraselector-members.html
  594. share/doc/qt5/qt3d/qml-qt3d-render-cameraselector.html
  595. share/doc/qt5/qt3d/qml-qt3d-render-clearbuffers-members.html
  596. share/doc/qt5/qt3d/qml-qt3d-render-clearbuffers.html
  597. share/doc/qt5/qt3d/qml-qt3d-render-clipplane-members.html
  598. share/doc/qt5/qt3d/qml-qt3d-render-clipplane.html
  599. share/doc/qt5/qt3d/qml-qt3d-render-colormask-members.html
  600. share/doc/qt5/qt3d/qml-qt3d-render-colormask.html
  601. share/doc/qt5/qt3d/qml-qt3d-render-cullface-members.html
  602. share/doc/qt5/qt3d/qml-qt3d-render-cullface.html
  603. share/doc/qt5/qt3d/qml-qt3d-render-depthtest-members.html
  604. share/doc/qt5/qt3d/qml-qt3d-render-depthtest.html
  605. share/doc/qt5/qt3d/qml-qt3d-render-directionallight-members.html
  606. share/doc/qt5/qt3d/qml-qt3d-render-directionallight.html
  607. share/doc/qt5/qt3d/qml-qt3d-render-dispatchcompute-members.html
  608. share/doc/qt5/qt3d/qml-qt3d-render-dispatchcompute.html
  609. share/doc/qt5/qt3d/qml-qt3d-render-dithering-members.html
  610. share/doc/qt5/qt3d/qml-qt3d-render-dithering.html
  611. share/doc/qt5/qt3d/qml-qt3d-render-effect-members.html
  612. share/doc/qt5/qt3d/qml-qt3d-render-effect.html
  613. share/doc/qt5/qt3d/qml-qt3d-render-environmentlight-members.html
  614. share/doc/qt5/qt3d/qml-qt3d-render-environmentlight.html
  615. share/doc/qt5/qt3d/qml-qt3d-render-filterkey-members.html
  616. share/doc/qt5/qt3d/qml-qt3d-render-filterkey.html
  617. share/doc/qt5/qt3d/qml-qt3d-render-framegraphnode-members.html
  618. share/doc/qt5/qt3d/qml-qt3d-render-framegraphnode.html
  619. share/doc/qt5/qt3d/qml-qt3d-render-frontface-members.html
  620. share/doc/qt5/qt3d/qml-qt3d-render-frontface.html
  621. share/doc/qt5/qt3d/qml-qt3d-render-frustumculling-members.html
  622. share/doc/qt5/qt3d/qml-qt3d-render-frustumculling.html
  623. share/doc/qt5/qt3d/qml-qt3d-render-geometry-members.html
  624. share/doc/qt5/qt3d/qml-qt3d-render-geometry.html
  625. share/doc/qt5/qt3d/qml-qt3d-render-geometryrenderer-members.html
  626. share/doc/qt5/qt3d/qml-qt3d-render-geometryrenderer.html
  627. share/doc/qt5/qt3d/qml-qt3d-render-graphicsapifilter-members.html
  628. share/doc/qt5/qt3d/qml-qt3d-render-graphicsapifilter.html
  629. share/doc/qt5/qt3d/qml-qt3d-render-layer-members.html
  630. share/doc/qt5/qt3d/qml-qt3d-render-layer.html
  631. share/doc/qt5/qt3d/qml-qt3d-render-layerfilter-members.html
  632. share/doc/qt5/qt3d/qml-qt3d-render-layerfilter.html
  633. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetail-members.html
  634. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetail.html
  635. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailloader-members.html
  636. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailloader.html
  637. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailswitch-members.html
  638. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailswitch.html
  639. share/doc/qt5/qt3d/qml-qt3d-render-light-members.html
  640. share/doc/qt5/qt3d/qml-qt3d-render-light.html
  641. share/doc/qt5/qt3d/qml-qt3d-render-material-members.html
  642. share/doc/qt5/qt3d/qml-qt3d-render-material.html
  643. share/doc/qt5/qt3d/qml-qt3d-render-memorybarrier-members.html
  644. share/doc/qt5/qt3d/qml-qt3d-render-memorybarrier.html
  645. share/doc/qt5/qt3d/qml-qt3d-render-mesh-members.html
  646. share/doc/qt5/qt3d/qml-qt3d-render-mesh.html
  647. share/doc/qt5/qt3d/qml-qt3d-render-multisampleantialiasing-members.html
  648. share/doc/qt5/qt3d/qml-qt3d-render-multisampleantialiasing.html
  649. share/doc/qt5/qt3d/qml-qt3d-render-nodepthmask-members.html
  650. share/doc/qt5/qt3d/qml-qt3d-render-nodepthmask.html
  651. share/doc/qt5/qt3d/qml-qt3d-render-nodraw-members.html
  652. share/doc/qt5/qt3d/qml-qt3d-render-nodraw.html
  653. share/doc/qt5/qt3d/qml-qt3d-render-objectpicker-members.html
  654. share/doc/qt5/qt3d/qml-qt3d-render-objectpicker.html
  655. share/doc/qt5/qt3d/qml-qt3d-render-parameter-members.html
  656. share/doc/qt5/qt3d/qml-qt3d-render-parameter.html
  657. share/doc/qt5/qt3d/qml-qt3d-render-pickevent-members.html
  658. share/doc/qt5/qt3d/qml-qt3d-render-pickevent.html
  659. share/doc/qt5/qt3d/qml-qt3d-render-pickingsettings-members.html
  660. share/doc/qt5/qt3d/qml-qt3d-render-pickingsettings.html
  661. share/doc/qt5/qt3d/qml-qt3d-render-picktriangleevent-members.html
  662. share/doc/qt5/qt3d/qml-qt3d-render-picktriangleevent.html
  663. share/doc/qt5/qt3d/qml-qt3d-render-pointlight-members.html
  664. share/doc/qt5/qt3d/qml-qt3d-render-pointlight.html
  665. share/doc/qt5/qt3d/qml-qt3d-render-pointsize-members.html
  666. share/doc/qt5/qt3d/qml-qt3d-render-pointsize.html
  667. share/doc/qt5/qt3d/qml-qt3d-render-polygonoffset-members.html
  668. share/doc/qt5/qt3d/qml-qt3d-render-polygonoffset.html
  669. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture-members.html
  670. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture-obsolete.html
  671. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture.html
  672. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply-members.html
  673. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply-obsolete.html
  674. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply.html
  675. share/doc/qt5/qt3d/qml-qt3d-render-renderpass-members.html
  676. share/doc/qt5/qt3d/qml-qt3d-render-renderpass.html
  677. share/doc/qt5/qt3d/qml-qt3d-render-rendersettings-members.html
  678. share/doc/qt5/qt3d/qml-qt3d-render-rendersettings.html
  679. share/doc/qt5/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
  680. share/doc/qt5/qt3d/qml-qt3d-render-rendersurfaceselector.html
  681. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetselector-members.html
  682. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetselector.html
  683. share/doc/qt5/qt3d/qml-qt3d-render-sceneloader-members.html
  684. share/doc/qt5/qt3d/qml-qt3d-render-sceneloader.html
  685. share/doc/qt5/qt3d/qml-qt3d-render-scissortest-members.html
  686. share/doc/qt5/qt3d/qml-qt3d-render-scissortest.html
  687. share/doc/qt5/qt3d/qml-qt3d-render-seamlesscubemap-members.html
  688. share/doc/qt5/qt3d/qml-qt3d-render-seamlesscubemap.html
  689. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogram-members.html
  690. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogram.html
  691. share/doc/qt5/qt3d/qml-qt3d-render-sortpolicy-members.html
  692. share/doc/qt5/qt3d/qml-qt3d-render-sortpolicy.html
  693. share/doc/qt5/qt3d/qml-qt3d-render-spotlight-members.html
  694. share/doc/qt5/qt3d/qml-qt3d-render-spotlight.html
  695. share/doc/qt5/qt3d/qml-qt3d-render-stencilmask-members.html
  696. share/doc/qt5/qt3d/qml-qt3d-render-stencilmask.html
  697. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperation-members.html
  698. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperation.html
  699. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperationarguments-members.html
  700. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperationarguments.html
  701. share/doc/qt5/qt3d/qml-qt3d-render-stenciltest-members.html
  702. share/doc/qt5/qt3d/qml-qt3d-render-stenciltest.html
  703. share/doc/qt5/qt3d/qml-qt3d-render-stenciltestarguments-members.html
  704. share/doc/qt5/qt3d/qml-qt3d-render-stenciltestarguments.html
  705. share/doc/qt5/qt3d/qml-qt3d-render-technique-members.html
  706. share/doc/qt5/qt3d/qml-qt3d-render-technique.html
  707. share/doc/qt5/qt3d/qml-qt3d-render-textureimage-members.html
  708. share/doc/qt5/qt3d/qml-qt3d-render-textureimage.html
  709. share/doc/qt5/qt3d/qml-qt3d-render-viewport-members.html
  710. share/doc/qt5/qt3d/qml-qt3d-render-viewport.html
  711. share/doc/qt5/qt3d/qml-qt3d-scene2d-scene2d-members.html
  712. share/doc/qt5/qt3d/qml-qt3d-scene2d-scene2d.html
  713. share/doc/qt5/qt3d/qml-renderpassfilter-members.html
  714. share/doc/qt5/qt3d/qml-renderpassfilter.html
  715. share/doc/qt5/qt3d/qml-renderstate-members.html
  716. share/doc/qt5/qt3d/qml-renderstate.html
  717. share/doc/qt5/qt3d/qml-renderstateset-members.html
  718. share/doc/qt5/qt3d/qml-renderstateset.html
  719. share/doc/qt5/qt3d/qml-rendertarget-members.html
  720. share/doc/qt5/qt3d/qml-rendertarget.html
  721. share/doc/qt5/qt3d/qml-rendertargetoutput-members.html
  722. share/doc/qt5/qt3d/qml-rendertargetoutput.html
  723. share/doc/qt5/qt3d/qml-techniquefilter-members.html
  724. share/doc/qt5/qt3d/qml-techniquefilter.html
  725. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-advancedcustommaterial-pro.html
  726. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-example.html
  727. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-main-cpp.html
  728. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-main-qml.html
  729. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-models-qrc.html
  730. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-qml-qrc.html
  731. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-sceneroot-qml.html
  732. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-es2-water-vert.html
  733. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-gl3-water-vert.html
  734. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-qrc.html
  735. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-textures-qrc.html
  736. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-water-qml.html
  737. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-watermaterial-qml.html
  738. share/doc/qt5/qt3d/qt3d-animation-qmlmodule.html
  739. share/doc/qt5/qt3d/qt3d-attribution-assimp.html
  740. share/doc/qt5/qt3d/qt3d-attribution-nasa-jpl.html
  741. share/doc/qt5/qt3d/qt3d-attribution-solar-system-scope.html
  742. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-pro.html
  743. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-qrc.html
  744. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-barentity-qml.html
  745. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-example.html
  746. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-main-cpp.html
  747. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-main-qml.html
  748. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-touchsettings-cpp.html
  749. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-touchsettings-h.html
  750. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-visualizer-qml.html
  751. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-basicshapes-cpp-pro.html
  752. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-example.html
  753. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-main-cpp.html
  754. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-scenemodifier-cpp.html
  755. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-scenemodifier-h.html
  756. share/doc/qt5/qt3d/qt3d-core-qmlmodule.html
  757. share/doc/qt5/qt3d/qt3d-cpp.html
  758. share/doc/qt5/qt3d/qt3d-examples.html
  759. share/doc/qt5/qt3d/qt3d-extras-qmlmodule.html
  760. share/doc/qt5/qt3d/qt3d-index.html
  761. share/doc/qt5/qt3d/qt3d-input-qmlmodule.html
  762. share/doc/qt5/qt3d/qt3d-logic-qmlmodule.html
  763. share/doc/qt5/qt3d/qt3d-materials-barrel-qml.html
  764. share/doc/qt5/qt3d/qt3d-materials-basiccamera-qml.html
  765. share/doc/qt5/qt3d/qt3d-materials-chest-qml.html
  766. share/doc/qt5/qt3d/qt3d-materials-cpp-barrel-cpp.html
  767. share/doc/qt5/qt3d/qt3d-materials-cpp-barrel-h.html
  768. share/doc/qt5/qt3d/qt3d-materials-cpp-example.html
  769. share/doc/qt5/qt3d/qt3d-materials-cpp-houseplant-cpp.html
  770. share/doc/qt5/qt3d/qt3d-materials-cpp-houseplant-h.html
  771. share/doc/qt5/qt3d/qt3d-materials-cpp-main-cpp.html
  772. share/doc/qt5/qt3d/qt3d-materials-cpp-materials-cpp-pro.html
  773. share/doc/qt5/qt3d/qt3d-materials-cpp-planeentity-cpp.html
  774. share/doc/qt5/qt3d/qt3d-materials-cpp-planeentity-h.html
  775. share/doc/qt5/qt3d/qt3d-materials-cpp-renderableentity-cpp.html
  776. share/doc/qt5/qt3d/qt3d-materials-cpp-renderableentity-h.html
  777. share/doc/qt5/qt3d/qt3d-materials-cpp-rotatingtrefoilknot-cpp.html
  778. share/doc/qt5/qt3d/qt3d-materials-cpp-rotatingtrefoilknot-h.html
  779. share/doc/qt5/qt3d/qt3d-materials-cpp-trefoilknot-cpp.html
  780. share/doc/qt5/qt3d/qt3d-materials-cpp-trefoilknot-h.html
  781. share/doc/qt5/qt3d/qt3d-materials-example.html
  782. share/doc/qt5/qt3d/qt3d-materials-houseplant-qml.html
  783. share/doc/qt5/qt3d/qt3d-materials-lights-qml.html
  784. share/doc/qt5/qt3d/qt3d-materials-main-cpp.html
  785. share/doc/qt5/qt3d/qt3d-materials-main-qml.html
  786. share/doc/qt5/qt3d/qt3d-materials-materials-pro.html
  787. share/doc/qt5/qt3d/qt3d-materials-materials-qrc.html
  788. share/doc/qt5/qt3d/qt3d-materials-planeentity-qml.html
  789. share/doc/qt5/qt3d/qt3d-materials-renderableentity-qml.html
  790. share/doc/qt5/qt3d/qt3d-materials-sortedforwardrenderer-qml.html
  791. share/doc/qt5/qt3d/qt3d-materials-trefoilknot-qml.html
  792. share/doc/qt5/qt3d/qt3d-multiviewport-example.html
  793. share/doc/qt5/qt3d/qt3d-multiviewport-main-cpp.html
  794. share/doc/qt5/qt3d/qt3d-multiviewport-main-qml.html
  795. share/doc/qt5/qt3d/qt3d-multiviewport-multiviewport-pro.html
  796. share/doc/qt5/qt3d/qt3d-multiviewport-multiviewport-qrc.html
  797. share/doc/qt5/qt3d/qt3d-multiviewport-quadviewportframegraph-qml.html
  798. share/doc/qt5/qt3d/qt3d-multiviewport-simplecamera-qml.html
  799. share/doc/qt5/qt3d/qt3d-overview.html
  800. share/doc/qt5/qt3d/qt3d-planets-qml-android-androidmanifest-xml.html
  801. share/doc/qt5/qt3d/qt3d-planets-qml-appletvinput-qml.html
  802. share/doc/qt5/qt3d/qt3d-planets-qml-example.html
  803. share/doc/qt5/qt3d/qt3d-planets-qml-fpsdisplay-qml.html
  804. share/doc/qt5/qt3d/qt3d-planets-qml-infosheet-qml.html
  805. share/doc/qt5/qt3d/qt3d-planets-qml-main-cpp.html
  806. share/doc/qt5/qt3d/qt3d-planets-qml-networkcontroller-cpp.html
  807. share/doc/qt5/qt3d/qt3d-planets-qml-networkcontroller-h.html
  808. share/doc/qt5/qt3d/qt3d-planets-qml-planet-qml.html
  809. share/doc/qt5/qt3d/qt3d-planets-qml-planetbutton-qml.html
  810. share/doc/qt5/qt3d/qt3d-planets-qml-planeteffect-qml.html
  811. share/doc/qt5/qt3d/qt3d-planets-qml-planetframegraph-qml.html
  812. share/doc/qt5/qt3d/qt3d-planets-qml-planetmaterial-qml.html
  813. share/doc/qt5/qt3d/qt3d-planets-qml-planets-js.html
  814. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-images-qrc.html
  815. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-pro.html
  816. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-qrc.html
  817. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-appdelegate-h.html
  818. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-viewcontroller-h.html
  819. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-extensiondelegate-h.html
  820. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-interfacecontroller-h.html
  821. share/doc/qt5/qt3d/qt3d-planets-qml-planetslight-qml.html
  822. share/doc/qt5/qt3d/qt3d-planets-qml-planetsmain-qml.html
  823. share/doc/qt5/qt3d/qt3d-planets-qml-ring-qml.html
  824. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-planetd-vert.html
  825. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-planetdb-vert.html
  826. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-sun-vert.html
  827. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetd-vert.html
  828. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetdb-vert.html
  829. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetdshadow-vert.html
  830. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-shadowmap-vert.html
  831. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-sun-vert.html
  832. share/doc/qt5/qt3d/qt3d-planets-qml-shadoweffect-qml.html
  833. share/doc/qt5/qt3d/qt3d-planets-qml-solarsystem-qml.html
  834. share/doc/qt5/qt3d/qt3d-planets-qml-styledslider-qml.html
  835. share/doc/qt5/qt3d/qt3d-planets-qml-suneffect-qml.html
  836. share/doc/qt5/qt3d/qt3d-render-qmlmodule.html
  837. share/doc/qt5/qt3d/qt3d-scene2d-example.html
  838. share/doc/qt5/qt3d/qt3d-scene2d-logocontrols-qml.html
  839. share/doc/qt5/qt3d/qt3d-scene2d-main-cpp.html
  840. share/doc/qt5/qt3d/qt3d-scene2d-main-qml.html
  841. share/doc/qt5/qt3d/qt3d-scene2d-qmlmodule.html
  842. share/doc/qt5/qt3d/qt3d-scene2d-scene2d-pro.html
  843. share/doc/qt5/qt3d/qt3d-scene2d-scene2d-qrc.html
  844. share/doc/qt5/qt3d/qt3d-scene3d-animatedentity-qml.html
  845. share/doc/qt5/qt3d/qt3d-scene3d-example.html
  846. share/doc/qt5/qt3d/qt3d-scene3d-main-cpp.html
  847. share/doc/qt5/qt3d/qt3d-scene3d-main-qml.html
  848. share/doc/qt5/qt3d/qt3d-scene3d-scene3d-pro.html
  849. share/doc/qt5/qt3d/qt3d-scene3d-scene3d-qrc.html
  850. share/doc/qt5/qt3d/qt3d-shadow-map-qml-adseffect-qml.html
  851. share/doc/qt5/qt3d/qt3d-shadow-map-qml-adsmaterial-qml.html
  852. share/doc/qt5/qt3d/qt3d-shadow-map-qml-example.html
  853. share/doc/qt5/qt3d/qt3d-shadow-map-qml-groundplane-qml.html
  854. share/doc/qt5/qt3d/qt3d-shadow-map-qml-main-cpp.html
  855. share/doc/qt5/qt3d/qt3d-shadow-map-qml-main-qml.html
  856. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-ads-vert.html
  857. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-es3-ads-vert.html
  858. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-es3-shadowmap-vert.html
  859. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-shadowmap-vert.html
  860. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadow-map-qml-pro.html
  861. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadow-map-qml-qrc.html
  862. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadowmapframegraph-qml.html
  863. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadowmaplight-qml.html
  864. share/doc/qt5/qt3d/qt3d-shadow-map-qml-toyplane-qml.html
  865. share/doc/qt5/qt3d/qt3d-shadow-map-qml-trefoil-qml.html
  866. share/doc/qt5/qt3d/qt3d-simple-cpp-example.html
  867. share/doc/qt5/qt3d/qt3d-simple-cpp-main-cpp.html
  868. share/doc/qt5/qt3d/qt3d-simple-cpp-orbittransformcontroller-cpp.html
  869. share/doc/qt5/qt3d/qt3d-simple-cpp-orbittransformcontroller-h.html
  870. share/doc/qt5/qt3d/qt3d-simple-cpp-simple-cpp-pro.html
  871. share/doc/qt5/qt3d/qt3d-simple-qml-cameracontroller-qml.html
  872. share/doc/qt5/qt3d/qt3d-simple-qml-example.html
  873. share/doc/qt5/qt3d/qt3d-simple-qml-main-cpp.html
  874. share/doc/qt5/qt3d/qt3d-simple-qml-main-qml.html
  875. share/doc/qt5/qt3d/qt3d-simple-qml-simple-qml-pro.html
  876. share/doc/qt5/qt3d/qt3d-simple-qml-simple-qml-qrc.html
  877. share/doc/qt5/qt3d/qt3d-simplecustommaterial-example.html
  878. share/doc/qt5/qt3d/qt3d-simplecustommaterial-main-cpp.html
  879. share/doc/qt5/qt3d/qt3d-simplecustommaterial-main-qml.html
  880. share/doc/qt5/qt3d/qt3d-simplecustommaterial-models-qrc.html
  881. share/doc/qt5/qt3d/qt3d-simplecustommaterial-planemodel-qml.html
  882. share/doc/qt5/qt3d/qt3d-simplecustommaterial-qml-qrc.html
  883. share/doc/qt5/qt3d/qt3d-simplecustommaterial-sceneroot-qml.html
  884. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-es2-simplecolor-vert.html
  885. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-gl3-simplecolor-vert.html
  886. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-qrc.html
  887. share/doc/qt5/qt3d/qt3d-simplecustommaterial-simplecustommaterial-pro.html
  888. share/doc/qt5/qt3d/qt3d-simplecustommaterial-simplematerial-qml.html
  889. share/doc/qt5/qt3d/qt3d-simplecustommaterial-textures-qrc.html
  890. share/doc/qt5/qt3d/qt3d-wave-background-qml.html
  891. share/doc/qt5/qt3d/qt3d-wave-backgroundeffect-qml.html
  892. share/doc/qt5/qt3d/qt3d-wave-basiccamera-qml.html
  893. share/doc/qt5/qt3d/qt3d-wave-example.html
  894. share/doc/qt5/qt3d/qt3d-wave-main-cpp.html
  895. share/doc/qt5/qt3d/qt3d-wave-main-qml.html
  896. share/doc/qt5/qt3d/qt3d-wave-shaders-background-vert.html
  897. share/doc/qt5/qt3d/qt3d-wave-shaders-ribbon-vert.html
  898. share/doc/qt5/qt3d/qt3d-wave-shaders-robustwireframe-geom.html
  899. share/doc/qt5/qt3d/qt3d-wave-wave-pro.html
  900. share/doc/qt5/qt3d/qt3d-wave-wave-qml.html
  901. share/doc/qt5/qt3d/qt3d-wave-wave-qrc.html
  902. share/doc/qt5/qt3d/qt3d-wave-waveeffect-qml.html
  903. share/doc/qt5/qt3d/qt3d-wave-waveforwardrenderer-qml.html
  904. share/doc/qt5/qt3d/qt3d-wave-wavematerial-qml.html
  905. share/doc/qt5/qt3d/qt3d-widgets-scene3d-example.html
  906. share/doc/qt5/qt3d/qt3d-widgets-scene3d-main-cpp.html
  907. share/doc/qt5/qt3d/qt3d-widgets-scene3d-widgets-scene3d-pro.html
  908. share/doc/qt5/qt3d/qt3d-widgets-scene3d-widgets-scene3d-qrc.html
  909. share/doc/qt5/qt3d/qt3d-wireframe-basiccamera-qml.html
  910. share/doc/qt5/qt3d/qt3d-wireframe-example.html
  911. share/doc/qt5/qt3d/qt3d-wireframe-main-cpp.html
  912. share/doc/qt5/qt3d/qt3d-wireframe-main-qml.html
  913. share/doc/qt5/qt3d/qt3d-wireframe-shaders-robustwireframe-geom.html
  914. share/doc/qt5/qt3d/qt3d-wireframe-shaders-robustwireframe-vert.html
  915. share/doc/qt5/qt3d/qt3d-wireframe-trefoilknot-qml.html
  916. share/doc/qt5/qt3d/qt3d-wireframe-wireframe-pro.html
  917. share/doc/qt5/qt3d/qt3d-wireframe-wireframe-qrc.html
  918. share/doc/qt5/qt3d/qt3d-wireframe-wireframeeffect-qml.html
  919. share/doc/qt5/qt3d/qt3d-wireframe-wireframematerial-qml.html
  920. share/doc/qt5/qt3d/qt3d.index
  921. share/doc/qt5/qt3d/qt3d.qhp
  922. share/doc/qt5/qt3d/qt3d.qhp.sha1
  923. share/doc/qt5/qt3d/qt3d.tags
  924. share/doc/qt5/qt3d/qt3danimation-module.html
  925. share/doc/qt5/qt3d/qt3danimation-qabstractanimation-members.html
  926. share/doc/qt5/qt3d/qt3danimation-qabstractanimation.html
  927. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip-members.html
  928. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip.html
  929. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator-members.html
  930. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator.html
  931. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode-members.html
  932. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode.html
  933. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend-members.html
  934. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend.html
  935. share/doc/qt5/qt3d/qt3danimation-qanimationaspect-members.html
  936. share/doc/qt5/qt3d/qt3danimation-qanimationaspect.html
  937. share/doc/qt5/qt3d/qt3danimation-qanimationclip-members.html
  938. share/doc/qt5/qt3d/qt3danimation-qanimationclip.html
  939. share/doc/qt5/qt3d/qt3danimation-qanimationclipdata-members.html
  940. share/doc/qt5/qt3d/qt3danimation-qanimationclipdata.html
  941. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader-members.html
  942. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader.html
  943. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller-members.html
  944. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller.html
  945. share/doc/qt5/qt3d/qt3danimation-qanimationgroup-members.html
  946. share/doc/qt5/qt3d/qt3danimation-qanimationgroup.html
  947. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator-members.html
  948. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator.html
  949. share/doc/qt5/qt3d/qt3danimation-qchannel-members.html
  950. share/doc/qt5/qt3d/qt3danimation-qchannel.html
  951. share/doc/qt5/qt3d/qt3danimation-qchannelcomponent-members.html
  952. share/doc/qt5/qt3d/qt3danimation-qchannelcomponent.html
  953. share/doc/qt5/qt3d/qt3danimation-qchannelmapper-members.html
  954. share/doc/qt5/qt3d/qt3danimation-qchannelmapper.html
  955. share/doc/qt5/qt3d/qt3danimation-qchannelmapping-members.html
  956. share/doc/qt5/qt3d/qt3danimation-qchannelmapping.html
  957. share/doc/qt5/qt3d/qt3danimation-qclipanimator-members.html
  958. share/doc/qt5/qt3d/qt3danimation-qclipanimator.html
  959. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchange-members.html
  960. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchange.html
  961. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchangebase-members.html
  962. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchangebase.html
  963. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue-members.html
  964. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue.html
  965. share/doc/qt5/qt3d/qt3danimation-qkeyframe-members.html
  966. share/doc/qt5/qt3d/qt3danimation-qkeyframe.html
  967. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation-members.html
  968. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation.html
  969. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend-members.html
  970. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend.html
  971. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation-members.html
  972. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation.html
  973. share/doc/qt5/qt3d/qt3danimation-qmorphtarget-members.html
  974. share/doc/qt5/qt3d/qt3danimation-qmorphtarget.html
  975. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation-members.html
  976. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation.html
  977. share/doc/qt5/qt3d/qt3danimation.html
  978. share/doc/qt5/qt3d/qt3dcore-module.html
  979. share/doc/qt5/qt3d/qt3dcore-qabstractaspect-members.html
  980. share/doc/qt5/qt3d/qt3dcore-qabstractaspect.html
  981. share/doc/qt5/qt3d/qt3dcore-qaspectengine-members.html
  982. share/doc/qt5/qt3d/qt3dcore-qaspectengine.html
  983. share/doc/qt5/qt3d/qt3dcore-qaspectjob-members.html
  984. share/doc/qt5/qt3d/qt3dcore-qaspectjob.html
  985. share/doc/qt5/qt3d/qt3dcore-qbackendnode-members.html
  986. share/doc/qt5/qt3d/qt3dcore-qbackendnode.html
  987. share/doc/qt5/qt3d/qt3dcore-qbackendnodemapper-members.html
  988. share/doc/qt5/qt3d/qt3dcore-qbackendnodemapper.html
  989. share/doc/qt5/qt3d/qt3dcore-qcomponent-members.html
  990. share/doc/qt5/qt3d/qt3dcore-qcomponent.html
  991. share/doc/qt5/qt3d/qt3dcore-qcomponentaddedchange-members.html
  992. share/doc/qt5/qt3d/qt3dcore-qcomponentaddedchange.html
  993. share/doc/qt5/qt3d/qt3dcore-qcomponentremovedchange-members.html
  994. share/doc/qt5/qt3d/qt3dcore-qcomponentremovedchange.html
  995. share/doc/qt5/qt3d/qt3dcore-qdynamicpropertyupdatedchange-members.html
  996. share/doc/qt5/qt3d/qt3dcore-qdynamicpropertyupdatedchange.html
  997. share/doc/qt5/qt3d/qt3dcore-qentity-members.html
  998. share/doc/qt5/qt3d/qt3dcore-qentity.html
  999. share/doc/qt5/qt3d/qt3dcore-qnode-members.html
  1000. share/doc/qt5/qt3d/qt3dcore-qnode.html
  1001. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchange-members.html
  1002. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchange.html
  1003. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchangebase-members.html
  1004. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchangebase.html
  1005. share/doc/qt5/qt3d/qt3dcore-qnodedestroyedchange-members.html
  1006. share/doc/qt5/qt3d/qt3dcore-qnodedestroyedchange.html
  1007. share/doc/qt5/qt3d/qt3dcore-qnodeid-members.html
  1008. share/doc/qt5/qt3d/qt3dcore-qnodeid.html
  1009. share/doc/qt5/qt3d/qt3dcore-qnodeidtypepair-members.html
  1010. share/doc/qt5/qt3d/qt3dcore-qnodeidtypepair.html
  1011. share/doc/qt5/qt3d/qt3dcore-qpropertynodeaddedchange-members.html
  1012. share/doc/qt5/qt3d/qt3dcore-qpropertynodeaddedchange.html
  1013. share/doc/qt5/qt3d/qt3dcore-qpropertynoderemovedchange-members.html
  1014. share/doc/qt5/qt3d/qt3dcore-qpropertynoderemovedchange.html
  1015. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchange-members.html
  1016. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchange.html
  1017. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchangebase-members.html
  1018. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchangebase.html
  1019. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchange-members.html
  1020. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchange.html
  1021. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchangebase-members.html
  1022. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchangebase.html
  1023. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchange-members.html
  1024. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchange.html
  1025. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchangebase-members.html
  1026. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchangebase.html
  1027. share/doc/qt5/qt3d/qt3dcore-qscenechange-members.html
  1028. share/doc/qt5/qt3d/qt3dcore-qscenechange.html
  1029. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyupdatedchangebase-members.html
  1030. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyupdatedchangebase.html
  1031. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
  1032. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase.html
  1033. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
  1034. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase.html
  1035. share/doc/qt5/qt3d/qt3dcore-qtransform-members.html
  1036. share/doc/qt5/qt3d/qt3dcore-qtransform.html
  1037. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
  1038. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine.html
  1039. share/doc/qt5/qt3d/qt3dcore-quick.html
  1040. share/doc/qt5/qt3d/qt3dcore.html
  1041. share/doc/qt5/qt3d/qt3dextras-module.html
  1042. share/doc/qt5/qt3d/qt3dextras-qconegeometry-members.html
  1043. share/doc/qt5/qt3d/qt3dextras-qconegeometry.html
  1044. share/doc/qt5/qt3d/qt3dextras-qconemesh-members.html
  1045. share/doc/qt5/qt3d/qt3dextras-qconemesh.html
  1046. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry-members.html
  1047. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry.html
  1048. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh-members.html
  1049. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh.html
  1050. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry-members.html
  1051. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry.html
  1052. share/doc/qt5/qt3d/qt3dextras-qcylindermesh-members.html
  1053. share/doc/qt5/qt3d/qt3dextras-qcylindermesh.html
  1054. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial-members.html
  1055. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial.html
  1056. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
  1057. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
  1058. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry-members.html
  1059. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry.html
  1060. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh-members.html
  1061. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh.html
  1062. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
  1063. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller.html
  1064. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer-members.html
  1065. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer-obsolete.html
  1066. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer.html
  1067. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial-members.html
  1068. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial.html
  1069. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial-members.html
  1070. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial.html
  1071. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial-members.html
  1072. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial.html
  1073. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
  1074. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
  1075. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
  1076. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
  1077. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
  1078. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
  1079. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller-members.html
  1080. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller.html
  1081. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial-members.html
  1082. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial.html
  1083. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial-members.html
  1084. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial.html
  1085. share/doc/qt5/qt3d/qt3dextras-qphongmaterial-members.html
  1086. share/doc/qt5/qt3d/qt3dextras-qphongmaterial.html
  1087. share/doc/qt5/qt3d/qt3dextras-qplanegeometry-members.html
  1088. share/doc/qt5/qt3d/qt3dextras-qplanegeometry.html
  1089. share/doc/qt5/qt3d/qt3dextras-qplanemesh-members.html
  1090. share/doc/qt5/qt3d/qt3dextras-qplanemesh.html
  1091. share/doc/qt5/qt3d/qt3dextras-qskyboxentity-members.html
  1092. share/doc/qt5/qt3d/qt3dextras-qskyboxentity.html
  1093. share/doc/qt5/qt3d/qt3dextras-qspheregeometry-members.html
  1094. share/doc/qt5/qt3d/qt3dextras-qspheregeometry.html
  1095. share/doc/qt5/qt3d/qt3dextras-qspheremesh-members.html
  1096. share/doc/qt5/qt3d/qt3dextras-qspheremesh.html
  1097. share/doc/qt5/qt3d/qt3dextras-qt3dwindow-members.html
  1098. share/doc/qt5/qt3d/qt3dextras-qt3dwindow.html
  1099. share/doc/qt5/qt3d/qt3dextras-qtext2dentity-members.html
  1100. share/doc/qt5/qt3d/qt3dextras-qtext2dentity.html
  1101. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial-members.html
  1102. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial.html
  1103. share/doc/qt5/qt3d/qt3dextras-qtexturematerial-members.html
  1104. share/doc/qt5/qt3d/qt3dextras-qtexturematerial.html
  1105. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry-members.html
  1106. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry.html
  1107. share/doc/qt5/qt3d/qt3dextras-qtorusmesh-members.html
  1108. share/doc/qt5/qt3d/qt3dextras-qtorusmesh.html
  1109. share/doc/qt5/qt3d/qt3dextras.html
  1110. share/doc/qt5/qt3d/qt3dinput-module.html
  1111. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput-members.html
  1112. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput.html
  1113. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput-members.html
  1114. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput.html
  1115. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice-members.html
  1116. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice.html
  1117. share/doc/qt5/qt3d/qt3dinput-qaction-members.html
  1118. share/doc/qt5/qt3d/qt3dinput-qaction.html
  1119. share/doc/qt5/qt3d/qt3dinput-qactioninput-members.html
  1120. share/doc/qt5/qt3d/qt3dinput-qactioninput.html
  1121. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput-members.html
  1122. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput.html
  1123. share/doc/qt5/qt3d/qt3dinput-qaxis-members.html
  1124. share/doc/qt5/qt3d/qt3dinput-qaxis.html
  1125. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator-members.html
  1126. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator.html
  1127. share/doc/qt5/qt3d/qt3dinput-qaxissetting-members.html
  1128. share/doc/qt5/qt3d/qt3dinput-qaxissetting.html
  1129. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput-members.html
  1130. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput.html
  1131. share/doc/qt5/qt3d/qt3dinput-qinputaspect-members.html
  1132. share/doc/qt5/qt3d/qt3dinput-qinputaspect.html
  1133. share/doc/qt5/qt3d/qt3dinput-qinputchord-members.html
  1134. share/doc/qt5/qt3d/qt3dinput-qinputchord.html
  1135. share/doc/qt5/qt3d/qt3dinput-qinputsequence-members.html
  1136. share/doc/qt5/qt3d/qt3dinput-qinputsequence.html
  1137. share/doc/qt5/qt3d/qt3dinput-qinputsettings-members.html
  1138. share/doc/qt5/qt3d/qt3dinput-qinputsettings.html
  1139. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice-members.html
  1140. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice.html
  1141. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler-members.html
  1142. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler.html
  1143. share/doc/qt5/qt3d/qt3dinput-qkeyevent-members.html
  1144. share/doc/qt5/qt3d/qt3dinput-qkeyevent.html
  1145. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice-members.html
  1146. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice.html
  1147. share/doc/qt5/qt3d/qt3dinput-qmousedevice-members.html
  1148. share/doc/qt5/qt3d/qt3dinput-qmousedevice.html
  1149. share/doc/qt5/qt3d/qt3dinput-qmouseevent-members.html
  1150. share/doc/qt5/qt3d/qt3dinput-qmouseevent.html
  1151. share/doc/qt5/qt3d/qt3dinput-qmousehandler-members.html
  1152. share/doc/qt5/qt3d/qt3dinput-qmousehandler.html
  1153. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchange-members.html
  1154. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchange.html
  1155. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchangebase-members.html
  1156. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchangebase.html
  1157. share/doc/qt5/qt3d/qt3dinput-qwheelevent-members.html
  1158. share/doc/qt5/qt3d/qt3dinput-qwheelevent.html
  1159. share/doc/qt5/qt3d/qt3dinput.html
  1160. share/doc/qt5/qt3d/qt3dlogic-logic.html
  1161. share/doc/qt5/qt3d/qt3dlogic-module.html
  1162. share/doc/qt5/qt3d/qt3dlogic-qframeaction-members.html
  1163. share/doc/qt5/qt3d/qt3dlogic-qframeaction.html
  1164. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect-members.html
  1165. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect.html
  1166. share/doc/qt5/qt3d/qt3dlogic.html
  1167. share/doc/qt5/qt3d/qt3drender-assimphelper.html
  1168. share/doc/qt5/qt3d/qt3drender-assimpimporter-members.html
  1169. share/doc/qt5/qt3d/qt3drender-assimpimporter.html
  1170. share/doc/qt5/qt3d/qt3drender-fbxgeometryloader-members.html
  1171. share/doc/qt5/qt3d/qt3drender-fbxgeometryloader.html
  1172. share/doc/qt5/qt3d/qt3drender-framegraph.html
  1173. share/doc/qt5/qt3d/qt3drender-functortype-members.html
  1174. share/doc/qt5/qt3d/qt3drender-functortype.html
  1175. share/doc/qt5/qt3d/qt3drender-geometry.html
  1176. share/doc/qt5/qt3d/qt3drender-gltfexporter-gltfoptions-members.html
  1177. share/doc/qt5/qt3d/qt3drender-gltfexporter-gltfoptions.html
  1178. share/doc/qt5/qt3d/qt3drender-gltfexporter-members.html
  1179. share/doc/qt5/qt3d/qt3drender-gltfexporter.html
  1180. share/doc/qt5/qt3d/qt3drender-gltfgeometryloader-members.html
  1181. share/doc/qt5/qt3d/qt3drender-gltfgeometryloader.html
  1182. share/doc/qt5/qt3d/qt3drender-gltfimporter-members.html
  1183. share/doc/qt5/qt3d/qt3drender-gltfimporter.html
  1184. share/doc/qt5/qt3d/qt3drender-module.html
  1185. share/doc/qt5/qt3d/qt3drender-objgeometryloader-members.html
  1186. share/doc/qt5/qt3d/qt3drender-objgeometryloader.html
  1187. share/doc/qt5/qt3d/qt3drender-plygeometryloader-element-members.html
  1188. share/doc/qt5/qt3d/qt3drender-plygeometryloader-element.html
  1189. share/doc/qt5/qt3d/qt3drender-plygeometryloader-members.html
  1190. share/doc/qt5/qt3d/qt3drender-plygeometryloader-property-members.html
  1191. share/doc/qt5/qt3d/qt3drender-plygeometryloader-property.html
  1192. share/doc/qt5/qt3d/qt3drender-plygeometryloader.html
  1193. share/doc/qt5/qt3d/qt3drender-propertyreaderinterface-members.html
  1194. share/doc/qt5/qt3d/qt3drender-propertyreaderinterface.html
  1195. share/doc/qt5/qt3d/qt3drender-protips.html
  1196. share/doc/qt5/qt3d/qt3drender-qabstractfunctor-members.html
  1197. share/doc/qt5/qt3d/qt3drender-qabstractfunctor.html
  1198. share/doc/qt5/qt3d/qt3drender-qabstractlight-members.html
  1199. share/doc/qt5/qt3d/qt3drender-qabstractlight.html
  1200. share/doc/qt5/qt3d/qt3drender-qabstracttexture-members.html
  1201. share/doc/qt5/qt3d/qt3drender-qabstracttexture.html
  1202. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage-members.html
  1203. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage.html
  1204. share/doc/qt5/qt3d/qt3drender-qalphacoverage-members.html
  1205. share/doc/qt5/qt3d/qt3drender-qalphacoverage.html
  1206. share/doc/qt5/qt3d/qt3drender-qalphatest-members.html
  1207. share/doc/qt5/qt3d/qt3drender-qalphatest.html
  1208. share/doc/qt5/qt3d/qt3drender-qattribute-members.html
  1209. share/doc/qt5/qt3d/qt3drender-qattribute.html
  1210. share/doc/qt5/qt3d/qt3drender-qblendequation-members.html
  1211. share/doc/qt5/qt3d/qt3drender-qblendequation.html
  1212. share/doc/qt5/qt3d/qt3drender-qblendequationarguments-members.html
  1213. share/doc/qt5/qt3d/qt3drender-qblendequationarguments.html
  1214. share/doc/qt5/qt3d/qt3drender-qbuffer-members.html
  1215. share/doc/qt5/qt3d/qt3drender-qbuffer.html
  1216. share/doc/qt5/qt3d/qt3drender-qbuffercapture-members.html
  1217. share/doc/qt5/qt3d/qt3drender-qbuffercapture.html
  1218. share/doc/qt5/qt3d/qt3drender-qbufferdatagenerator-members.html
  1219. share/doc/qt5/qt3d/qt3drender-qbufferdatagenerator.html
  1220. share/doc/qt5/qt3d/qt3drender-qcamera-members.html
  1221. share/doc/qt5/qt3d/qt3drender-qcamera.html
  1222. share/doc/qt5/qt3d/qt3drender-qcameralens-members.html
  1223. share/doc/qt5/qt3d/qt3drender-qcameralens.html
  1224. share/doc/qt5/qt3d/qt3drender-qcameraselector-members.html
  1225. share/doc/qt5/qt3d/qt3drender-qcameraselector.html
  1226. share/doc/qt5/qt3d/qt3drender-qclearbuffers-members.html
  1227. share/doc/qt5/qt3d/qt3drender-qclearbuffers.html
  1228. share/doc/qt5/qt3d/qt3drender-qclipplane-members.html
  1229. share/doc/qt5/qt3d/qt3drender-qclipplane.html
  1230. share/doc/qt5/qt3d/qt3drender-qcolormask-members.html
  1231. share/doc/qt5/qt3d/qt3drender-qcolormask.html
  1232. share/doc/qt5/qt3d/qt3drender-qcomputecommand-members.html
  1233. share/doc/qt5/qt3d/qt3drender-qcomputecommand.html
  1234. share/doc/qt5/qt3d/qt3drender-qcullface-members.html
  1235. share/doc/qt5/qt3d/qt3drender-qcullface.html
  1236. share/doc/qt5/qt3d/qt3drender-qdepthtest-members.html
  1237. share/doc/qt5/qt3d/qt3drender-qdepthtest.html
  1238. share/doc/qt5/qt3d/qt3drender-qdirectionallight-members.html
  1239. share/doc/qt5/qt3d/qt3drender-qdirectionallight.html
  1240. share/doc/qt5/qt3d/qt3drender-qdispatchcompute-members.html
  1241. share/doc/qt5/qt3d/qt3drender-qdispatchcompute.html
  1242. share/doc/qt5/qt3d/qt3drender-qdithering-members.html
  1243. share/doc/qt5/qt3d/qt3drender-qdithering.html
  1244. share/doc/qt5/qt3d/qt3drender-qeffect-members.html
  1245. share/doc/qt5/qt3d/qt3drender-qeffect.html
  1246. share/doc/qt5/qt3d/qt3drender-qenvironmentlight-members.html
  1247. share/doc/qt5/qt3d/qt3drender-qenvironmentlight.html
  1248. share/doc/qt5/qt3d/qt3drender-qfilterkey-members.html
  1249. share/doc/qt5/qt3d/qt3drender-qfilterkey.html
  1250. share/doc/qt5/qt3d/qt3drender-qframegraphnode-members.html
  1251. share/doc/qt5/qt3d/qt3drender-qframegraphnode.html
  1252. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchange-members.html
  1253. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchange.html
  1254. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchangebase-members.html
  1255. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchangebase.html
  1256. share/doc/qt5/qt3d/qt3drender-qfrontface-members.html
  1257. share/doc/qt5/qt3d/qt3drender-qfrontface.html
  1258. share/doc/qt5/qt3d/qt3drender-qfrustumculling-members.html
  1259. share/doc/qt5/qt3d/qt3drender-qfrustumculling.html
  1260. share/doc/qt5/qt3d/qt3drender-qgeometry-members.html
  1261. share/doc/qt5/qt3d/qt3drender-qgeometry.html
  1262. share/doc/qt5/qt3d/qt3drender-qgeometryfactory-members.html
  1263. share/doc/qt5/qt3d/qt3drender-qgeometryfactory.html
  1264. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer-members.html
  1265. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer.html
  1266. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter-members.html
  1267. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter.html
  1268. share/doc/qt5/qt3d/qt3drender-qlayer-members.html
  1269. share/doc/qt5/qt3d/qt3drender-qlayer.html
  1270. share/doc/qt5/qt3d/qt3drender-qlayerfilter-members.html
  1271. share/doc/qt5/qt3d/qt3drender-qlayerfilter.html
  1272. share/doc/qt5/qt3d/qt3drender-qlevelofdetail-members.html
  1273. share/doc/qt5/qt3d/qt3drender-qlevelofdetail.html
  1274. share/doc/qt5/qt3d/qt3drender-qlevelofdetailboundingsphere-members.html
  1275. share/doc/qt5/qt3d/qt3drender-qlevelofdetailboundingsphere.html
  1276. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch-members.html
  1277. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch.html
  1278. share/doc/qt5/qt3d/qt3drender-qmaterial-members.html
  1279. share/doc/qt5/qt3d/qt3drender-qmaterial.html
  1280. share/doc/qt5/qt3d/qt3drender-qmemorybarrier-members.html
  1281. share/doc/qt5/qt3d/qt3drender-qmemorybarrier.html
  1282. share/doc/qt5/qt3d/qt3drender-qmesh-members.html
  1283. share/doc/qt5/qt3d/qt3drender-qmesh.html
  1284. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing-members.html
  1285. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing.html
  1286. share/doc/qt5/qt3d/qt3drender-qnodepthmask-members.html
  1287. share/doc/qt5/qt3d/qt3drender-qnodepthmask.html
  1288. share/doc/qt5/qt3d/qt3drender-qnodraw-members.html
  1289. share/doc/qt5/qt3d/qt3drender-qnodraw.html
  1290. share/doc/qt5/qt3d/qt3drender-qobjectpicker-members.html
  1291. share/doc/qt5/qt3d/qt3drender-qobjectpicker.html
  1292. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage-members.html
  1293. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage.html
  1294. share/doc/qt5/qt3d/qt3drender-qparameter-members.html
  1295. share/doc/qt5/qt3d/qt3drender-qparameter.html
  1296. share/doc/qt5/qt3d/qt3drender-qpickevent-members.html
  1297. share/doc/qt5/qt3d/qt3drender-qpickevent.html
  1298. share/doc/qt5/qt3d/qt3drender-qpickingsettings-members.html
  1299. share/doc/qt5/qt3d/qt3drender-qpickingsettings.html
  1300. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent-members.html
  1301. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent.html
  1302. share/doc/qt5/qt3d/qt3drender-qpointlight-members.html
  1303. share/doc/qt5/qt3d/qt3drender-qpointlight.html
  1304. share/doc/qt5/qt3d/qt3drender-qpointsize-members.html
  1305. share/doc/qt5/qt3d/qt3drender-qpointsize.html
  1306. share/doc/qt5/qt3d/qt3drender-qpolygonoffset-members.html
  1307. share/doc/qt5/qt3d/qt3drender-qpolygonoffset.html
  1308. share/doc/qt5/qt3d/qt3drender-qrenderaspect-members.html
  1309. share/doc/qt5/qt3d/qt3drender-qrenderaspect.html
  1310. share/doc/qt5/qt3d/qt3drender-qrendercapture-members.html
  1311. share/doc/qt5/qt3d/qt3drender-qrendercapture.html
  1312. share/doc/qt5/qt3d/qt3drender-qrendercapturereply-members.html
  1313. share/doc/qt5/qt3d/qt3drender-qrendercapturereply.html
  1314. share/doc/qt5/qt3d/qt3drender-qrenderpass-members.html
  1315. share/doc/qt5/qt3d/qt3drender-qrenderpass.html
  1316. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter-members.html
  1317. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter.html
  1318. share/doc/qt5/qt3d/qt3drender-qrendersettings-members.html
  1319. share/doc/qt5/qt3d/qt3drender-qrendersettings.html
  1320. share/doc/qt5/qt3d/qt3drender-qrenderstate-members.html
  1321. share/doc/qt5/qt3d/qt3drender-qrenderstate.html
  1322. share/doc/qt5/qt3d/qt3drender-qrenderstateset-members.html
  1323. share/doc/qt5/qt3d/qt3drender-qrenderstateset.html
  1324. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector-members.html
  1325. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector.html
  1326. share/doc/qt5/qt3d/qt3drender-qrendertarget-members.html
  1327. share/doc/qt5/qt3d/qt3drender-qrendertarget.html
  1328. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput-members.html
  1329. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput.html
  1330. share/doc/qt5/qt3d/qt3drender-qrendertargetselector-members.html
  1331. share/doc/qt5/qt3d/qt3drender-qrendertargetselector.html
  1332. share/doc/qt5/qt3d/qt3drender-qsceneloader-members.html
  1333. share/doc/qt5/qt3d/qt3drender-qsceneloader.html
  1334. share/doc/qt5/qt3d/qt3drender-qscissortest-members.html
  1335. share/doc/qt5/qt3d/qt3drender-qscissortest.html
  1336. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap-members.html
  1337. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap.html
  1338. share/doc/qt5/qt3d/qt3drender-qshaderdata-members.html
  1339. share/doc/qt5/qt3d/qt3drender-qshaderdata.html
  1340. share/doc/qt5/qt3d/qt3drender-qshaderprogram-members.html
  1341. share/doc/qt5/qt3d/qt3drender-qshaderprogram.html
  1342. share/doc/qt5/qt3d/qt3drender-qsortpolicy-members.html
  1343. share/doc/qt5/qt3d/qt3drender-qsortpolicy.html
  1344. share/doc/qt5/qt3d/qt3drender-qspotlight-members.html
  1345. share/doc/qt5/qt3d/qt3drender-qspotlight.html
  1346. share/doc/qt5/qt3d/qt3drender-qstencilmask-members.html
  1347. share/doc/qt5/qt3d/qt3drender-qstencilmask.html
  1348. share/doc/qt5/qt3d/qt3drender-qstenciloperation-members.html
  1349. share/doc/qt5/qt3d/qt3drender-qstenciloperation.html
  1350. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments-members.html
  1351. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments.html
  1352. share/doc/qt5/qt3d/qt3drender-qstenciltest-members.html
  1353. share/doc/qt5/qt3d/qt3drender-qstenciltest.html
  1354. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments-members.html
  1355. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments.html
  1356. share/doc/qt5/qt3d/qt3drender-qtechnique-members.html
  1357. share/doc/qt5/qt3d/qt3drender-qtechnique.html
  1358. share/doc/qt5/qt3d/qt3drender-qtechniquefilter-members.html
  1359. share/doc/qt5/qt3d/qt3drender-qtechniquefilter.html
  1360. share/doc/qt5/qt3d/qt3drender-qtexture1d-members.html
  1361. share/doc/qt5/qt3d/qt3drender-qtexture1d.html
  1362. share/doc/qt5/qt3d/qt3drender-qtexture1darray-members.html
  1363. share/doc/qt5/qt3d/qt3drender-qtexture1darray.html
  1364. share/doc/qt5/qt3d/qt3drender-qtexture2d-members.html
  1365. share/doc/qt5/qt3d/qt3drender-qtexture2d.html
  1366. share/doc/qt5/qt3d/qt3drender-qtexture2darray-members.html
  1367. share/doc/qt5/qt3d/qt3drender-qtexture2darray.html
  1368. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample-members.html
  1369. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample.html
  1370. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
  1371. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray.html
  1372. share/doc/qt5/qt3d/qt3drender-qtexture3d-members.html
  1373. share/doc/qt5/qt3d/qt3drender-qtexture3d.html
  1374. share/doc/qt5/qt3d/qt3drender-qtexturebuffer-members.html
  1375. share/doc/qt5/qt3d/qt3drender-qtexturebuffer.html
  1376. share/doc/qt5/qt3d/qt3drender-qtexturecubemap-members.html
  1377. share/doc/qt5/qt3d/qt3drender-qtexturecubemap.html
  1378. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray-members.html
  1379. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray.html
  1380. share/doc/qt5/qt3d/qt3drender-qtexturedata-members.html
  1381. share/doc/qt5/qt3d/qt3drender-qtexturedata.html
  1382. share/doc/qt5/qt3d/qt3drender-qtexturegenerator-members.html
  1383. share/doc/qt5/qt3d/qt3drender-qtexturegenerator.html
  1384. share/doc/qt5/qt3d/qt3drender-qtextureimage-members.html
  1385. share/doc/qt5/qt3d/qt3drender-qtextureimage.html
  1386. share/doc/qt5/qt3d/qt3drender-qtextureimagedata-members.html
  1387. share/doc/qt5/qt3d/qt3drender-qtextureimagedata.html
  1388. share/doc/qt5/qt3d/qt3drender-qtextureimagedatagenerator-members.html
  1389. share/doc/qt5/qt3d/qt3drender-qtextureimagedatagenerator.html
  1390. share/doc/qt5/qt3d/qt3drender-qtextureloader-members.html
  1391. share/doc/qt5/qt3d/qt3drender-qtextureloader.html
  1392. share/doc/qt5/qt3d/qt3drender-qtexturerectangle-members.html
  1393. share/doc/qt5/qt3d/qt3drender-qtexturerectangle.html
  1394. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode-members.html
  1395. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode.html
  1396. share/doc/qt5/qt3d/qt3drender-quick-qscene2d-members.html
  1397. share/doc/qt5/qt3d/qt3drender-quick-qscene2d.html
  1398. share/doc/qt5/qt3d/qt3drender-qviewport-members.html
  1399. share/doc/qt5/qt3d/qt3drender-qviewport.html
  1400. share/doc/qt5/qt3d/qt3drender-render.html
  1401. share/doc/qt5/qt3d/qt3drender-stlgeometryloader-members.html
  1402. share/doc/qt5/qt3d/qt3drender-stlgeometryloader.html
  1403. share/doc/qt5/qt3d/qt3drender.html
  1404. share/doc/qt5/qt3d/qt3dscene2d-module.html
  1405. share/doc/qt5/qt3d/style/offline-simple.css
  1406. share/doc/qt5/qt3d/style/offline.css
  1407. share/doc/qt5/qtandroidextras.qch
  1408. share/doc/qt5/qtandroidextras/examples-manifest.xml
  1409. share/doc/qt5/qtandroidextras/examples-qtandroidextras.html
  1410. share/doc/qt5/qtandroidextras/images/arrow_bc.png
  1411. share/doc/qt5/qtandroidextras/images/bgrContent.png
  1412. share/doc/qt5/qtandroidextras/images/btn_next.png
  1413. share/doc/qt5/qtandroidextras/images/btn_prev.png
  1414. share/doc/qt5/qtandroidextras/images/bullet_dn.png
  1415. share/doc/qt5/qtandroidextras/images/bullet_sq.png
  1416. share/doc/qt5/qtandroidextras/images/home.png
  1417. share/doc/qt5/qtandroidextras/images/ico_note.png
  1418. share/doc/qt5/qtandroidextras/images/ico_note_attention.png
  1419. share/doc/qt5/qtandroidextras/images/ico_out.png
  1420. share/doc/qt5/qtandroidextras/images/logo.png
  1421. share/doc/qt5/qtandroidextras/images/notification.png
  1422. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/images/happy.png
  1423. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/images/sad.png
  1424. share/doc/qt5/qtandroidextras/qandroidactivityresultreceiver-members.html
  1425. share/doc/qt5/qtandroidextras/qandroidactivityresultreceiver.html
  1426. share/doc/qt5/qtandroidextras/qandroidjnienvironment-members.html
  1427. share/doc/qt5/qtandroidextras/qandroidjnienvironment.html
  1428. share/doc/qt5/qtandroidextras/qandroidjniobject-members.html
  1429. share/doc/qt5/qtandroidextras/qandroidjniobject.html
  1430. share/doc/qt5/qtandroidextras/qtandroid.html
  1431. share/doc/qt5/qtandroidextras/qtandroidextras-index.html
  1432. share/doc/qt5/qtandroidextras/qtandroidextras-module.html
  1433. share/doc/qt5/qtandroidextras/qtandroidextras-notification-android-sources-androidmanifest-xml.html
  1434. share/doc/qt5/qtandroidextras/qtandroidextras-notification-android-sources-src-org-qtproject-example-notification-notificationclient-java.html
  1435. share/doc/qt5/qtandroidextras/qtandroidextras-notification-example.html
  1436. share/doc/qt5/qtandroidextras/qtandroidextras-notification-main-cpp.html
  1437. share/doc/qt5/qtandroidextras/qtandroidextras-notification-main-qrc.html
  1438. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notification-pro.html
  1439. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notificationclient-cpp.html
  1440. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notificationclient-h.html
  1441. share/doc/qt5/qtandroidextras/qtandroidextras-notification-qml-main-qml.html
  1442. share/doc/qt5/qtandroidextras/qtandroidextras.index
  1443. share/doc/qt5/qtandroidextras/qtandroidextras.qhp
  1444. share/doc/qt5/qtandroidextras/qtandroidextras.qhp.sha1
  1445. share/doc/qt5/qtandroidextras/style/offline-simple.css
  1446. share/doc/qt5/qtandroidextras/style/offline.css
  1447. share/doc/qt5/qtassistant.qch
  1448. share/doc/qt5/qtassistant/assistant-custom-help-viewer.html
  1449. share/doc/qt5/qtassistant/assistant-details.html
  1450. share/doc/qt5/qtassistant/assistant-quick-guide.html
  1451. share/doc/qt5/qtassistant/examples-manifest.xml
  1452. share/doc/qt5/qtassistant/examples-qtassistant.html
  1453. share/doc/qt5/qtassistant/images/arrow_bc.png
  1454. share/doc/qt5/qtassistant/images/assistant-assistant.png
  1455. share/doc/qt5/qtassistant/images/assistant-bookmarks.png
  1456. share/doc/qt5/qtassistant/images/assistant-dockwidgets.png
  1457. share/doc/qt5/qtassistant/images/assistant-examples.png
  1458. share/doc/qt5/qtassistant/images/assistant-index.png
  1459. share/doc/qt5/qtassistant/images/assistant-preferences-documentation.png
  1460. share/doc/qt5/qtassistant/images/assistant-preferences-filters.png
  1461. share/doc/qt5/qtassistant/images/assistant-preferences-fonts.png
  1462. share/doc/qt5/qtassistant/images/assistant-preferences-options.png
  1463. share/doc/qt5/qtassistant/images/assistant-search.png
  1464. share/doc/qt5/qtassistant/images/bgrContent.png
  1465. share/doc/qt5/qtassistant/images/btn_next.png
  1466. share/doc/qt5/qtassistant/images/btn_prev.png
  1467. share/doc/qt5/qtassistant/images/bullet_dn.png
  1468. share/doc/qt5/qtassistant/images/bullet_sq.png
  1469. share/doc/qt5/qtassistant/images/home.png
  1470. share/doc/qt5/qtassistant/images/ico_note.png
  1471. share/doc/qt5/qtassistant/images/ico_note_attention.png
  1472. share/doc/qt5/qtassistant/images/ico_out.png
  1473. share/doc/qt5/qtassistant/images/logo.png
  1474. share/doc/qt5/qtassistant/images/simpletextviewer-example.png
  1475. share/doc/qt5/qtassistant/images/simpletextviewer-findfiledialog.png
  1476. share/doc/qt5/qtassistant/images/simpletextviewer-mainwindow.png
  1477. share/doc/qt5/qtassistant/qtassistant-index.html
  1478. share/doc/qt5/qtassistant/qtassistant-remotecontrol-example.html
  1479. share/doc/qt5/qtassistant/qtassistant-remotecontrol-main-cpp.html
  1480. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-cpp.html
  1481. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-h.html
  1482. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-pro.html
  1483. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-qrc.html
  1484. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-ui.html
  1485. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-assistant-cpp.html
  1486. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-assistant-h.html
  1487. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhcp.html
  1488. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhp.html
  1489. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-example.html
  1490. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-findfiledialog-cpp.html
  1491. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-findfiledialog-h.html
  1492. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-main-cpp.html
  1493. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-mainwindow-cpp.html
  1494. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-mainwindow-h.html
  1495. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-simpletextviewer-pro.html
  1496. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-textedit-cpp.html
  1497. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-textedit-h.html
  1498. share/doc/qt5/qtassistant/qtassistant.index
  1499. share/doc/qt5/qtassistant/qtassistant.qhp
  1500. share/doc/qt5/qtassistant/qtassistant.qhp.sha1
  1501. share/doc/qt5/qtassistant/style/offline-simple.css
  1502. share/doc/qt5/qtassistant/style/offline.css
  1503. share/doc/qt5/qtbluetooth.qch
  1504. share/doc/qt5/qtbluetooth/bluetooth-examples.html
  1505. share/doc/qt5/qtbluetooth/examples-manifest.xml
  1506. share/doc/qt5/qtbluetooth/images/arrow_bc.png
  1507. share/doc/qt5/qtbluetooth/images/bgrContent.png
  1508. share/doc/qt5/qtbluetooth/images/btchat-example.png
  1509. share/doc/qt5/qtbluetooth/images/btfiletransfer-example.png
  1510. share/doc/qt5/qtbluetooth/images/btn_next.png
  1511. share/doc/qt5/qtbluetooth/images/btn_prev.png
  1512. share/doc/qt5/qtbluetooth/images/btscanner-example.png
  1513. share/doc/qt5/qtbluetooth/images/bullet_dn.png
  1514. share/doc/qt5/qtbluetooth/images/bullet_sq.png
  1515. share/doc/qt5/qtbluetooth/images/chat-view.png
  1516. share/doc/qt5/qtbluetooth/images/devicescan.png
  1517. share/doc/qt5/qtbluetooth/images/heartgame-result.png
  1518. share/doc/qt5/qtbluetooth/images/heartgame-running.png
  1519. share/doc/qt5/qtbluetooth/images/heartgame-search.png
  1520. share/doc/qt5/qtbluetooth/images/heartgame-start.png
  1521. share/doc/qt5/qtbluetooth/images/home.png
  1522. share/doc/qt5/qtbluetooth/images/ico_note.png
  1523. share/doc/qt5/qtbluetooth/images/ico_note_attention.png
  1524. share/doc/qt5/qtbluetooth/images/ico_out.png
  1525. share/doc/qt5/qtbluetooth/images/intro.png
  1526. share/doc/qt5/qtbluetooth/images/intro1.png
  1527. share/doc/qt5/qtbluetooth/images/logo.png
  1528. share/doc/qt5/qtbluetooth/images/lowenergyscanner-chars.png
  1529. share/doc/qt5/qtbluetooth/images/lowenergyscanner-devices.png
  1530. share/doc/qt5/qtbluetooth/images/lowenergyscanner-services.png
  1531. share/doc/qt5/qtbluetooth/images/opp-example-1.png
  1532. share/doc/qt5/qtbluetooth/images/opp-example-2.png
  1533. share/doc/qt5/qtbluetooth/images/opp-example-3.png
  1534. share/doc/qt5/qtbluetooth/images/peripheral-structure.png
  1535. share/doc/qt5/qtbluetooth/images/servicescan.png
  1536. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/clear.png
  1537. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/default.png
  1538. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/lineedit-bg.png
  1539. share/doc/qt5/qtbluetooth/qbluetooth.html
  1540. share/doc/qt5/qtbluetooth/qbluetoothaddress-members.html
  1541. share/doc/qt5/qtbluetooth/qbluetoothaddress.html
  1542. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
  1543. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent.html
  1544. share/doc/qt5/qtbluetooth/qbluetoothdeviceinfo-members.html
  1545. share/doc/qt5/qtbluetooth/qbluetoothdeviceinfo.html
  1546. share/doc/qt5/qtbluetooth/qbluetoothhostinfo-members.html
  1547. share/doc/qt5/qtbluetooth/qbluetoothhostinfo.html
  1548. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice-members.html
  1549. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice.html
  1550. share/doc/qt5/qtbluetooth/qbluetoothserver-members.html
  1551. share/doc/qt5/qtbluetooth/qbluetoothserver.html
  1552. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent-members.html
  1553. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent.html
  1554. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
  1555. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-alternative.html
  1556. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-members.html
  1557. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
  1558. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-sequence.html
  1559. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo.html
  1560. share/doc/qt5/qtbluetooth/qbluetoothsocket-members.html
  1561. share/doc/qt5/qtbluetooth/qbluetoothsocket.html
  1562. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager-members.html
  1563. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager.html
  1564. share/doc/qt5/qtbluetooth/qbluetoothtransferreply-members.html
  1565. share/doc/qt5/qtbluetooth/qbluetoothtransferreply.html
  1566. share/doc/qt5/qtbluetooth/qbluetoothtransferrequest-members.html
  1567. share/doc/qt5/qtbluetooth/qbluetoothtransferrequest.html
  1568. share/doc/qt5/qtbluetooth/qbluetoothuuid-members.html
  1569. share/doc/qt5/qtbluetooth/qbluetoothuuid.html
  1570. share/doc/qt5/qtbluetooth/qlowenergyadvertisingdata-members.html
  1571. share/doc/qt5/qtbluetooth/qlowenergyadvertisingdata.html
  1572. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
  1573. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
  1574. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-members.html
  1575. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters.html
  1576. share/doc/qt5/qtbluetooth/qlowenergycharacteristic-members.html
  1577. share/doc/qt5/qtbluetooth/qlowenergycharacteristic.html
  1578. share/doc/qt5/qtbluetooth/qlowenergycharacteristicdata-members.html
  1579. share/doc/qt5/qtbluetooth/qlowenergycharacteristicdata.html
  1580. share/doc/qt5/qtbluetooth/qlowenergyconnectionparameters-members.html
  1581. share/doc/qt5/qtbluetooth/qlowenergyconnectionparameters.html
  1582. share/doc/qt5/qtbluetooth/qlowenergycontroller-members.html
  1583. share/doc/qt5/qtbluetooth/qlowenergycontroller-obsolete.html
  1584. share/doc/qt5/qtbluetooth/qlowenergycontroller.html
  1585. share/doc/qt5/qtbluetooth/qlowenergydescriptor-members.html
  1586. share/doc/qt5/qtbluetooth/qlowenergydescriptor.html
  1587. share/doc/qt5/qtbluetooth/qlowenergydescriptordata-members.html
  1588. share/doc/qt5/qtbluetooth/qlowenergydescriptordata.html
  1589. share/doc/qt5/qtbluetooth/qlowenergyservice-members.html
  1590. share/doc/qt5/qtbluetooth/qlowenergyservice.html
  1591. share/doc/qt5/qtbluetooth/qlowenergyservicedata-members.html
  1592. share/doc/qt5/qtbluetooth/qlowenergyservicedata.html
  1593. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel-members.html
  1594. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel.html
  1595. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothservice-members.html
  1596. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothservice.html
  1597. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothsocket-members.html
  1598. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothsocket.html
  1599. share/doc/qt5/qtbluetooth/qtbluetooth-attribution-bluez.html
  1600. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-btchat-pro.html
  1601. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-cpp.html
  1602. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-h.html
  1603. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-ui.html
  1604. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatclient-cpp.html
  1605. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatclient-h.html
  1606. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatserver-cpp.html
  1607. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatserver-h.html
  1608. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-example.html
  1609. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-main-cpp.html
  1610. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-cpp.html
  1611. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-h.html
  1612. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-ui.html
  1613. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-pro.html
  1614. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-qrc.html
  1615. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-example.html
  1616. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-main-cpp.html
  1617. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-cpp.html
  1618. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-h.html
  1619. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-ui.html
  1620. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-cpp.html
  1621. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-h.html
  1622. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-ui.html
  1623. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-cpp.html
  1624. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-h.html
  1625. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-ui.html
  1626. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-btscanner-pro.html
  1627. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-cpp.html
  1628. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-h.html
  1629. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-ui.html
  1630. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-example.html
  1631. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-main-cpp.html
  1632. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-cpp.html
  1633. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-h.html
  1634. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-ui.html
  1635. share/doc/qt5/qtbluetooth/qtbluetooth-chat-button-qml.html
  1636. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-pro.html
  1637. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-qml.html
  1638. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-qrc.html
  1639. share/doc/qt5/qtbluetooth/qtbluetooth-chat-example.html
  1640. share/doc/qt5/qtbluetooth/qtbluetooth-chat-inputbox-qml.html
  1641. share/doc/qt5/qtbluetooth/qtbluetooth-chat-qmlchat-cpp.html
  1642. share/doc/qt5/qtbluetooth/qtbluetooth-chat-search-qml.html
  1643. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-cpp.html
  1644. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-h.html
  1645. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-cpp.html
  1646. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-h.html
  1647. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-cpp.html
  1648. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-h.html
  1649. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-cpp.html
  1650. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-h.html
  1651. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-cpp.html
  1652. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-h.html
  1653. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-example.html
  1654. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-heartrate-game-pro.html
  1655. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-heartrate-global-h.html
  1656. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-images-qrc.html
  1657. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-main-cpp.html
  1658. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-app-qml.html
  1659. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-bluetoothalarmdialog-qml.html
  1660. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-bottomline-qml.html
  1661. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-connect-qml.html
  1662. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamebutton-qml.html
  1663. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamepage-qml.html
  1664. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamesettings-qml.html
  1665. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-main-qml.html
  1666. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-measure-qml.html
  1667. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-qmldir.html
  1668. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-qrc.html
  1669. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-splashscreen-qml.html
  1670. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-stats-qml.html
  1671. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-statslabel-qml.html
  1672. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-titlebar-qml.html
  1673. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-example.html
  1674. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-heartrate-server-pro.html
  1675. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-main-cpp.html
  1676. share/doc/qt5/qtbluetooth/qtbluetooth-index.html
  1677. share/doc/qt5/qtbluetooth/qtbluetooth-le-overview.html
  1678. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-characteristics-qml.html
  1679. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-dialog-qml.html
  1680. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-header-qml.html
  1681. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-label-qml.html
  1682. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-main-qml.html
  1683. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-menu-qml.html
  1684. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-services-qml.html
  1685. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-cpp.html
  1686. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-h.html
  1687. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-device-cpp.html
  1688. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-device-h.html
  1689. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-cpp.html
  1690. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-h.html
  1691. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
  1692. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-lowenergyscanner-pro.html
  1693. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-main-cpp.html
  1694. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-resources-qrc.html
  1695. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-cpp.html
  1696. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-h.html
  1697. share/doc/qt5/qtbluetooth/qtbluetooth-module.html
  1698. share/doc/qt5/qtbluetooth/qtbluetooth-overview.html
  1699. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-bttransfer-qml.html
  1700. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-button-qml.html
  1701. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-devicediscovery-qml.html
  1702. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-example.html
  1703. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filesending-qml.html
  1704. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-cpp.html
  1705. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-h.html
  1706. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-main-cpp.html
  1707. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-pictureselector-qml.html
  1708. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-picturetransfer-pro.html
  1709. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-qmltransfer-qrc.html
  1710. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-board-qml.html
  1711. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-dialog-qml.html
  1712. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-main-qml.html
  1713. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-menu-qml.html
  1714. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-example.html
  1715. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-main-cpp.html
  1716. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-cpp.html
  1717. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-h.html
  1718. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-pro.html
  1719. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-resource-qrc.html
  1720. share/doc/qt5/qtbluetooth/qtbluetooth-qmlmodule.html
  1721. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-button-qml.html
  1722. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-example.html
  1723. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-qmlscanner-cpp.html
  1724. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-pro.html
  1725. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-qml.html
  1726. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-qrc.html
  1727. share/doc/qt5/qtbluetooth/qtbluetooth.index
  1728. share/doc/qt5/qtbluetooth/qtbluetooth.qhp
  1729. share/doc/qt5/qtbluetooth/qtbluetooth.qhp.sha1
  1730. share/doc/qt5/qtbluetooth/qtbluetooth.tags
  1731. share/doc/qt5/qtbluetooth/style/offline-simple.css
  1732. share/doc/qt5/qtbluetooth/style/offline.css
  1733. share/doc/qt5/qtcanvas3d.qch
  1734. share/doc/qt5/qtcanvas3d/examples-manifest.xml
  1735. share/doc/qt5/qtcanvas3d/images/arrow_bc.png
  1736. share/doc/qt5/qtcanvas3d/images/bgrContent.png
  1737. share/doc/qt5/qtcanvas3d/images/btn_next.png
  1738. share/doc/qt5/qtcanvas3d/images/btn_prev.png
  1739. share/doc/qt5/qtcanvas3d/images/bullet_dn.png
  1740. share/doc/qt5/qtcanvas3d/images/bullet_sq.png
  1741. share/doc/qt5/qtcanvas3d/images/cellphone-example.png
  1742. share/doc/qt5/qtcanvas3d/images/framebuffer-example.png
  1743. share/doc/qt5/qtcanvas3d/images/home.png
  1744. share/doc/qt5/qtcanvas3d/images/ico_note.png
  1745. share/doc/qt5/qtcanvas3d/images/ico_note_attention.png
  1746. share/doc/qt5/qtcanvas3d/images/ico_out.png
  1747. share/doc/qt5/qtcanvas3d/images/interaction-example.png
  1748. share/doc/qt5/qtcanvas3d/images/jsonmodels-example.png
  1749. share/doc/qt5/qtcanvas3d/images/logo.png
  1750. share/doc/qt5/qtcanvas3d/images/oneqt-example.png
  1751. share/doc/qt5/qtcanvas3d/images/planets-example.jpg
  1752. share/doc/qt5/qtcanvas3d/images/quickitemtexture-example.png
  1753. share/doc/qt5/qtcanvas3d/images/textureandlight-example.png
  1754. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/calendar.png
  1755. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/camera.png
  1756. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/clock.png
  1757. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/contacts.png
  1758. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/gallery.png
  1759. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/games.png
  1760. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/lock.png
  1761. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/mail.png
  1762. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/maps.png
  1763. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/menu_background.jpg
  1764. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/music.png
  1765. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/plutomap1k.jpg
  1766. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/qtlogo_with_alpha.png
  1767. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/settings.png
  1768. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/todo.png
  1769. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/videos.png
  1770. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earth.png
  1771. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthbump1k.jpg
  1772. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthcloudmapcolortrans.png
  1773. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthmap1k.jpg
  1774. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthspec1k.jpg
  1775. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/galaxy_starfield.png
  1776. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupiter.png
  1777. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupitermap.jpg
  1778. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mars.png
  1779. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsbump1k.jpg
  1780. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsmap1k.jpg
  1781. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercury.png
  1782. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurybump.jpg
  1783. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurymap.jpg
  1784. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonbump1k.jpg
  1785. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonmap1k.jpg
  1786. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptune.png
  1787. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptunemap.jpg
  1788. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutobump1k.jpg
  1789. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutomap1k.jpg
  1790. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturn.png
  1791. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnmap.jpg
  1792. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnringcolortrans.png
  1793. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/sun.png
  1794. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/sunmap.jpg
  1795. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranus.png
  1796. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusmap.jpg
  1797. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusringcolortrans.png
  1798. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venus.png
  1799. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusbump.jpg
  1800. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusmap.jpg
  1801. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3d-members.html
  1802. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3d.html
  1803. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject-members.html
  1804. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject.html
  1805. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo-members.html
  1806. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo.html
  1807. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer-members.html
  1808. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer.html
  1809. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes-members.html
  1810. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes.html
  1811. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer-members.html
  1812. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer.html
  1813. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram-members.html
  1814. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram.html
  1815. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer-members.html
  1816. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer.html
  1817. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshader-members.html
  1818. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshader.html
  1819. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat-members.html
  1820. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat.html
  1821. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture-members.html
  1822. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture.html
  1823. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider-members.html
  1824. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider.html
  1825. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation-members.html
  1826. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation.html
  1827. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-context3d-members.html
  1828. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-context3d.html
  1829. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-glstatedumpext-members.html
  1830. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-glstatedumpext.html
  1831. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimage-members.html
  1832. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimage.html
  1833. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimagefactory-members.html
  1834. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimagefactory.html
  1835. share/doc/qt5/qtcanvas3d/qtcanvas3d-conformance-issues-html.html
  1836. share/doc/qt5/qtcanvas3d/qtcanvas3d-examples.html
  1837. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-example.html
  1838. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-pro.html
  1839. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-qrc.html
  1840. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-main-cpp.html
  1841. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-framebuffer-js.html
  1842. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-main-qml.html
  1843. share/doc/qt5/qtcanvas3d/qtcanvas3d-getting-started.html
  1844. share/doc/qt5/qtcanvas3d/qtcanvas3d-index.html
  1845. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-example.html
  1846. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-interaction-pro.html
  1847. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-interaction-qrc.html
  1848. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-main-cpp.html
  1849. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-interaction-js.html
  1850. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-main-qml.html
  1851. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-example.html
  1852. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-jsonmodels-pro.html
  1853. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-main-cpp.html
  1854. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-js.html
  1855. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-qml.html
  1856. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-qrc.html
  1857. share/doc/qt5/qtcanvas3d/qtcanvas3d-logging.html
  1858. share/doc/qt5/qtcanvas3d/qtcanvas3d-qmlmodule.html
  1859. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-example.html
  1860. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-main-cpp.html
  1861. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-main-qml.html
  1862. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-quickitemtexture-js.html
  1863. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-pro.html
  1864. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-qrc.html
  1865. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-example.html
  1866. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-main-cpp.html
  1867. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-main-qml.html
  1868. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-textureandlight-js.html
  1869. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-pro.html
  1870. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-qrc.html
  1871. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-pro.html
  1872. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-qrc.html
  1873. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-example.html
  1874. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-main-cpp.html
  1875. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphone-js.html
  1876. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphoneapp-qml.html
  1877. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphonecanvas-qml.html
  1878. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-colorselector-qml.html
  1879. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-fpsdisplay-qml.html
  1880. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-main-qml.html
  1881. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-example.html
  1882. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-js.html
  1883. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-qml.html
  1884. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-infosheet-qml.html
  1885. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-main-cpp.html
  1886. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-navibutton-qml.html
  1887. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-pro.html
  1888. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qml.html
  1889. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qrc.html
  1890. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-swipearea-qml.html
  1891. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-example.html
  1892. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-fpsdisplay-qml.html
  1893. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-infosheet-qml.html
  1894. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-main-cpp.html
  1895. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planetbutton-qml.html
  1896. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-js.html
  1897. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-pro.html
  1898. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qml.html
  1899. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qrc.html
  1900. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-styledslider-qml.html
  1901. share/doc/qt5/qtcanvas3d/qtcanvas3d.index
  1902. share/doc/qt5/qtcanvas3d/qtcanvas3d.qhp
  1903. share/doc/qt5/qtcanvas3d/qtcanvas3d.qhp.sha1
  1904. share/doc/qt5/qtcanvas3d/style/offline-simple.css
  1905. share/doc/qt5/qtcanvas3d/style/offline.css
  1906. share/doc/qt5/qtconcurrent.qch
  1907. share/doc/qt5/qtconcurrent/examples-manifest.xml
  1908. share/doc/qt5/qtconcurrent/images/arrow_bc.png
  1909. share/doc/qt5/qtconcurrent/images/bgrContent.png
  1910. share/doc/qt5/qtconcurrent/images/btn_next.png
  1911. share/doc/qt5/qtconcurrent/images/btn_prev.png
  1912. share/doc/qt5/qtconcurrent/images/bullet_dn.png
  1913. share/doc/qt5/qtconcurrent/images/bullet_sq.png
  1914. share/doc/qt5/qtconcurrent/images/home.png
  1915. share/doc/qt5/qtconcurrent/images/ico_note.png
  1916. share/doc/qt5/qtconcurrent/images/ico_note_attention.png
  1917. share/doc/qt5/qtconcurrent/images/ico_out.png
  1918. share/doc/qt5/qtconcurrent/images/imagescaling_example.png
  1919. share/doc/qt5/qtconcurrent/images/logo.png
  1920. share/doc/qt5/qtconcurrent/images/qtconcurrent-progressdialog.png
  1921. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-example.html
  1922. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-cpp.html
  1923. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-h.html
  1924. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-pro.html
  1925. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-main-cpp.html
  1926. share/doc/qt5/qtconcurrent/qtconcurrent-index.html
  1927. share/doc/qt5/qtconcurrent/qtconcurrent-map-example.html
  1928. share/doc/qt5/qtconcurrent/qtconcurrent-map-main-cpp.html
  1929. share/doc/qt5/qtconcurrent/qtconcurrent-map-map-pro.html
  1930. share/doc/qt5/qtconcurrent/qtconcurrent-module.html
  1931. share/doc/qt5/qtconcurrent/qtconcurrent-obsolete.html
  1932. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-example.html
  1933. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-main-cpp.html
  1934. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-progressdialog-pro.html
  1935. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-example.html
  1936. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-main-cpp.html
  1937. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-runfunction-pro.html
  1938. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-example.html
  1939. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-main-cpp.html
  1940. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-wordcount-pro.html
  1941. share/doc/qt5/qtconcurrent/qtconcurrent.html
  1942. share/doc/qt5/qtconcurrent/qtconcurrent.index
  1943. share/doc/qt5/qtconcurrent/qtconcurrent.qhp
  1944. share/doc/qt5/qtconcurrent/qtconcurrent.qhp.sha1
  1945. share/doc/qt5/qtconcurrent/qtconcurrent.tags
  1946. share/doc/qt5/qtconcurrent/qtconcurrentfilter.html
  1947. share/doc/qt5/qtconcurrent/qtconcurrentmap.html
  1948. share/doc/qt5/qtconcurrent/qtconcurrentrun.html
  1949. share/doc/qt5/qtconcurrent/style/offline-simple.css
  1950. share/doc/qt5/qtconcurrent/style/offline.css
  1951. share/doc/qt5/qtcore.qch
  1952. share/doc/qt5/qtcore/animation-overview.html
  1953. share/doc/qt5/qtcore/animation.html
  1954. share/doc/qt5/qtcore/codec-big5.html
  1955. share/doc/qt5/qtcore/codec-big5hkscs.html
  1956. share/doc/qt5/qtcore/codec-eucjp.html
  1957. share/doc/qt5/qtcore/codec-euckr.html
  1958. share/doc/qt5/qtcore/codec-gbk.html
  1959. share/doc/qt5/qtcore/codec-sjis.html
  1960. share/doc/qt5/qtcore/codec-tscii.html
  1961. share/doc/qt5/qtcore/codecs-jis.html
  1962. share/doc/qt5/qtcore/containers.html
  1963. share/doc/qt5/qtcore/custom-types.html
  1964. share/doc/qt5/qtcore/datastreamformat.html
  1965. share/doc/qt5/qtcore/events.html
  1966. share/doc/qt5/qtcore/eventsandfilters.html
  1967. share/doc/qt5/qtcore/examples-manifest.xml
  1968. share/doc/qt5/qtcore/images/abstract-connections.png
  1969. share/doc/qt5/qtcore/images/animations-architecture.png
  1970. share/doc/qt5/qtcore/images/arrow_bc.png
  1971. share/doc/qt5/qtcore/images/bgrContent.png
  1972. share/doc/qt5/qtcore/images/brush-styles.png
  1973. share/doc/qt5/qtcore/images/btn_next.png
  1974. share/doc/qt5/qtcore/images/btn_prev.png
  1975. share/doc/qt5/qtcore/images/bullet_dn.png
  1976. share/doc/qt5/qtcore/images/bullet_sq.png
  1977. share/doc/qt5/qtcore/images/cursor-arrow.png
  1978. share/doc/qt5/qtcore/images/cursor-busy.png
  1979. share/doc/qt5/qtcore/images/cursor-closedhand.png
  1980. share/doc/qt5/qtcore/images/cursor-cross.png
  1981. share/doc/qt5/qtcore/images/cursor-forbidden.png
  1982. share/doc/qt5/qtcore/images/cursor-hand.png
  1983. share/doc/qt5/qtcore/images/cursor-hsplit.png
  1984. share/doc/qt5/qtcore/images/cursor-ibeam.png
  1985. share/doc/qt5/qtcore/images/cursor-openhand.png
  1986. share/doc/qt5/qtcore/images/cursor-sizeall.png
  1987. share/doc/qt5/qtcore/images/cursor-sizeb.png
  1988. share/doc/qt5/qtcore/images/cursor-sizef.png
  1989. share/doc/qt5/qtcore/images/cursor-sizeh.png
  1990. share/doc/qt5/qtcore/images/cursor-sizev.png
  1991. share/doc/qt5/qtcore/images/cursor-uparrow.png
  1992. share/doc/qt5/qtcore/images/cursor-vsplit.png
  1993. share/doc/qt5/qtcore/images/cursor-wait.png
  1994. share/doc/qt5/qtcore/images/cursor-whatsthis.png
  1995. share/doc/qt5/qtcore/images/home.png
  1996. share/doc/qt5/qtcore/images/ico_note.png
  1997. share/doc/qt5/qtcore/images/ico_note_attention.png
  1998. share/doc/qt5/qtcore/images/ico_out.png
  1999. share/doc/qt5/qtcore/images/javaiterators1.png
  2000. share/doc/qt5/qtcore/images/javaiterators2.png
  2001. share/doc/qt5/qtcore/images/localfortuneclient-example.png
  2002. share/doc/qt5/qtcore/images/localfortuneserver-example.png
  2003. share/doc/qt5/qtcore/images/logo.png
  2004. share/doc/qt5/qtcore/images/mandelbrot-example.png
  2005. share/doc/qt5/qtcore/images/mandelbrot_scroll1.png
  2006. share/doc/qt5/qtcore/images/mandelbrot_scroll2.png
  2007. share/doc/qt5/qtcore/images/mandelbrot_scroll3.png
  2008. share/doc/qt5/qtcore/images/mandelbrot_zoom1.png
  2009. share/doc/qt5/qtcore/images/mandelbrot_zoom2.png
  2010. share/doc/qt5/qtcore/images/mandelbrot_zoom3.png
  2011. share/doc/qt5/qtcore/images/mimetypebrowser.png
  2012. share/doc/qt5/qtcore/images/modelindex-no-parent.png
  2013. share/doc/qt5/qtcore/images/modelview-begin-append-columns.png
  2014. share/doc/qt5/qtcore/images/modelview-begin-append-rows.png
  2015. share/doc/qt5/qtcore/images/modelview-begin-insert-columns.png
  2016. share/doc/qt5/qtcore/images/modelview-begin-insert-rows.png
  2017. share/doc/qt5/qtcore/images/modelview-begin-remove-columns.png
  2018. share/doc/qt5/qtcore/images/modelview-begin-remove-rows.png
  2019. share/doc/qt5/qtcore/images/modelview-move-rows-1.png
  2020. share/doc/qt5/qtcore/images/modelview-move-rows-2.png
  2021. share/doc/qt5/qtcore/images/modelview-move-rows-3.png
  2022. share/doc/qt5/qtcore/images/modelview-move-rows-4.png
  2023. share/doc/qt5/qtcore/images/qeasingcurve-inback.png
  2024. share/doc/qt5/qtcore/images/qeasingcurve-inbounce.png
  2025. share/doc/qt5/qtcore/images/qeasingcurve-incirc.png
  2026. share/doc/qt5/qtcore/images/qeasingcurve-incubic.png
  2027. share/doc/qt5/qtcore/images/qeasingcurve-inelastic.png
  2028. share/doc/qt5/qtcore/images/qeasingcurve-inexpo.png
  2029. share/doc/qt5/qtcore/images/qeasingcurve-inoutback.png
  2030. share/doc/qt5/qtcore/images/qeasingcurve-inoutbounce.png
  2031. share/doc/qt5/qtcore/images/qeasingcurve-inoutcirc.png
  2032. share/doc/qt5/qtcore/images/qeasingcurve-inoutcubic.png
  2033. share/doc/qt5/qtcore/images/qeasingcurve-inoutelastic.png
  2034. share/doc/qt5/qtcore/images/qeasingcurve-inoutexpo.png
  2035. share/doc/qt5/qtcore/images/qeasingcurve-inoutquad.png
  2036. share/doc/qt5/qtcore/images/qeasingcurve-inoutquart.png
  2037. share/doc/qt5/qtcore/images/qeasingcurve-inoutquint.png
  2038. share/doc/qt5/qtcore/images/qeasingcurve-inoutsine.png
  2039. share/doc/qt5/qtcore/images/qeasingcurve-inquad.png
  2040. share/doc/qt5/qtcore/images/qeasingcurve-inquart.png
  2041. share/doc/qt5/qtcore/images/qeasingcurve-inquint.png
  2042. share/doc/qt5/qtcore/images/qeasingcurve-insine.png
  2043. share/doc/qt5/qtcore/images/qeasingcurve-linear.png
  2044. share/doc/qt5/qtcore/images/qeasingcurve-outback.png
  2045. share/doc/qt5/qtcore/images/qeasingcurve-outbounce.png
  2046. share/doc/qt5/qtcore/images/qeasingcurve-outcirc.png
  2047. share/doc/qt5/qtcore/images/qeasingcurve-outcubic.png
  2048. share/doc/qt5/qtcore/images/qeasingcurve-outelastic.png
  2049. share/doc/qt5/qtcore/images/qeasingcurve-outexpo.png
  2050. share/doc/qt5/qtcore/images/qeasingcurve-outinback.png
  2051. share/doc/qt5/qtcore/images/qeasingcurve-outinbounce.png
  2052. share/doc/qt5/qtcore/images/qeasingcurve-outincirc.png
  2053. share/doc/qt5/qtcore/images/qeasingcurve-outincubic.png
  2054. share/doc/qt5/qtcore/images/qeasingcurve-outinelastic.png
  2055. share/doc/qt5/qtcore/images/qeasingcurve-outinexpo.png
  2056. share/doc/qt5/qtcore/images/qeasingcurve-outinquad.png
  2057. share/doc/qt5/qtcore/images/qeasingcurve-outinquart.png
  2058. share/doc/qt5/qtcore/images/qeasingcurve-outinquint.png
  2059. share/doc/qt5/qtcore/images/qeasingcurve-outinsine.png
  2060. share/doc/qt5/qtcore/images/qeasingcurve-outquad.png
  2061. share/doc/qt5/qtcore/images/qeasingcurve-outquart.png
  2062. share/doc/qt5/qtcore/images/qeasingcurve-outquint.png
  2063. share/doc/qt5/qtcore/images/qeasingcurve-outsine.png
  2064. share/doc/qt5/qtcore/images/qimage-scaling.png
  2065. share/doc/qt5/qtcore/images/qline-coordinates.png
  2066. share/doc/qt5/qtcore/images/qline-point.png
  2067. share/doc/qt5/qtcore/images/qlinef-angle-identicaldirection.png
  2068. share/doc/qt5/qtcore/images/qlinef-angle-oppositedirection.png
  2069. share/doc/qt5/qtcore/images/qlinef-bounded.png
  2070. share/doc/qt5/qtcore/images/qlinef-normalvector.png
  2071. share/doc/qt5/qtcore/images/qlinef-unbounded.png
  2072. share/doc/qt5/qtcore/images/qpen-bevel.png
  2073. share/doc/qt5/qtcore/images/qpen-custom.png
  2074. share/doc/qt5/qtcore/images/qpen-dash.png
  2075. share/doc/qt5/qtcore/images/qpen-dashdot.png
  2076. share/doc/qt5/qtcore/images/qpen-dashdotdot.png
  2077. share/doc/qt5/qtcore/images/qpen-dot.png
  2078. share/doc/qt5/qtcore/images/qpen-flat.png
  2079. share/doc/qt5/qtcore/images/qpen-miter.png
  2080. share/doc/qt5/qtcore/images/qpen-roundcap.png
  2081. share/doc/qt5/qtcore/images/qpen-roundjoin.png
  2082. share/doc/qt5/qtcore/images/qpen-solid.png
  2083. share/doc/qt5/qtcore/images/qpen-square.png
  2084. share/doc/qt5/qtcore/images/qrect-coordinates.png
  2085. share/doc/qt5/qtcore/images/qrect-diagram-one.png
  2086. share/doc/qt5/qtcore/images/qrect-diagram-three.png
  2087. share/doc/qt5/qtcore/images/qrect-diagram-two.png
  2088. share/doc/qt5/qtcore/images/qrect-diagram-zero.png
  2089. share/doc/qt5/qtcore/images/qrect-intersect.png
  2090. share/doc/qt5/qtcore/images/qrect-unite.png
  2091. share/doc/qt5/qtcore/images/qrectf-coordinates.png
  2092. share/doc/qt5/qtcore/images/qrectf-diagram-one.png
  2093. share/doc/qt5/qtcore/images/qrectf-diagram-three.png
  2094. share/doc/qt5/qtcore/images/qrectf-diagram-two.png
  2095. share/doc/qt5/qtcore/images/qsortfilterproxymodel-sorting.png
  2096. share/doc/qt5/qtcore/images/queuedcustomtype-example.png
  2097. share/doc/qt5/qtcore/images/qurl-authority.png
  2098. share/doc/qt5/qtcore/images/qurl-authority2.png
  2099. share/doc/qt5/qtcore/images/qurl-authority3.png
  2100. share/doc/qt5/qtcore/images/qurl-fragment.png
  2101. share/doc/qt5/qtcore/images/qurl-ftppath.png
  2102. share/doc/qt5/qtcore/images/qurl-mailtopath.png
  2103. share/doc/qt5/qtcore/images/qurl-querystring.png
  2104. share/doc/qt5/qtcore/images/resources.png
  2105. share/doc/qt5/qtcore/images/sharedmemory-example_1.png
  2106. share/doc/qt5/qtcore/images/sharedmemory-example_2.png
  2107. share/doc/qt5/qtcore/images/statemachine-button-history.png
  2108. share/doc/qt5/qtcore/images/statemachine-button-nested.png
  2109. share/doc/qt5/qtcore/images/statemachine-button.png
  2110. share/doc/qt5/qtcore/images/statemachine-customevents.png
  2111. share/doc/qt5/qtcore/images/statemachine-customevents2.png
  2112. share/doc/qt5/qtcore/images/statemachine-finished.png
  2113. share/doc/qt5/qtcore/images/statemachine-nonparallel.png
  2114. share/doc/qt5/qtcore/images/statemachine-parallel.png
  2115. share/doc/qt5/qtcore/images/stliterators1.png
  2116. share/doc/qt5/qtcore/implicit-sharing.html
  2117. share/doc/qt5/qtcore/io-functions.html
  2118. share/doc/qt5/qtcore/io.html
  2119. share/doc/qt5/qtcore/json.html
  2120. share/doc/qt5/qtcore/metaobjects.html
  2121. share/doc/qt5/qtcore/object.html
  2122. share/doc/qt5/qtcore/objecttrees.html
  2123. share/doc/qt5/qtcore/plugins.html
  2124. share/doc/qt5/qtcore/properties.html
  2125. share/doc/qt5/qtcore/qabstractanimation-members.html
  2126. share/doc/qt5/qtcore/qabstractanimation.html
  2127. share/doc/qt5/qtcore/qabstracteventdispatcher-members.html
  2128. share/doc/qt5/qtcore/qabstracteventdispatcher-obsolete.html
  2129. share/doc/qt5/qtcore/qabstracteventdispatcher-timerinfo-members.html
  2130. share/doc/qt5/qtcore/qabstracteventdispatcher-timerinfo.html
  2131. share/doc/qt5/qtcore/qabstracteventdispatcher.html
  2132. share/doc/qt5/qtcore/qabstractitemmodel-members.html
  2133. share/doc/qt5/qtcore/qabstractitemmodel-obsolete.html
  2134. share/doc/qt5/qtcore/qabstractitemmodel.html
  2135. share/doc/qt5/qtcore/qabstractlistmodel-members.html
  2136. share/doc/qt5/qtcore/qabstractlistmodel.html
  2137. share/doc/qt5/qtcore/qabstractnativeeventfilter-members.html
  2138. share/doc/qt5/qtcore/qabstractnativeeventfilter.html
  2139. share/doc/qt5/qtcore/qabstractproxymodel-members.html
  2140. share/doc/qt5/qtcore/qabstractproxymodel.html
  2141. share/doc/qt5/qtcore/qabstractstate-members.html
  2142. share/doc/qt5/qtcore/qabstractstate.html
  2143. share/doc/qt5/qtcore/qabstracttablemodel-members.html
  2144. share/doc/qt5/qtcore/qabstracttablemodel.html
  2145. share/doc/qt5/qtcore/qabstracttransition-members.html
  2146. share/doc/qt5/qtcore/qabstracttransition.html
  2147. share/doc/qt5/qtcore/qanimationgroup-members.html
  2148. share/doc/qt5/qtcore/qanimationgroup.html
  2149. share/doc/qt5/qtcore/qassociativeiterable-const-iterator-members.html
  2150. share/doc/qt5/qtcore/qassociativeiterable-const-iterator.html
  2151. share/doc/qt5/qtcore/qassociativeiterable-members.html
  2152. share/doc/qt5/qtcore/qassociativeiterable.html
  2153. share/doc/qt5/qtcore/qatomicint-members.html
  2154. share/doc/qt5/qtcore/qatomicint.html
  2155. share/doc/qt5/qtcore/qatomicinteger-members.html
  2156. share/doc/qt5/qtcore/qatomicinteger.html
  2157. share/doc/qt5/qtcore/qatomicpointer-members.html
  2158. share/doc/qt5/qtcore/qatomicpointer.html
  2159. share/doc/qt5/qtcore/qbasictimer-members.html
  2160. share/doc/qt5/qtcore/qbasictimer.html
  2161. share/doc/qt5/qtcore/qbitarray-members.html
  2162. share/doc/qt5/qtcore/qbitarray.html
  2163. share/doc/qt5/qtcore/qbuffer-members.html
  2164. share/doc/qt5/qtcore/qbuffer.html
  2165. share/doc/qt5/qtcore/qbytearray-members.html
  2166. share/doc/qt5/qtcore/qbytearray-obsolete.html
  2167. share/doc/qt5/qtcore/qbytearray.html
  2168. share/doc/qt5/qtcore/qbytearraylist-members.html
  2169. share/doc/qt5/qtcore/qbytearraylist.html
  2170. share/doc/qt5/qtcore/qbytearraymatcher-members.html
  2171. share/doc/qt5/qtcore/qbytearraymatcher.html
  2172. share/doc/qt5/qtcore/qcache-members.html
  2173. share/doc/qt5/qtcore/qcache.html
  2174. share/doc/qt5/qtcore/qchar-members.html
  2175. share/doc/qt5/qtcore/qchar-obsolete.html
  2176. share/doc/qt5/qtcore/qchar.html
  2177. share/doc/qt5/qtcore/qchildevent-members.html
  2178. share/doc/qt5/qtcore/qchildevent.html
  2179. share/doc/qt5/qtcore/qcollator-members.html
  2180. share/doc/qt5/qtcore/qcollator.html
  2181. share/doc/qt5/qtcore/qcollatorsortkey-members.html
  2182. share/doc/qt5/qtcore/qcollatorsortkey.html
  2183. share/doc/qt5/qtcore/qcommandlineoption-members.html
  2184. share/doc/qt5/qtcore/qcommandlineoption-obsolete.html
  2185. share/doc/qt5/qtcore/qcommandlineoption.html
  2186. share/doc/qt5/qtcore/qcommandlineparser-members.html
  2187. share/doc/qt5/qtcore/qcommandlineparser.html
  2188. share/doc/qt5/qtcore/qcontiguouscache-members.html
  2189. share/doc/qt5/qtcore/qcontiguouscache.html
  2190. share/doc/qt5/qtcore/qcoreapplication-members.html
  2191. share/doc/qt5/qtcore/qcoreapplication-obsolete.html
  2192. share/doc/qt5/qtcore/qcoreapplication.html
  2193. share/doc/qt5/qtcore/qcryptographichash-members.html
  2194. share/doc/qt5/qtcore/qcryptographichash.html
  2195. share/doc/qt5/qtcore/qdatastream-members.html
  2196. share/doc/qt5/qtcore/qdatastream-obsolete.html
  2197. share/doc/qt5/qtcore/qdatastream.html
  2198. share/doc/qt5/qtcore/qdate-members.html
  2199. share/doc/qt5/qtcore/qdate-obsolete.html
  2200. share/doc/qt5/qtcore/qdate.html
  2201. share/doc/qt5/qtcore/qdatetime-members.html
  2202. share/doc/qt5/qtcore/qdatetime-obsolete.html
  2203. share/doc/qt5/qtcore/qdatetime.html
  2204. share/doc/qt5/qtcore/qdeadlinetimer-members.html
  2205. share/doc/qt5/qtcore/qdeadlinetimer.html
  2206. share/doc/qt5/qtcore/qdebug-members.html
  2207. share/doc/qt5/qtcore/qdebug.html
  2208. share/doc/qt5/qtcore/qdebugstatesaver-members.html
  2209. share/doc/qt5/qtcore/qdebugstatesaver.html
  2210. share/doc/qt5/qtcore/qdir-members.html
  2211. share/doc/qt5/qtcore/qdir-obsolete.html
  2212. share/doc/qt5/qtcore/qdir.html
  2213. share/doc/qt5/qtcore/qdiriterator-members.html
  2214. share/doc/qt5/qtcore/qdiriterator.html
  2215. share/doc/qt5/qtcore/qdynamicpropertychangeevent-members.html
  2216. share/doc/qt5/qtcore/qdynamicpropertychangeevent.html
  2217. share/doc/qt5/qtcore/qeasingcurve-members.html
  2218. share/doc/qt5/qtcore/qeasingcurve-obsolete.html
  2219. share/doc/qt5/qtcore/qeasingcurve.html
  2220. share/doc/qt5/qtcore/qelapsedtimer-members.html
  2221. share/doc/qt5/qtcore/qelapsedtimer.html
  2222. share/doc/qt5/qtcore/qenablesharedfromthis-members.html
  2223. share/doc/qt5/qtcore/qenablesharedfromthis.html
  2224. share/doc/qt5/qtcore/qevent-members.html
  2225. share/doc/qt5/qtcore/qevent.html
  2226. share/doc/qt5/qtcore/qeventloop-members.html
  2227. share/doc/qt5/qtcore/qeventloop.html
  2228. share/doc/qt5/qtcore/qeventlooplocker-members.html
  2229. share/doc/qt5/qtcore/qeventlooplocker.html
  2230. share/doc/qt5/qtcore/qeventtransition-members.html
  2231. share/doc/qt5/qtcore/qeventtransition.html
  2232. share/doc/qt5/qtcore/qexception-members.html
  2233. share/doc/qt5/qtcore/qexception.html
  2234. share/doc/qt5/qtcore/qexplicitlyshareddatapointer-members.html
  2235. share/doc/qt5/qtcore/qexplicitlyshareddatapointer.html
  2236. share/doc/qt5/qtcore/qfile-members.html
  2237. share/doc/qt5/qtcore/qfile-obsolete.html
  2238. share/doc/qt5/qtcore/qfile.html
  2239. share/doc/qt5/qtcore/qfiledevice-members.html
  2240. share/doc/qt5/qtcore/qfiledevice.html
  2241. share/doc/qt5/qtcore/qfileinfo-members.html
  2242. share/doc/qt5/qtcore/qfileinfo-obsolete.html
  2243. share/doc/qt5/qtcore/qfileinfo.html
  2244. share/doc/qt5/qtcore/qfileselector-members.html
  2245. share/doc/qt5/qtcore/qfileselector.html
  2246. share/doc/qt5/qtcore/qfilesystemwatcher-members.html
  2247. share/doc/qt5/qtcore/qfilesystemwatcher.html
  2248. share/doc/qt5/qtcore/qfinalstate-members.html
  2249. share/doc/qt5/qtcore/qfinalstate.html
  2250. share/doc/qt5/qtcore/qflag-members.html
  2251. share/doc/qt5/qtcore/qflag.html
  2252. share/doc/qt5/qtcore/qflags-members.html
  2253. share/doc/qt5/qtcore/qflags.html
  2254. share/doc/qt5/qtcore/qfloat16.html
  2255. share/doc/qt5/qtcore/qfuture-const-iterator-members.html
  2256. share/doc/qt5/qtcore/qfuture-const-iterator.html
  2257. share/doc/qt5/qtcore/qfuture-members.html
  2258. share/doc/qt5/qtcore/qfuture.html
  2259. share/doc/qt5/qtcore/qfutureiterator-members.html
  2260. share/doc/qt5/qtcore/qfutureiterator.html
  2261. share/doc/qt5/qtcore/qfuturesynchronizer-members.html
  2262. share/doc/qt5/qtcore/qfuturesynchronizer.html
  2263. share/doc/qt5/qtcore/qfuturewatcher-members.html
  2264. share/doc/qt5/qtcore/qfuturewatcher.html
  2265. share/doc/qt5/qtcore/qgenericargument-members.html
  2266. share/doc/qt5/qtcore/qgenericargument.html
  2267. share/doc/qt5/qtcore/qgenericreturnargument-members.html
  2268. share/doc/qt5/qtcore/qgenericreturnargument.html
  2269. share/doc/qt5/qtcore/qglobalstatic-members.html
  2270. share/doc/qt5/qtcore/qglobalstatic-obsolete.html
  2271. share/doc/qt5/qtcore/qglobalstatic.html
  2272. share/doc/qt5/qtcore/qhash-const-iterator-members.html
  2273. share/doc/qt5/qtcore/qhash-const-iterator.html
  2274. share/doc/qt5/qtcore/qhash-iterator-members.html
  2275. share/doc/qt5/qtcore/qhash-iterator.html
  2276. share/doc/qt5/qtcore/qhash-key-iterator-members.html
  2277. share/doc/qt5/qtcore/qhash-key-iterator.html
  2278. share/doc/qt5/qtcore/qhash-members.html
  2279. share/doc/qt5/qtcore/qhash.html
  2280. share/doc/qt5/qtcore/qhashiterator-members.html
  2281. share/doc/qt5/qtcore/qhashiterator.html
  2282. share/doc/qt5/qtcore/qhistorystate-members.html
  2283. share/doc/qt5/qtcore/qhistorystate.html
  2284. share/doc/qt5/qtcore/qidentityproxymodel-members.html
  2285. share/doc/qt5/qtcore/qidentityproxymodel.html
  2286. share/doc/qt5/qtcore/qiodevice-members.html
  2287. share/doc/qt5/qtcore/qiodevice.html
  2288. share/doc/qt5/qtcore/qitemselection-members.html
  2289. share/doc/qt5/qtcore/qitemselection.html
  2290. share/doc/qt5/qtcore/qitemselectionmodel-members.html
  2291. share/doc/qt5/qtcore/qitemselectionmodel.html
  2292. share/doc/qt5/qtcore/qitemselectionrange-members.html
  2293. share/doc/qt5/qtcore/qitemselectionrange-obsolete.html
  2294. share/doc/qt5/qtcore/qitemselectionrange.html
  2295. share/doc/qt5/qtcore/qjsonarray-const-iterator-members.html
  2296. share/doc/qt5/qtcore/qjsonarray-const-iterator.html
  2297. share/doc/qt5/qtcore/qjsonarray-iterator-members.html
  2298. share/doc/qt5/qtcore/qjsonarray-iterator.html
  2299. share/doc/qt5/qtcore/qjsonarray-members.html
  2300. share/doc/qt5/qtcore/qjsonarray.html
  2301. share/doc/qt5/qtcore/qjsondocument-members.html
  2302. share/doc/qt5/qtcore/qjsondocument.html
  2303. share/doc/qt5/qtcore/qjsonobject-const-iterator-members.html
  2304. share/doc/qt5/qtcore/qjsonobject-const-iterator.html
  2305. share/doc/qt5/qtcore/qjsonobject-iterator-members.html
  2306. share/doc/qt5/qtcore/qjsonobject-iterator.html
  2307. share/doc/qt5/qtcore/qjsonobject-members.html
  2308. share/doc/qt5/qtcore/qjsonobject.html
  2309. share/doc/qt5/qtcore/qjsonparseerror-members.html
  2310. share/doc/qt5/qtcore/qjsonparseerror.html
  2311. share/doc/qt5/qtcore/qjsonvalue-members.html
  2312. share/doc/qt5/qtcore/qjsonvalue.html
  2313. share/doc/qt5/qtcore/qlatin1char-members.html
  2314. share/doc/qt5/qtcore/qlatin1char.html
  2315. share/doc/qt5/qtcore/qlatin1string-members.html
  2316. share/doc/qt5/qtcore/qlatin1string.html
  2317. share/doc/qt5/qtcore/qlibrary-members.html
  2318. share/doc/qt5/qtcore/qlibrary.html
  2319. share/doc/qt5/qtcore/qlibraryinfo-members.html
  2320. share/doc/qt5/qtcore/qlibraryinfo-obsolete.html
  2321. share/doc/qt5/qtcore/qlibraryinfo.html
  2322. share/doc/qt5/qtcore/qline-members.html
  2323. share/doc/qt5/qtcore/qline.html
  2324. share/doc/qt5/qtcore/qlinef-members.html
  2325. share/doc/qt5/qtcore/qlinef-obsolete.html
  2326. share/doc/qt5/qtcore/qlinef.html
  2327. share/doc/qt5/qtcore/qlinkedlist-const-iterator-members.html
  2328. share/doc/qt5/qtcore/qlinkedlist-const-iterator.html
  2329. share/doc/qt5/qtcore/qlinkedlist-iterator-members.html
  2330. share/doc/qt5/qtcore/qlinkedlist-iterator.html
  2331. share/doc/qt5/qtcore/qlinkedlist-members.html
  2332. share/doc/qt5/qtcore/qlinkedlist.html
  2333. share/doc/qt5/qtcore/qlinkedlistiterator-members.html
  2334. share/doc/qt5/qtcore/qlinkedlistiterator.html
  2335. share/doc/qt5/qtcore/qlist-const-iterator-members.html
  2336. share/doc/qt5/qtcore/qlist-const-iterator.html
  2337. share/doc/qt5/qtcore/qlist-iterator-members.html
  2338. share/doc/qt5/qtcore/qlist-iterator.html
  2339. share/doc/qt5/qtcore/qlist-members.html
  2340. share/doc/qt5/qtcore/qlist-memorylayout.html
  2341. share/doc/qt5/qtcore/qlist.html
  2342. share/doc/qt5/qtcore/qlistiterator-members.html
  2343. share/doc/qt5/qtcore/qlistiterator.html
  2344. share/doc/qt5/qtcore/qlocale-members.html
  2345. share/doc/qt5/qtcore/qlocale-obsolete.html
  2346. share/doc/qt5/qtcore/qlocale.html
  2347. share/doc/qt5/qtcore/qlockfile-members.html
  2348. share/doc/qt5/qtcore/qlockfile.html
  2349. share/doc/qt5/qtcore/qloggingcategory-members.html
  2350. share/doc/qt5/qtcore/qloggingcategory.html
  2351. share/doc/qt5/qtcore/qmap-const-iterator-members.html
  2352. share/doc/qt5/qtcore/qmap-const-iterator.html
  2353. share/doc/qt5/qtcore/qmap-iterator-members.html
  2354. share/doc/qt5/qtcore/qmap-iterator.html
  2355. share/doc/qt5/qtcore/qmap-key-iterator-members.html
  2356. share/doc/qt5/qtcore/qmap-key-iterator.html
  2357. share/doc/qt5/qtcore/qmap-members.html
  2358. share/doc/qt5/qtcore/qmap.html
  2359. share/doc/qt5/qtcore/qmapiterator-members.html
  2360. share/doc/qt5/qtcore/qmapiterator.html
  2361. share/doc/qt5/qtcore/qmargins-members.html
  2362. share/doc/qt5/qtcore/qmargins.html
  2363. share/doc/qt5/qtcore/qmarginsf-members.html
  2364. share/doc/qt5/qtcore/qmarginsf.html
  2365. share/doc/qt5/qtcore/qmessageauthenticationcode-members.html
  2366. share/doc/qt5/qtcore/qmessageauthenticationcode.html
  2367. share/doc/qt5/qtcore/qmessagelogcontext-members.html
  2368. share/doc/qt5/qtcore/qmessagelogcontext.html
  2369. share/doc/qt5/qtcore/qmessagelogger-members.html
  2370. share/doc/qt5/qtcore/qmessagelogger.html
  2371. share/doc/qt5/qtcore/qmetaclassinfo-members.html
  2372. share/doc/qt5/qtcore/qmetaclassinfo.html
  2373. share/doc/qt5/qtcore/qmetaenum-members.html
  2374. share/doc/qt5/qtcore/qmetaenum.html
  2375. share/doc/qt5/qtcore/qmetamethod-members.html
  2376. share/doc/qt5/qtcore/qmetamethod.html
  2377. share/doc/qt5/qtcore/qmetaobject-connection-members.html
  2378. share/doc/qt5/qtcore/qmetaobject-connection.html
  2379. share/doc/qt5/qtcore/qmetaobject-members.html
  2380. share/doc/qt5/qtcore/qmetaobject.html
  2381. share/doc/qt5/qtcore/qmetaproperty-members.html
  2382. share/doc/qt5/qtcore/qmetaproperty-obsolete.html
  2383. share/doc/qt5/qtcore/qmetaproperty.html
  2384. share/doc/qt5/qtcore/qmetatype-members.html
  2385. share/doc/qt5/qtcore/qmetatype-obsolete.html
  2386. share/doc/qt5/qtcore/qmetatype.html
  2387. share/doc/qt5/qtcore/qmimedata-members.html
  2388. share/doc/qt5/qtcore/qmimedata.html
  2389. share/doc/qt5/qtcore/qmimedatabase-members.html
  2390. share/doc/qt5/qtcore/qmimedatabase.html
  2391. share/doc/qt5/qtcore/qmimetype-members.html
  2392. share/doc/qt5/qtcore/qmimetype.html
  2393. share/doc/qt5/qtcore/qmodelindex-members.html
  2394. share/doc/qt5/qtcore/qmodelindex-obsolete.html
  2395. share/doc/qt5/qtcore/qmodelindex.html
  2396. share/doc/qt5/qtcore/qmultihash-members.html
  2397. share/doc/qt5/qtcore/qmultihash.html
  2398. share/doc/qt5/qtcore/qmultimap-members.html
  2399. share/doc/qt5/qtcore/qmultimap.html
  2400. share/doc/qt5/qtcore/qmutablehashiterator-members.html
  2401. share/doc/qt5/qtcore/qmutablehashiterator.html
  2402. share/doc/qt5/qtcore/qmutablelinkedlistiterator-members.html
  2403. share/doc/qt5/qtcore/qmutablelinkedlistiterator.html
  2404. share/doc/qt5/qtcore/qmutablelistiterator-members.html
  2405. share/doc/qt5/qtcore/qmutablelistiterator.html
  2406. share/doc/qt5/qtcore/qmutablemapiterator-members.html
  2407. share/doc/qt5/qtcore/qmutablemapiterator.html
  2408. share/doc/qt5/qtcore/qmutablesetiterator-members.html
  2409. share/doc/qt5/qtcore/qmutablesetiterator.html
  2410. share/doc/qt5/qtcore/qmutablevectoriterator-members.html
  2411. share/doc/qt5/qtcore/qmutablevectoriterator.html
  2412. share/doc/qt5/qtcore/qmutex-members.html
  2413. share/doc/qt5/qtcore/qmutex.html
  2414. share/doc/qt5/qtcore/qmutexlocker-members.html
  2415. share/doc/qt5/qtcore/qmutexlocker.html
  2416. share/doc/qt5/qtcore/qobject-members.html
  2417. share/doc/qt5/qtcore/qobject-obsolete.html
  2418. share/doc/qt5/qtcore/qobject.html
  2419. share/doc/qt5/qtcore/qobjectcleanuphandler-members.html
  2420. share/doc/qt5/qtcore/qobjectcleanuphandler.html
  2421. share/doc/qt5/qtcore/qoperatingsystemversion-members.html
  2422. share/doc/qt5/qtcore/qoperatingsystemversion.html
  2423. share/doc/qt5/qtcore/qpair-members.html
  2424. share/doc/qt5/qtcore/qpair.html
  2425. share/doc/qt5/qtcore/qparallelanimationgroup-members.html
  2426. share/doc/qt5/qtcore/qparallelanimationgroup.html
  2427. share/doc/qt5/qtcore/qpauseanimation-members.html
  2428. share/doc/qt5/qtcore/qpauseanimation.html
  2429. share/doc/qt5/qtcore/qpersistentmodelindex-members.html
  2430. share/doc/qt5/qtcore/qpersistentmodelindex-obsolete.html
  2431. share/doc/qt5/qtcore/qpersistentmodelindex.html
  2432. share/doc/qt5/qtcore/qpluginloader-members.html
  2433. share/doc/qt5/qtcore/qpluginloader.html
  2434. share/doc/qt5/qtcore/qpoint-members.html
  2435. share/doc/qt5/qtcore/qpoint.html
  2436. share/doc/qt5/qtcore/qpointer-members.html
  2437. share/doc/qt5/qtcore/qpointer.html
  2438. share/doc/qt5/qtcore/qpointf-members.html
  2439. share/doc/qt5/qtcore/qpointf.html
  2440. share/doc/qt5/qtcore/qprocess-createprocessarguments-members.html
  2441. share/doc/qt5/qtcore/qprocess-createprocessarguments.html
  2442. share/doc/qt5/qtcore/qprocess-members.html
  2443. share/doc/qt5/qtcore/qprocess-obsolete.html
  2444. share/doc/qt5/qtcore/qprocess.html
  2445. share/doc/qt5/qtcore/qprocessenvironment-members.html
  2446. share/doc/qt5/qtcore/qprocessenvironment.html
  2447. share/doc/qt5/qtcore/qpropertyanimation-members.html
  2448. share/doc/qt5/qtcore/qpropertyanimation.html
  2449. share/doc/qt5/qtcore/qqueue-members.html
  2450. share/doc/qt5/qtcore/qqueue.html
  2451. share/doc/qt5/qtcore/qreadlocker-members.html
  2452. share/doc/qt5/qtcore/qreadlocker.html
  2453. share/doc/qt5/qtcore/qreadwritelock-members.html
  2454. share/doc/qt5/qtcore/qreadwritelock.html
  2455. share/doc/qt5/qtcore/qrect-members.html
  2456. share/doc/qt5/qtcore/qrect-obsolete.html
  2457. share/doc/qt5/qtcore/qrect.html
  2458. share/doc/qt5/qtcore/qrectf-members.html
  2459. share/doc/qt5/qtcore/qrectf-obsolete.html
  2460. share/doc/qt5/qtcore/qrectf.html
  2461. share/doc/qt5/qtcore/qregexp-members.html
  2462. share/doc/qt5/qtcore/qregexp.html
  2463. share/doc/qt5/qtcore/qregularexpression-members.html
  2464. share/doc/qt5/qtcore/qregularexpression.html
  2465. share/doc/qt5/qtcore/qregularexpressionmatch-members.html
  2466. share/doc/qt5/qtcore/qregularexpressionmatch.html
  2467. share/doc/qt5/qtcore/qregularexpressionmatchiterator-members.html
  2468. share/doc/qt5/qtcore/qregularexpressionmatchiterator.html
  2469. share/doc/qt5/qtcore/qresource-members.html
  2470. share/doc/qt5/qtcore/qresource-obsolete.html
  2471. share/doc/qt5/qtcore/qresource.html
  2472. share/doc/qt5/qtcore/qrunnable-members.html
  2473. share/doc/qt5/qtcore/qrunnable.html
  2474. share/doc/qt5/qtcore/qsavefile-members.html
  2475. share/doc/qt5/qtcore/qsavefile.html
  2476. share/doc/qt5/qtcore/qscopedarraypointer-members.html
  2477. share/doc/qt5/qtcore/qscopedarraypointer.html
  2478. share/doc/qt5/qtcore/qscopedpointer-members.html
  2479. share/doc/qt5/qtcore/qscopedpointer.html
  2480. share/doc/qt5/qtcore/qscopedvaluerollback-members.html
  2481. share/doc/qt5/qtcore/qscopedvaluerollback.html
  2482. share/doc/qt5/qtcore/qsemaphore-members.html
  2483. share/doc/qt5/qtcore/qsemaphore.html
  2484. share/doc/qt5/qtcore/qsequentialanimationgroup-members.html
  2485. share/doc/qt5/qtcore/qsequentialanimationgroup.html
  2486. share/doc/qt5/qtcore/qsequentialiterable-const-iterator-members.html
  2487. share/doc/qt5/qtcore/qsequentialiterable-const-iterator.html
  2488. share/doc/qt5/qtcore/qsequentialiterable-members.html
  2489. share/doc/qt5/qtcore/qsequentialiterable.html
  2490. share/doc/qt5/qtcore/qset-const-iterator-members.html
  2491. share/doc/qt5/qtcore/qset-const-iterator.html
  2492. share/doc/qt5/qtcore/qset-iterator-members.html
  2493. share/doc/qt5/qtcore/qset-iterator.html
  2494. share/doc/qt5/qtcore/qset-members.html
  2495. share/doc/qt5/qtcore/qset.html
  2496. share/doc/qt5/qtcore/qsetiterator-members.html
  2497. share/doc/qt5/qtcore/qsetiterator.html
  2498. share/doc/qt5/qtcore/qsettings-members.html
  2499. share/doc/qt5/qtcore/qsettings-obsolete.html
  2500. share/doc/qt5/qtcore/qsettings.html
  2501. share/doc/qt5/qtcore/qshareddata-members.html
  2502. share/doc/qt5/qtcore/qshareddata.html
  2503. share/doc/qt5/qtcore/qshareddatapointer-members.html
  2504. share/doc/qt5/qtcore/qshareddatapointer.html
  2505. share/doc/qt5/qtcore/qsharedmemory-members.html
  2506. share/doc/qt5/qtcore/qsharedmemory.html
  2507. share/doc/qt5/qtcore/qsharedpointer-members.html
  2508. share/doc/qt5/qtcore/qsharedpointer.html
  2509. share/doc/qt5/qtcore/qsignalblocker-members.html
  2510. share/doc/qt5/qtcore/qsignalblocker.html
  2511. share/doc/qt5/qtcore/qsignalmapper-members.html
  2512. share/doc/qt5/qtcore/qsignalmapper.html
  2513. share/doc/qt5/qtcore/qsignaltransition-members.html
  2514. share/doc/qt5/qtcore/qsignaltransition.html
  2515. share/doc/qt5/qtcore/qsize-members.html
  2516. share/doc/qt5/qtcore/qsize.html
  2517. share/doc/qt5/qtcore/qsizef-members.html
  2518. share/doc/qt5/qtcore/qsizef.html
  2519. share/doc/qt5/qtcore/qsocketnotifier-members.html
  2520. share/doc/qt5/qtcore/qsocketnotifier.html
  2521. share/doc/qt5/qtcore/qsortfilterproxymodel-members.html
  2522. share/doc/qt5/qtcore/qsortfilterproxymodel-obsolete.html
  2523. share/doc/qt5/qtcore/qsortfilterproxymodel.html
  2524. share/doc/qt5/qtcore/qstack-members.html
  2525. share/doc/qt5/qtcore/qstack.html
  2526. share/doc/qt5/qtcore/qstandardpaths-members.html
  2527. share/doc/qt5/qtcore/qstandardpaths-obsolete.html
  2528. share/doc/qt5/qtcore/qstandardpaths.html
  2529. share/doc/qt5/qtcore/qstate-members.html
  2530. share/doc/qt5/qtcore/qstate.html
  2531. share/doc/qt5/qtcore/qstatemachine-members.html
  2532. share/doc/qt5/qtcore/qstatemachine-signalevent-members.html
  2533. share/doc/qt5/qtcore/qstatemachine-signalevent.html
  2534. share/doc/qt5/qtcore/qstatemachine-wrappedevent-members.html
  2535. share/doc/qt5/qtcore/qstatemachine-wrappedevent.html
  2536. share/doc/qt5/qtcore/qstatemachine.html
  2537. share/doc/qt5/qtcore/qstaticbytearraymatcher.html
  2538. share/doc/qt5/qtcore/qstaticplugin-members.html
  2539. share/doc/qt5/qtcore/qstaticplugin.html
  2540. share/doc/qt5/qtcore/qstorageinfo-members.html
  2541. share/doc/qt5/qtcore/qstorageinfo.html
  2542. share/doc/qt5/qtcore/qstring-members.html
  2543. share/doc/qt5/qtcore/qstring-null.html
  2544. share/doc/qt5/qtcore/qstring-obsolete.html
  2545. share/doc/qt5/qtcore/qstring.html
  2546. share/doc/qt5/qtcore/qstringlist-members.html
  2547. share/doc/qt5/qtcore/qstringlist.html
  2548. share/doc/qt5/qtcore/qstringlistmodel-members.html
  2549. share/doc/qt5/qtcore/qstringlistmodel.html
  2550. share/doc/qt5/qtcore/qstringmatcher-members.html
  2551. share/doc/qt5/qtcore/qstringmatcher.html
  2552. share/doc/qt5/qtcore/qstringref-members.html
  2553. share/doc/qt5/qtcore/qstringref-obsolete.html
  2554. share/doc/qt5/qtcore/qstringref.html
  2555. share/doc/qt5/qtcore/qsysinfo-members.html
  2556. share/doc/qt5/qtcore/qsysinfo-obsolete.html
  2557. share/doc/qt5/qtcore/qsysinfo.html
  2558. share/doc/qt5/qtcore/qsystemsemaphore-members.html
  2559. share/doc/qt5/qtcore/qsystemsemaphore.html
  2560. share/doc/qt5/qtcore/qt-obsolete.html
  2561. share/doc/qt5/qtcore/qt.html
  2562. share/doc/qt5/qtcore/qtalgorithms-obsolete.html
  2563. share/doc/qt5/qtcore/qtalgorithms.html
  2564. share/doc/qt5/qtcore/qtcore-attribution-android-gradle-wrapper.html
  2565. share/doc/qt5/qtcore/qtcore-attribution-cldr-data.html
  2566. share/doc/qt5/qtcore/qtcore-attribution-doubleconversion.html
  2567. share/doc/qt5/qtcore/qtcore-attribution-easing.html
  2568. share/doc/qt5/qtcore/qtcore-attribution-forkfd.html
  2569. share/doc/qt5/qtcore/qtcore-attribution-freebsd.html
  2570. share/doc/qt5/qtcore/qtcore-attribution-md4.html
  2571. share/doc/qt5/qtcore/qtcore-attribution-md5.html
  2572. share/doc/qt5/qtcore/qtcore-attribution-pcre2.html
  2573. share/doc/qt5/qtcore/qtcore-attribution-psl.html
  2574. share/doc/qt5/qtcore/qtcore-attribution-qbig5codecs.html
  2575. share/doc/qt5/qtcore/qtcore-attribution-qbkcodec.html
  2576. share/doc/qt5/qtcore/qtcore-attribution-qeucjpcodec.html
  2577. share/doc/qt5/qtcore/qtcore-attribution-qeuckrcodec.html
  2578. share/doc/qt5/qtcore/qtcore-attribution-qeventdispatcher-cf.html
  2579. share/doc/qt5/qtcore/qtcore-attribution-qjiscodec.html
  2580. share/doc/qt5/qtcore/qtcore-attribution-qsjiscodec.html
  2581. share/doc/qt5/qtcore/qtcore-attribution-qtemporaryfile.html
  2582. share/doc/qt5/qtcore/qtcore-attribution-qtsciicodec.html
  2583. share/doc/qt5/qtcore/qtcore-attribution-rfc6234.html
  2584. share/doc/qt5/qtcore/qtcore-attribution-sha1.html
  2585. share/doc/qt5/qtcore/qtcore-attribution-sha3-endian.html
  2586. share/doc/qt5/qtcore/qtcore-attribution-sha3-keccak.html
  2587. share/doc/qt5/qtcore/qtcore-attribution-zlib.html
  2588. share/doc/qt5/qtcore/qtcore-index.html
  2589. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-client-cpp.html
  2590. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-client-h.html
  2591. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-example.html
  2592. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-localfortuneclient-pro.html
  2593. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-main-cpp.html
  2594. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-example.html
  2595. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-localfortuneserver-pro.html
  2596. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-main-cpp.html
  2597. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-server-cpp.html
  2598. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-server-h.html
  2599. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-cpp.html
  2600. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-h.html
  2601. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-ui.html
  2602. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-example.html
  2603. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-main-cpp.html
  2604. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-sharedmemory-pro.html
  2605. share/doc/qt5/qtcore/qtcore-json-savegame-character-cpp.html
  2606. share/doc/qt5/qtcore/qtcore-json-savegame-character-h.html
  2607. share/doc/qt5/qtcore/qtcore-json-savegame-example.html
  2608. share/doc/qt5/qtcore/qtcore-json-savegame-game-cpp.html
  2609. share/doc/qt5/qtcore/qtcore-json-savegame-game-h.html
  2610. share/doc/qt5/qtcore/qtcore-json-savegame-level-cpp.html
  2611. share/doc/qt5/qtcore/qtcore-json-savegame-level-h.html
  2612. share/doc/qt5/qtcore/qtcore-json-savegame-main-cpp.html
  2613. share/doc/qt5/qtcore/qtcore-json-savegame-savegame-pro.html
  2614. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
  2615. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-main-cpp.html
  2616. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-cpp.html
  2617. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-h.html
  2618. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypebrowser-pro.html
  2619. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-cpp.html
  2620. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-h.html
  2621. share/doc/qt5/qtcore/qtcore-module.html
  2622. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-example.html
  2623. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-main-cpp.html
  2624. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrot-pro.html
  2625. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-cpp.html
  2626. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-h.html
  2627. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-renderthread-cpp.html
  2628. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-renderthread-h.html
  2629. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-block-cpp.html
  2630. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-block-h.html
  2631. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-example.html
  2632. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-main-cpp.html
  2633. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-queuedcustomtype-pro.html
  2634. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-renderthread-cpp.html
  2635. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-renderthread-h.html
  2636. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-window-cpp.html
  2637. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-window-h.html
  2638. share/doc/qt5/qtcore/qtcore-threads-semaphores-example.html
  2639. share/doc/qt5/qtcore/qtcore-threads-semaphores-semaphores-cpp.html
  2640. share/doc/qt5/qtcore/qtcore-threads-semaphores-semaphores-pro.html
  2641. share/doc/qt5/qtcore/qtcore-threads-waitconditions-example.html
  2642. share/doc/qt5/qtcore/qtcore-threads-waitconditions-waitconditions-cpp.html
  2643. share/doc/qt5/qtcore/qtcore-threads-waitconditions-waitconditions-pro.html
  2644. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-contiguouscache-pro.html
  2645. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-example.html
  2646. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-main-cpp.html
  2647. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-randomlistmodel-cpp.html
  2648. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-randomlistmodel-h.html
  2649. share/doc/qt5/qtcore/qtcore-tools-customtype-customtype-pro.html
  2650. share/doc/qt5/qtcore/qtcore-tools-customtype-example.html
  2651. share/doc/qt5/qtcore/qtcore-tools-customtype-main-cpp.html
  2652. share/doc/qt5/qtcore/qtcore-tools-customtype-message-cpp.html
  2653. share/doc/qt5/qtcore/qtcore-tools-customtype-message-h.html
  2654. share/doc/qt5/qtcore/qtcore.index
  2655. share/doc/qt5/qtcore/qtcore.qhp
  2656. share/doc/qt5/qtcore/qtcore.qhp.sha1
  2657. share/doc/qt5/qtcore/qtcore.tags
  2658. share/doc/qt5/qtcore/qtemporarydir-members.html
  2659. share/doc/qt5/qtcore/qtemporarydir.html
  2660. share/doc/qt5/qtcore/qtemporaryfile-members.html
  2661. share/doc/qt5/qtcore/qtemporaryfile-obsolete.html
  2662. share/doc/qt5/qtcore/qtemporaryfile.html
  2663. share/doc/qt5/qtcore/qtendian.html
  2664. share/doc/qt5/qtcore/qtextboundaryfinder-members.html
  2665. share/doc/qt5/qtcore/qtextboundaryfinder.html
  2666. share/doc/qt5/qtcore/qtextcodec-converterstate-members.html
  2667. share/doc/qt5/qtcore/qtextcodec-converterstate.html
  2668. share/doc/qt5/qtcore/qtextcodec-members.html
  2669. share/doc/qt5/qtcore/qtextcodec-obsolete.html
  2670. share/doc/qt5/qtcore/qtextcodec.html
  2671. share/doc/qt5/qtcore/qtextdecoder-members.html
  2672. share/doc/qt5/qtcore/qtextdecoder.html
  2673. share/doc/qt5/qtcore/qtextencoder-members.html
  2674. share/doc/qt5/qtcore/qtextencoder.html
  2675. share/doc/qt5/qtcore/qtextstream-members.html
  2676. share/doc/qt5/qtcore/qtextstream.html
  2677. share/doc/qt5/qtcore/qtglobal-obsolete.html
  2678. share/doc/qt5/qtcore/qtglobal.html
  2679. share/doc/qt5/qtcore/qthread-members.html
  2680. share/doc/qt5/qtcore/qthread.html
  2681. share/doc/qt5/qtcore/qthreadpool-members.html
  2682. share/doc/qt5/qtcore/qthreadpool-obsolete.html
  2683. share/doc/qt5/qtcore/qthreadpool.html
  2684. share/doc/qt5/qtcore/qthreadstorage-members.html
  2685. share/doc/qt5/qtcore/qthreadstorage.html
  2686. share/doc/qt5/qtcore/qtime-members.html
  2687. share/doc/qt5/qtcore/qtime.html
  2688. share/doc/qt5/qtcore/qtimeline-members.html
  2689. share/doc/qt5/qtcore/qtimeline.html
  2690. share/doc/qt5/qtcore/qtimer-members.html
  2691. share/doc/qt5/qtcore/qtimer.html
  2692. share/doc/qt5/qtcore/qtimerevent-members.html
  2693. share/doc/qt5/qtcore/qtimerevent.html
  2694. share/doc/qt5/qtcore/qtimezone-members.html
  2695. share/doc/qt5/qtcore/qtimezone-offsetdata-members.html
  2696. share/doc/qt5/qtcore/qtimezone-offsetdata.html
  2697. share/doc/qt5/qtcore/qtimezone.html
  2698. share/doc/qt5/qtcore/qtmath.html
  2699. share/doc/qt5/qtcore/qtplugin.html
  2700. share/doc/qt5/qtcore/qtranslator-members.html
  2701. share/doc/qt5/qtcore/qtranslator.html
  2702. share/doc/qt5/qtcore/qunhandledexception-members.html
  2703. share/doc/qt5/qtcore/qunhandledexception.html
  2704. share/doc/qt5/qtcore/qurl-members.html
  2705. share/doc/qt5/qtcore/qurl-obsolete.html
  2706. share/doc/qt5/qtcore/qurl.html
  2707. share/doc/qt5/qtcore/qurlquery-members.html
  2708. share/doc/qt5/qtcore/qurlquery.html
  2709. share/doc/qt5/qtcore/quuid-members.html
  2710. share/doc/qt5/qtcore/quuid.html
  2711. share/doc/qt5/qtcore/qvariant-members.html
  2712. share/doc/qt5/qtcore/qvariant-obsolete.html
  2713. share/doc/qt5/qtcore/qvariant.html
  2714. share/doc/qt5/qtcore/qvariantanimation-members.html
  2715. share/doc/qt5/qtcore/qvariantanimation.html
  2716. share/doc/qt5/qtcore/qvarlengtharray-members.html
  2717. share/doc/qt5/qtcore/qvarlengtharray.html
  2718. share/doc/qt5/qtcore/qvector-members.html
  2719. share/doc/qt5/qtcore/qvector.html
  2720. share/doc/qt5/qtcore/qvectoriterator-members.html
  2721. share/doc/qt5/qtcore/qvectoriterator.html
  2722. share/doc/qt5/qtcore/qversionnumber-members.html
  2723. share/doc/qt5/qtcore/qversionnumber.html
  2724. share/doc/qt5/qtcore/qwaitcondition-members.html
  2725. share/doc/qt5/qtcore/qwaitcondition.html
  2726. share/doc/qt5/qtcore/qweakpointer-members.html
  2727. share/doc/qt5/qtcore/qweakpointer-obsolete.html
  2728. share/doc/qt5/qtcore/qweakpointer.html
  2729. share/doc/qt5/qtcore/qwineventnotifier-members.html
  2730. share/doc/qt5/qtcore/qwineventnotifier.html
  2731. share/doc/qt5/qtcore/qwritelocker-members.html
  2732. share/doc/qt5/qtcore/qwritelocker.html
  2733. share/doc/qt5/qtcore/qxmlstreamattribute-members.html
  2734. share/doc/qt5/qtcore/qxmlstreamattribute.html
  2735. share/doc/qt5/qtcore/qxmlstreamattributes-members.html
  2736. share/doc/qt5/qtcore/qxmlstreamattributes.html
  2737. share/doc/qt5/qtcore/qxmlstreamentitydeclaration-members.html
  2738. share/doc/qt5/qtcore/qxmlstreamentitydeclaration.html
  2739. share/doc/qt5/qtcore/qxmlstreamentityresolver-members.html
  2740. share/doc/qt5/qtcore/qxmlstreamentityresolver.html
  2741. share/doc/qt5/qtcore/qxmlstreamnamespacedeclaration-members.html
  2742. share/doc/qt5/qtcore/qxmlstreamnamespacedeclaration.html
  2743. share/doc/qt5/qtcore/qxmlstreamnotationdeclaration-members.html
  2744. share/doc/qt5/qtcore/qxmlstreamnotationdeclaration.html
  2745. share/doc/qt5/qtcore/qxmlstreamreader-members.html
  2746. share/doc/qt5/qtcore/qxmlstreamreader.html
  2747. share/doc/qt5/qtcore/qxmlstreamwriter-members.html
  2748. share/doc/qt5/qtcore/qxmlstreamwriter.html
  2749. share/doc/qt5/qtcore/resources.html
  2750. share/doc/qt5/qtcore/shared.html
  2751. share/doc/qt5/qtcore/signalsandslots.html
  2752. share/doc/qt5/qtcore/statemachine-api.html
  2753. share/doc/qt5/qtcore/statemachine.html
  2754. share/doc/qt5/qtcore/style/offline-simple.css
  2755. share/doc/qt5/qtcore/style/offline.css
  2756. share/doc/qt5/qtcore/timers.html
  2757. share/doc/qt5/qtdbus.qch
  2758. share/doc/qt5/qtdbus/examples-dbus.html
  2759. share/doc/qt5/qtdbus/examples-manifest.xml
  2760. share/doc/qt5/qtdbus/images/arrow_bc.png
  2761. share/doc/qt5/qtdbus/images/bgrContent.png
  2762. share/doc/qt5/qtdbus/images/btn_next.png
  2763. share/doc/qt5/qtdbus/images/btn_prev.png
  2764. share/doc/qt5/qtdbus/images/bullet_dn.png
  2765. share/doc/qt5/qtdbus/images/bullet_sq.png
  2766. share/doc/qt5/qtdbus/images/dbus-chat-example.png
  2767. share/doc/qt5/qtdbus/images/home.png
  2768. share/doc/qt5/qtdbus/images/ico_note.png
  2769. share/doc/qt5/qtdbus/images/ico_note_attention.png
  2770. share/doc/qt5/qtdbus/images/ico_out.png
  2771. share/doc/qt5/qtdbus/images/logo.png
  2772. share/doc/qt5/qtdbus/images/qurl-ftppath.png
  2773. share/doc/qt5/qtdbus/images/remotecontrolledcar-car-example.png
  2774. share/doc/qt5/qtdbus/qdbus.html
  2775. share/doc/qt5/qtdbus/qdbusabstractadaptor-members.html
  2776. share/doc/qt5/qtdbus/qdbusabstractadaptor.html
  2777. share/doc/qt5/qtdbus/qdbusabstractinterface-members.html
  2778. share/doc/qt5/qtdbus/qdbusabstractinterface.html
  2779. share/doc/qt5/qtdbus/qdbusadaptorexample.html
  2780. share/doc/qt5/qtdbus/qdbusargument-members.html
  2781. share/doc/qt5/qtdbus/qdbusargument.html
  2782. share/doc/qt5/qtdbus/qdbusconnection-members.html
  2783. share/doc/qt5/qtdbus/qdbusconnection-obsolete.html
  2784. share/doc/qt5/qtdbus/qdbusconnection.html
  2785. share/doc/qt5/qtdbus/qdbusconnectioninterface-members.html
  2786. share/doc/qt5/qtdbus/qdbusconnectioninterface-obsolete.html
  2787. share/doc/qt5/qtdbus/qdbusconnectioninterface.html
  2788. share/doc/qt5/qtdbus/qdbuscontext-members.html
  2789. share/doc/qt5/qtdbus/qdbuscontext.html
  2790. share/doc/qt5/qtdbus/qdbusdeclaringsignals.html
  2791. share/doc/qt5/qtdbus/qdbusdeclaringslots.html
  2792. share/doc/qt5/qtdbus/qdbuserror-members.html
  2793. share/doc/qt5/qtdbus/qdbuserror.html
  2794. share/doc/qt5/qtdbus/qdbusinterface-members.html
  2795. share/doc/qt5/qtdbus/qdbusinterface.html
  2796. share/doc/qt5/qtdbus/qdbusmessage-members.html
  2797. share/doc/qt5/qtdbus/qdbusmessage.html
  2798. share/doc/qt5/qtdbus/qdbusobjectpath-members.html
  2799. share/doc/qt5/qtdbus/qdbusobjectpath.html
  2800. share/doc/qt5/qtdbus/qdbuspendingcall-members.html
  2801. share/doc/qt5/qtdbus/qdbuspendingcall.html
  2802. share/doc/qt5/qtdbus/qdbuspendingcallwatcher-members.html
  2803. share/doc/qt5/qtdbus/qdbuspendingcallwatcher.html
  2804. share/doc/qt5/qtdbus/qdbuspendingreply-members.html
  2805. share/doc/qt5/qtdbus/qdbuspendingreply.html
  2806. share/doc/qt5/qtdbus/qdbusreply-members.html
  2807. share/doc/qt5/qtdbus/qdbusreply.html
  2808. share/doc/qt5/qtdbus/qdbusserver-members.html
  2809. share/doc/qt5/qtdbus/qdbusserver.html
  2810. share/doc/qt5/qtdbus/qdbusservicewatcher-members.html
  2811. share/doc/qt5/qtdbus/qdbusservicewatcher.html
  2812. share/doc/qt5/qtdbus/qdbussignature-members.html
  2813. share/doc/qt5/qtdbus/qdbussignature.html
  2814. share/doc/qt5/qtdbus/qdbustypesystem.html
  2815. share/doc/qt5/qtdbus/qdbusunixfiledescriptor-members.html
  2816. share/doc/qt5/qtdbus/qdbusunixfiledescriptor.html
  2817. share/doc/qt5/qtdbus/qdbusvariant-members.html
  2818. share/doc/qt5/qtdbus/qdbusvariant.html
  2819. share/doc/qt5/qtdbus/qdbusviewer.html
  2820. share/doc/qt5/qtdbus/qdbusvirtualobject-members.html
  2821. share/doc/qt5/qtdbus/qdbusvirtualobject.html
  2822. share/doc/qt5/qtdbus/qdbusxml2cpp.html
  2823. share/doc/qt5/qtdbus/qtdbus-chat-chat-cpp.html
  2824. share/doc/qt5/qtdbus/qtdbus-chat-chat-h.html
  2825. share/doc/qt5/qtdbus/qtdbus-chat-chat-pro.html
  2826. share/doc/qt5/qtdbus/qtdbus-chat-chatmainwindow-ui.html
  2827. share/doc/qt5/qtdbus/qtdbus-chat-chatsetnickname-ui.html
  2828. share/doc/qt5/qtdbus/qtdbus-chat-example.html
  2829. share/doc/qt5/qtdbus/qtdbus-chat-org-example-chat-xml.html
  2830. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-cpp.html
  2831. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-h.html
  2832. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-pro.html
  2833. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpingpong-pro.html
  2834. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-cpp.html
  2835. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-h.html
  2836. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-pro.html
  2837. share/doc/qt5/qtdbus/qtdbus-complexpingpong-example.html
  2838. share/doc/qt5/qtdbus/qtdbus-complexpingpong-ping-common-h.html
  2839. share/doc/qt5/qtdbus/qtdbus-index.html
  2840. share/doc/qt5/qtdbus/qtdbus-listnames-example.html
  2841. share/doc/qt5/qtdbus/qtdbus-listnames-listnames-cpp.html
  2842. share/doc/qt5/qtdbus/qtdbus-listnames-listnames-pro.html
  2843. share/doc/qt5/qtdbus/qtdbus-module.html
  2844. share/doc/qt5/qtdbus/qtdbus-pingpong-example.html
  2845. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-common-h.html
  2846. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-cpp.html
  2847. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-pro.html
  2848. share/doc/qt5/qtdbus/qtdbus-pingpong-pingpong-pro.html
  2849. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-cpp.html
  2850. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-h.html
  2851. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-pro.html
  2852. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-cpp.html
  2853. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-h.html
  2854. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-pro.html
  2855. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-xml.html
  2856. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-main-cpp.html
  2857. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-car-xml.html
  2858. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-cpp.html
  2859. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-h.html
  2860. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-pro.html
  2861. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-ui.html
  2862. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-example.html
  2863. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-remotecontrolledcar-pro.html
  2864. share/doc/qt5/qtdbus/qtdbus.index
  2865. share/doc/qt5/qtdbus/qtdbus.qhp
  2866. share/doc/qt5/qtdbus/qtdbus.qhp.sha1
  2867. share/doc/qt5/qtdbus/style/offline-simple.css
  2868. share/doc/qt5/qtdbus/style/offline.css
  2869. share/doc/qt5/qtdbus/usingadaptors.html
  2870. share/doc/qt5/qtdesigner.qch
  2871. share/doc/qt5/qtdesigner/designer-buddy-mode.html
  2872. share/doc/qt5/qtdesigner/designer-connection-mode.html
  2873. share/doc/qt5/qtdesigner/designer-creating-custom-widgets-extensions.html
  2874. share/doc/qt5/qtdesigner/designer-creating-custom-widgets.html
  2875. share/doc/qt5/qtdesigner/designer-creating-mainwindows.html
  2876. share/doc/qt5/qtdesigner/designer-customizing-forms.html
  2877. share/doc/qt5/qtdesigner/designer-editing-mode.html
  2878. share/doc/qt5/qtdesigner/designer-layouts.html
  2879. share/doc/qt5/qtdesigner/designer-preview.html
  2880. share/doc/qt5/qtdesigner/designer-quick-start.html
  2881. share/doc/qt5/qtdesigner/designer-resources.html
  2882. share/doc/qt5/qtdesigner/designer-stylesheet.html
  2883. share/doc/qt5/qtdesigner/designer-tab-order.html
  2884. share/doc/qt5/qtdesigner/designer-to-know.html
  2885. share/doc/qt5/qtdesigner/designer-ui-file-format.html
  2886. share/doc/qt5/qtdesigner/designer-using-a-ui-file.html
  2887. share/doc/qt5/qtdesigner/designer-using-containers.html
  2888. share/doc/qt5/qtdesigner/designer-using-custom-widgets.html
  2889. share/doc/qt5/qtdesigner/designer-widget-mode.html
  2890. share/doc/qt5/qtdesigner/examples-designer.html
  2891. share/doc/qt5/qtdesigner/examples-manifest.xml
  2892. share/doc/qt5/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
  2893. share/doc/qt5/qtdesigner/images/arrow_bc.png
  2894. share/doc/qt5/qtdesigner/images/bgrContent.png
  2895. share/doc/qt5/qtdesigner/images/btn_next.png
  2896. share/doc/qt5/qtdesigner/images/btn_prev.png
  2897. share/doc/qt5/qtdesigner/images/bullet_dn.png
  2898. share/doc/qt5/qtdesigner/images/bullet_sq.png
  2899. share/doc/qt5/qtdesigner/images/calculatorbuilder-example.png
  2900. share/doc/qt5/qtdesigner/images/calculatorform-example.png
  2901. share/doc/qt5/qtdesigner/images/containerextension-example.png
  2902. share/doc/qt5/qtdesigner/images/customwidgetplugin-example.png
  2903. share/doc/qt5/qtdesigner/images/designer-action-editor.png
  2904. share/doc/qt5/qtdesigner/images/designer-add-files-button.png
  2905. share/doc/qt5/qtdesigner/images/designer-add-resource-entry-button.png
  2906. share/doc/qt5/qtdesigner/images/designer-adding-dockwidget.png
  2907. share/doc/qt5/qtdesigner/images/designer-adding-menu-action.png
  2908. share/doc/qt5/qtdesigner/images/designer-adding-toolbar-action.png
  2909. share/doc/qt5/qtdesigner/images/designer-buddy-making.png
  2910. share/doc/qt5/qtdesigner/images/designer-buddy-mode.png
  2911. share/doc/qt5/qtdesigner/images/designer-buddy-tool.png
  2912. share/doc/qt5/qtdesigner/images/designer-choosing-form.png
  2913. share/doc/qt5/qtdesigner/images/designer-code-viewer.png
  2914. share/doc/qt5/qtdesigner/images/designer-connection-dialog.png
  2915. share/doc/qt5/qtdesigner/images/designer-connection-editing.png
  2916. share/doc/qt5/qtdesigner/images/designer-connection-editor.png
  2917. share/doc/qt5/qtdesigner/images/designer-connection-highlight.png
  2918. share/doc/qt5/qtdesigner/images/designer-connection-making.png
  2919. share/doc/qt5/qtdesigner/images/designer-connection-mode.png
  2920. share/doc/qt5/qtdesigner/images/designer-connection-to-form.png
  2921. share/doc/qt5/qtdesigner/images/designer-connection-tool.png
  2922. share/doc/qt5/qtdesigner/images/designer-containers-dockwidget.png
  2923. share/doc/qt5/qtdesigner/images/designer-containers-frame.png
  2924. share/doc/qt5/qtdesigner/images/designer-containers-groupbox.png
  2925. share/doc/qt5/qtdesigner/images/designer-containers-stackedwidget.png
  2926. share/doc/qt5/qtdesigner/images/designer-containers-tabwidget.png
  2927. share/doc/qt5/qtdesigner/images/designer-containers-toolbox.png
  2928. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry1.png
  2929. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry2.png
  2930. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry3.png
  2931. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry4.png
  2932. share/doc/qt5/qtdesigner/images/designer-creating-menu1.png
  2933. share/doc/qt5/qtdesigner/images/designer-creating-menu2.png
  2934. share/doc/qt5/qtdesigner/images/designer-creating-menu3.png
  2935. share/doc/qt5/qtdesigner/images/designer-creating-menu4.png
  2936. share/doc/qt5/qtdesigner/images/designer-creating-toolbar.png
  2937. share/doc/qt5/qtdesigner/images/designer-dialog-preview.png
  2938. share/doc/qt5/qtdesigner/images/designer-dragging-onto-form.png
  2939. share/doc/qt5/qtdesigner/images/designer-edit-resource.png
  2940. share/doc/qt5/qtdesigner/images/designer-edit-resources-button.png
  2941. share/doc/qt5/qtdesigner/images/designer-editing-mode.png
  2942. share/doc/qt5/qtdesigner/images/designer-english-dialog.png
  2943. share/doc/qt5/qtdesigner/images/designer-file-menu.png
  2944. share/doc/qt5/qtdesigner/images/designer-form-layout-cleanlooks.png
  2945. share/doc/qt5/qtdesigner/images/designer-form-layout-macintosh.png
  2946. share/doc/qt5/qtdesigner/images/designer-form-layout-windowsXP.png
  2947. share/doc/qt5/qtdesigner/images/designer-form-layout.png
  2948. share/doc/qt5/qtdesigner/images/designer-form-layoutfunction.png
  2949. share/doc/qt5/qtdesigner/images/designer-form-settings.png
  2950. share/doc/qt5/qtdesigner/images/designer-form-viewcode.png
  2951. share/doc/qt5/qtdesigner/images/designer-french-dialog.png
  2952. share/doc/qt5/qtdesigner/images/designer-layout-inserting.png
  2953. share/doc/qt5/qtdesigner/images/designer-main-window.png
  2954. share/doc/qt5/qtdesigner/images/designer-manual-containerextension.png
  2955. share/doc/qt5/qtdesigner/images/designer-manual-membersheetextension.png
  2956. share/doc/qt5/qtdesigner/images/designer-manual-propertysheetextension.png
  2957. share/doc/qt5/qtdesigner/images/designer-manual-taskmenuextension.png
  2958. share/doc/qt5/qtdesigner/images/designer-multiple-screenshot.png
  2959. share/doc/qt5/qtdesigner/images/designer-object-inspector.png
  2960. share/doc/qt5/qtdesigner/images/designer-preview-deviceskin-selection.png
  2961. share/doc/qt5/qtdesigner/images/designer-preview-style-selection.png
  2962. share/doc/qt5/qtdesigner/images/designer-preview-style.png
  2963. share/doc/qt5/qtdesigner/images/designer-preview-stylesheet.png
  2964. share/doc/qt5/qtdesigner/images/designer-promoting-widgets.png
  2965. share/doc/qt5/qtdesigner/images/designer-property-editor-add-dynamic.png
  2966. share/doc/qt5/qtdesigner/images/designer-property-editor-configure.png
  2967. share/doc/qt5/qtdesigner/images/designer-property-editor-remove-dynamic.png
  2968. share/doc/qt5/qtdesigner/images/designer-property-editor-toolbar.png
  2969. share/doc/qt5/qtdesigner/images/designer-property-editor.png
  2970. share/doc/qt5/qtdesigner/images/designer-reload-resources-button.png
  2971. share/doc/qt5/qtdesigner/images/designer-remove-resource-entry-button.png
  2972. share/doc/qt5/qtdesigner/images/designer-removing-toolbar-action.png
  2973. share/doc/qt5/qtdesigner/images/designer-resource-browser.png
  2974. share/doc/qt5/qtdesigner/images/designer-resource-selector.png
  2975. share/doc/qt5/qtdesigner/images/designer-resources-editing.png
  2976. share/doc/qt5/qtdesigner/images/designer-resources-using.png
  2977. share/doc/qt5/qtdesigner/images/designer-screenshot.png
  2978. share/doc/qt5/qtdesigner/images/designer-selecting-widget.png
  2979. share/doc/qt5/qtdesigner/images/designer-set-layout.png
  2980. share/doc/qt5/qtdesigner/images/designer-set-layout2.png
  2981. share/doc/qt5/qtdesigner/images/designer-splitter-layout.png
  2982. share/doc/qt5/qtdesigner/images/designer-stylesheet-options.png
  2983. share/doc/qt5/qtdesigner/images/designer-stylesheet-usage.png
  2984. share/doc/qt5/qtdesigner/images/designer-tab-order-mode.png
  2985. share/doc/qt5/qtdesigner/images/designer-tab-order-tool.png
  2986. share/doc/qt5/qtdesigner/images/designer-widget-box.png
  2987. share/doc/qt5/qtdesigner/images/designer-widget-morph.png
  2988. share/doc/qt5/qtdesigner/images/designer-widget-tool.png
  2989. share/doc/qt5/qtdesigner/images/directapproach-calculatorform.png
  2990. share/doc/qt5/qtdesigner/images/home.png
  2991. share/doc/qt5/qtdesigner/images/ico_note.png
  2992. share/doc/qt5/qtdesigner/images/ico_note_attention.png
  2993. share/doc/qt5/qtdesigner/images/ico_out.png
  2994. share/doc/qt5/qtdesigner/images/logo.png
  2995. share/doc/qt5/qtdesigner/images/qtdesignerextensions.png
  2996. share/doc/qt5/qtdesigner/images/qtdesignerscreenshot.png
  2997. share/doc/qt5/qtdesigner/images/rgbController-arrangement.png
  2998. share/doc/qt5/qtdesigner/images/rgbController-configure-connection1.png
  2999. share/doc/qt5/qtdesigner/images/rgbController-configure-connection2.png
  3000. share/doc/qt5/qtdesigner/images/rgbController-final-layout.png
  3001. share/doc/qt5/qtdesigner/images/rgbController-form-gridLayout.png
  3002. share/doc/qt5/qtdesigner/images/rgbController-no-toplevel-layout.png
  3003. share/doc/qt5/qtdesigner/images/rgbController-property-editing.png
  3004. share/doc/qt5/qtdesigner/images/rgbController-screenshot.png
  3005. share/doc/qt5/qtdesigner/images/rgbController-selectForLayout.png
  3006. share/doc/qt5/qtdesigner/images/rgbController-signalsAndSlots.png
  3007. share/doc/qt5/qtdesigner/images/taskmenuextension-dialog.png
  3008. share/doc/qt5/qtdesigner/images/taskmenuextension-example-faded.png
  3009. share/doc/qt5/qtdesigner/images/taskmenuextension-menu.png
  3010. share/doc/qt5/qtdesigner/images/worldtimeclock-connection.png
  3011. share/doc/qt5/qtdesigner/images/worldtimeclock-signalandslot.png
  3012. share/doc/qt5/qtdesigner/images/worldtimeclockbuilder-example.png
  3013. share/doc/qt5/qtdesigner/images/worldtimeclockplugin-example.png
  3014. share/doc/qt5/qtdesigner/qabstractextensionfactory-members.html
  3015. share/doc/qt5/qtdesigner/qabstractextensionfactory.html
  3016. share/doc/qt5/qtdesigner/qabstractextensionmanager-members.html
  3017. share/doc/qt5/qtdesigner/qabstractextensionmanager.html
  3018. share/doc/qt5/qtdesigner/qabstractformbuilder-members.html
  3019. share/doc/qt5/qtdesigner/qabstractformbuilder.html
  3020. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface-members.html
  3021. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface.html
  3022. share/doc/qt5/qtdesigner/qdesignercontainerextension-members.html
  3023. share/doc/qt5/qtdesigner/qdesignercontainerextension.html
  3024. share/doc/qt5/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
  3025. share/doc/qt5/qtdesigner/qdesignercustomwidgetcollectioninterface.html
  3026. share/doc/qt5/qtdesigner/qdesignercustomwidgetinterface-members.html
  3027. share/doc/qt5/qtdesigner/qdesignercustomwidgetinterface.html
  3028. share/doc/qt5/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
  3029. share/doc/qt5/qtdesigner/qdesignerdynamicpropertysheetextension.html
  3030. share/doc/qt5/qtdesigner/qdesignerformeditorinterface-members.html
  3031. share/doc/qt5/qtdesigner/qdesignerformeditorinterface.html
  3032. share/doc/qt5/qtdesigner/qdesignerformwindowcursorinterface-members.html
  3033. share/doc/qt5/qtdesigner/qdesignerformwindowcursorinterface.html
  3034. share/doc/qt5/qtdesigner/qdesignerformwindowinterface-members.html
  3035. share/doc/qt5/qtdesigner/qdesignerformwindowinterface.html
  3036. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface-members.html
  3037. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
  3038. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface.html
  3039. share/doc/qt5/qtdesigner/qdesignermembersheetextension-members.html
  3040. share/doc/qt5/qtdesigner/qdesignermembersheetextension.html
  3041. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface-members.html
  3042. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface.html
  3043. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface-members.html
  3044. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface.html
  3045. share/doc/qt5/qtdesigner/qdesignerpropertysheetextension-members.html
  3046. share/doc/qt5/qtdesigner/qdesignerpropertysheetextension.html
  3047. share/doc/qt5/qtdesigner/qdesignertaskmenuextension-members.html
  3048. share/doc/qt5/qtdesigner/qdesignertaskmenuextension.html
  3049. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface-members.html
  3050. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface.html
  3051. share/doc/qt5/qtdesigner/qextensionfactory-members.html
  3052. share/doc/qt5/qtdesigner/qextensionfactory.html
  3053. share/doc/qt5/qtdesigner/qextensionmanager-members.html
  3054. share/doc/qt5/qtdesigner/qextensionmanager.html
  3055. share/doc/qt5/qtdesigner/qformbuilder-members.html
  3056. share/doc/qt5/qtdesigner/qformbuilder.html
  3057. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-pro.html
  3058. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-qrc.html
  3059. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-cpp.html
  3060. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-h.html
  3061. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-ui.html
  3062. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-example.html
  3063. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-main-cpp.html
  3064. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-cpp.html
  3065. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-h.html
  3066. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-pro.html
  3067. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-ui.html
  3068. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-example.html
  3069. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-main-cpp.html
  3070. share/doc/qt5/qtdesigner/qtdesigner-components.html
  3071. share/doc/qt5/qtdesigner/qtdesigner-containerextension-containerextension-pro.html
  3072. share/doc/qt5/qtdesigner/qtdesigner-containerextension-example.html
  3073. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidget-cpp.html
  3074. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidget-h.html
  3075. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-cpp.html
  3076. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-h.html
  3077. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-cpp.html
  3078. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-h.html
  3079. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-cpp.html
  3080. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-h.html
  3081. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-analogclock-cpp.html
  3082. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-analogclock-h.html
  3083. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-cpp.html
  3084. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-h.html
  3085. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-pro.html
  3086. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-example.html
  3087. share/doc/qt5/qtdesigner/qtdesigner-index.html
  3088. share/doc/qt5/qtdesigner/qtdesigner-manual.html
  3089. share/doc/qt5/qtdesigner/qtdesigner-module.html
  3090. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-example.html
  3091. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-taskmenuextension-pro.html
  3092. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoe-cpp.html
  3093. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoe-h.html
  3094. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-cpp.html
  3095. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-h.html
  3096. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-cpp.html
  3097. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-h.html
  3098. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-cpp.html
  3099. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-h.html
  3100. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-example.html
  3101. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-form-ui.html
  3102. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-main-cpp.html
  3103. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-pro.html
  3104. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-qrc.html
  3105. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-example.html
  3106. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-cpp.html
  3107. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-h.html
  3108. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-cpp.html
  3109. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-h.html
  3110. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-pro.html
  3111. share/doc/qt5/qtdesigner/qtdesigner.index
  3112. share/doc/qt5/qtdesigner/qtdesigner.qhp
  3113. share/doc/qt5/qtdesigner/qtdesigner.qhp.sha1
  3114. share/doc/qt5/qtdesigner/style/offline-simple.css
  3115. share/doc/qt5/qtdesigner/style/offline.css
  3116. share/doc/qt5/qtdoc.qch
  3117. share/doc/qt5/qtdoc/accelerators.html
  3118. share/doc/qt5/qtdoc/accessibility.html
  3119. share/doc/qt5/qtdoc/accessible-qtquick.html
  3120. share/doc/qt5/qtdoc/accessible-qwidget.html
  3121. share/doc/qt5/qtdoc/accessible.html
  3122. share/doc/qt5/qtdoc/activeqt-idc.html
  3123. share/doc/qt5/qtdoc/activeqt-testcon.html
  3124. share/doc/qt5/qtdoc/all-examples.html
  3125. share/doc/qt5/qtdoc/android-runtime-licensing-notes.html
  3126. share/doc/qt5/qtdoc/android-support.html
  3127. share/doc/qt5/qtdoc/android3rdpartylibs.html
  3128. share/doc/qt5/qtdoc/androidgs.html
  3129. share/doc/qt5/qtdoc/androidservices.html
  3130. share/doc/qt5/qtdoc/annotated.html
  3131. share/doc/qt5/qtdoc/appicon.html
  3132. share/doc/qt5/qtdoc/atomic-operations.html
  3133. share/doc/qt5/qtdoc/best-practices.html
  3134. share/doc/qt5/qtdoc/bughowto.html
  3135. share/doc/qt5/qtdoc/build-sources.html
  3136. share/doc/qt5/qtdoc/building-from-source-ios.html
  3137. share/doc/qt5/qtdoc/classes.html
  3138. share/doc/qt5/qtdoc/classesandfunctions.html
  3139. share/doc/qt5/qtdoc/cmake-manual.html
  3140. share/doc/qt5/qtdoc/commerciallicense.html
  3141. share/doc/qt5/qtdoc/configure-options.html
  3142. share/doc/qt5/qtdoc/debug.html
  3143. share/doc/qt5/qtdoc/deployment-android.html
  3144. share/doc/qt5/qtdoc/deployment-plugins.html
  3145. share/doc/qt5/qtdoc/deployment.html
  3146. share/doc/qt5/qtdoc/desktop-integration.html
  3147. share/doc/qt5/qtdoc/embedded-linux.html
  3148. share/doc/qt5/qtdoc/examples-activeqt.html
  3149. share/doc/qt5/qtdoc/examples-android.html
  3150. share/doc/qt5/qtdoc/examples-animation.html
  3151. share/doc/qt5/qtdoc/examples-draganddrop.html
  3152. share/doc/qt5/qtdoc/examples-gestures.html
  3153. share/doc/qt5/qtdoc/examples-ios.html
  3154. share/doc/qt5/qtdoc/examples-ipc.html
  3155. share/doc/qt5/qtdoc/examples-layouts.html
  3156. share/doc/qt5/qtdoc/examples-sql.html
  3157. share/doc/qt5/qtdoc/examples-statemachine.html
  3158. share/doc/qt5/qtdoc/examples-threadandconcurrent.html
  3159. share/doc/qt5/qtdoc/examples-widgets-tools.html
  3160. share/doc/qt5/qtdoc/examples-xml.html
  3161. share/doc/qt5/qtdoc/exceptionsafety.html
  3162. share/doc/qt5/qtdoc/fdl.html
  3163. share/doc/qt5/qtdoc/functions.html
  3164. share/doc/qt5/qtdoc/gettingstarted.html
  3165. share/doc/qt5/qtdoc/gettingstartedqml.html
  3166. share/doc/qt5/qtdoc/gettingstartedqt.html
  3167. share/doc/qt5/qtdoc/gpl.html
  3168. share/doc/qt5/qtdoc/groups.html
  3169. share/doc/qt5/qtdoc/hierarchy.html
  3170. share/doc/qt5/qtdoc/highdpi.html
  3171. share/doc/qt5/qtdoc/i18n-plural-rules.html
  3172. share/doc/qt5/qtdoc/i18n-source-translation.html
  3173. share/doc/qt5/qtdoc/i18n.html
  3174. share/doc/qt5/qtdoc/images/accessibleobjecttree.png
  3175. share/doc/qt5/qtdoc/images/activeqt-examples.png
  3176. share/doc/qt5/qtdoc/images/animatedtiles_snapshot.png
  3177. share/doc/qt5/qtdoc/images/animation-examples.png
  3178. share/doc/qt5/qtdoc/images/applicationwindow.png
  3179. share/doc/qt5/qtdoc/images/arrow_bc.png
  3180. share/doc/qt5/qtdoc/images/bgrContent.png
  3181. share/doc/qt5/qtdoc/images/btn_next.png
  3182. share/doc/qt5/qtdoc/images/btn_prev.png
  3183. share/doc/qt5/qtdoc/images/bullet_dn.png
  3184. share/doc/qt5/qtdoc/images/bullet_sq.png
  3185. share/doc/qt5/qtdoc/images/controlstexteditor_designer.png
  3186. share/doc/qt5/qtdoc/images/controlstexteditor_main.png
  3187. share/doc/qt5/qtdoc/images/controlstexteditor_navigator.png
  3188. share/doc/qt5/qtdoc/images/controlstexteditor_newproperties.png
  3189. share/doc/qt5/qtdoc/images/controlstexteditor_openproperties.png
  3190. share/doc/qt5/qtdoc/images/controlstexteditor_rowproperties.png
  3191. share/doc/qt5/qtdoc/images/deployment-mac-application.png
  3192. share/doc/qt5/qtdoc/images/deployment-mac-bundlestructure.png
  3193. share/doc/qt5/qtdoc/images/deployment-windows-depends.png
  3194. share/doc/qt5/qtdoc/images/draganddrop-examples.png
  3195. share/doc/qt5/qtdoc/images/flickr_application.png
  3196. share/doc/qt5/qtdoc/images/home.png
  3197. share/doc/qt5/qtdoc/images/ico_note.png
  3198. share/doc/qt5/qtdoc/images/ico_note_attention.png
  3199. share/doc/qt5/qtdoc/images/ico_out.png
  3200. share/doc/qt5/qtdoc/images/icon_QtCreator_78x78px.png
  3201. share/doc/qt5/qtdoc/images/icon_Qt_78x78px.png
  3202. share/doc/qt5/qtdoc/images/icon_Tools.png
  3203. share/doc/qt5/qtdoc/images/kernel-settings.png
  3204. share/doc/qt5/qtdoc/images/layout-examples.png
  3205. share/doc/qt5/qtdoc/images/logo.png
  3206. share/doc/qt5/qtdoc/images/notepad1.png
  3207. share/doc/qt5/qtdoc/images/notepad2.png
  3208. share/doc/qt5/qtdoc/images/notepad3.png
  3209. share/doc/qt5/qtdoc/images/notepad4.png
  3210. share/doc/qt5/qtdoc/images/ok.png
  3211. share/doc/qt5/qtdoc/images/open-project.png
  3212. share/doc/qt5/qtdoc/images/project-view-2.png
  3213. share/doc/qt5/qtdoc/images/project-view.png
  3214. share/doc/qt5/qtdoc/images/project-wizard.png
  3215. share/doc/qt5/qtdoc/images/qml-extending-types.png
  3216. share/doc/qt5/qtdoc/images/qml-texteditor1_button.png
  3217. share/doc/qt5/qtdoc/images/qml-texteditor1_editmenu.png
  3218. share/doc/qt5/qtdoc/images/qml-texteditor1_filemenu.png
  3219. share/doc/qt5/qtdoc/images/qml-texteditor1_simplebutton.png
  3220. share/doc/qt5/qtdoc/images/qml-texteditor2_menubar.png
  3221. share/doc/qt5/qtdoc/images/qml-texteditor3_texteditor.png
  3222. share/doc/qt5/qtdoc/images/qml-texteditor4_texteditor.png
  3223. share/doc/qt5/qtdoc/images/qml-texteditor5_editmenu.png
  3224. share/doc/qt5/qtdoc/images/qml-texteditor5_filemenu.png
  3225. share/doc/qt5/qtdoc/images/qml-texteditor5_newfile.png
  3226. share/doc/qt5/qtdoc/images/qml-uses-animation.png
  3227. share/doc/qt5/qtdoc/images/qml-uses-integratingjs.png
  3228. share/doc/qt5/qtdoc/images/qml-uses-layouts-anchors.png
  3229. share/doc/qt5/qtdoc/images/qml-uses-layouts-direct.png
  3230. share/doc/qt5/qtdoc/images/qml-uses-layouts-positioners.png
  3231. share/doc/qt5/qtdoc/images/qml-uses-text.png
  3232. share/doc/qt5/qtdoc/images/qml-uses-visual-opacity.png
  3233. share/doc/qt5/qtdoc/images/qml-uses-visual-rectangles.png
  3234. share/doc/qt5/qtdoc/images/qml-uses-visual-transforms.png
  3235. share/doc/qt5/qtdoc/images/qt-codesample.png
  3236. share/doc/qt5/qtdoc/images/qt-creator-gs.png
  3237. share/doc/qt5/qtdoc/images/qt-embedded-fontfeatures.png
  3238. share/doc/qt5/qtdoc/images/qt5_everywhere_demo.jpg
  3239. share/doc/qt5/qtdoc/images/qt5_graphicaleffects.jpg
  3240. share/doc/qt5/qtdoc/images/qt5_particles.jpg
  3241. share/doc/qt5/qtdoc/images/qt5_shadereffect.jpg
  3242. share/doc/qt5/qtdoc/images/qt5_video.jpg
  3243. share/doc/qt5/qtdoc/images/qt5_widgets.jpg
  3244. share/doc/qt5/qtdoc/images/qtcreator-run.png
  3245. share/doc/qt5/qtdoc/images/qtlocation-mapviewer-demo.jpg
  3246. share/doc/qt5/qtdoc/images/qtpositioning_weatherinfo_ex.jpg
  3247. share/doc/qt5/qtdoc/images/qtquickcontrols2-material.png
  3248. share/doc/qt5/qtdoc/images/qtsensors_accelbubble_ex.jpg
  3249. share/doc/qt5/qtdoc/images/qtwebengine_quicknanobrowser.jpg
  3250. share/doc/qt5/qtdoc/images/scalability-gridlayout.png
  3251. share/doc/qt5/qtdoc/images/select-item-to-add.png
  3252. share/doc/qt5/qtdoc/images/session.png
  3253. share/doc/qt5/qtdoc/images/sql-examples.png
  3254. share/doc/qt5/qtdoc/images/thread-examples.png
  3255. share/doc/qt5/qtdoc/images/threadsandobjects.png
  3256. share/doc/qt5/qtdoc/images/threadvisual-example.png
  3257. share/doc/qt5/qtdoc/images/tool-examples.png
  3258. share/doc/qt5/qtdoc/images/xml-examples.png
  3259. share/doc/qt5/qtdoc/index.html
  3260. share/doc/qt5/qtdoc/integrity-building-monolith.html
  3261. share/doc/qt5/qtdoc/integrity-building-qt-for-imx6quad-board.html
  3262. share/doc/qt5/qtdoc/integrity-building-u-boot-image.html
  3263. share/doc/qt5/qtdoc/integrity-creating-bootable-sd-card.html
  3264. share/doc/qt5/qtdoc/integrity-installing-dependencies.html
  3265. share/doc/qt5/qtdoc/integrity-monolith-project-tutorial.html
  3266. share/doc/qt5/qtdoc/integrity-preparing-bsp-for-imx6quad-board.html
  3267. share/doc/qt5/qtdoc/integrity-preparing-u-boot.html
  3268. share/doc/qt5/qtdoc/internationalization.html
  3269. share/doc/qt5/qtdoc/ios-support.html
  3270. share/doc/qt5/qtdoc/ipc.html
  3271. share/doc/qt5/qtdoc/known-issues.html
  3272. share/doc/qt5/qtdoc/lgpl.html
  3273. share/doc/qt5/qtdoc/licenses-used-in-qt.html
  3274. share/doc/qt5/qtdoc/licensing.html
  3275. share/doc/qt5/qtdoc/linux-building.html
  3276. share/doc/qt5/qtdoc/linux-deployment.html
  3277. share/doc/qt5/qtdoc/linux-issues.html
  3278. share/doc/qt5/qtdoc/linux-requirements.html
  3279. share/doc/qt5/qtdoc/linux.html
  3280. share/doc/qt5/qtdoc/mac-licensing.html
  3281. share/doc/qt5/qtdoc/mobiledevelopment.html
  3282. share/doc/qt5/qtdoc/moc.html
  3283. share/doc/qt5/qtdoc/modules-cpp.html
  3284. share/doc/qt5/qtdoc/modules-qml.html
  3285. share/doc/qt5/qtdoc/modules.html
  3286. share/doc/qt5/qtdoc/namespaces.html
  3287. share/doc/qt5/qtdoc/newclasses51.html
  3288. share/doc/qt5/qtdoc/newclasses52.html
  3289. share/doc/qt5/qtdoc/newclasses53.html
  3290. share/doc/qt5/qtdoc/newclasses54.html
  3291. share/doc/qt5/qtdoc/newclasses55.html
  3292. share/doc/qt5/qtdoc/newclasses56.html
  3293. share/doc/qt5/qtdoc/newclasses57.html
  3294. share/doc/qt5/qtdoc/newclasses58.html
  3295. share/doc/qt5/qtdoc/newclasses59.html
  3296. share/doc/qt5/qtdoc/obsoleteclasses.html
  3297. share/doc/qt5/qtdoc/obsoleteqmltypes.html
  3298. share/doc/qt5/qtdoc/opensourcelicense.html
  3299. share/doc/qt5/qtdoc/opensslsupport.html
  3300. share/doc/qt5/qtdoc/osx-building.html
  3301. share/doc/qt5/qtdoc/osx-deployment.html
  3302. share/doc/qt5/qtdoc/osx-issues.html
  3303. share/doc/qt5/qtdoc/osx-requirements.html
  3304. share/doc/qt5/qtdoc/osx.html
  3305. share/doc/qt5/qtdoc/overviews-main.html
  3306. share/doc/qt5/qtdoc/overviews.html
  3307. share/doc/qt5/qtdoc/platform-notes-android.html
  3308. share/doc/qt5/qtdoc/platform-notes-integrity.html
  3309. share/doc/qt5/qtdoc/platform-notes-ios.html
  3310. share/doc/qt5/qtdoc/platform-notes-qnx.html
  3311. share/doc/qt5/qtdoc/platform-notes-vxworks.html
  3312. share/doc/qt5/qtdoc/plugins-howto.html
  3313. share/doc/qt5/qtdoc/porting-to-ios.html
  3314. share/doc/qt5/qtdoc/portingcppapp.html
  3315. share/doc/qt5/qtdoc/portingguide.html
  3316. share/doc/qt5/qtdoc/portingqmlapp.html
  3317. share/doc/qt5/qtdoc/portingtoandroid.html
  3318. share/doc/qt5/qtdoc/publishtogoogleplay.html
  3319. share/doc/qt5/qtdoc/qml-codingconventions.html
  3320. share/doc/qt5/qtdoc/qml-glossary.html
  3321. share/doc/qt5/qtdoc/qmlapplications.html
  3322. share/doc/qt5/qtdoc/qmlbasictypes.html
  3323. share/doc/qt5/qtdoc/qmlfirststeps.html
  3324. share/doc/qt5/qtdoc/qmltypes.html
  3325. share/doc/qt5/qtdoc/qpa.html
  3326. share/doc/qt5/qtdoc/qt-activex.html
  3327. share/doc/qt5/qtdoc/qt-attribution-cmake-macros.html
  3328. share/doc/qt5/qtdoc/qt-attribution-llvmpipe.html
  3329. share/doc/qt5/qtdoc/qt-conf.html
  3330. share/doc/qt5/qtdoc/qt-embedded-fonts.html
  3331. share/doc/qt5/qtdoc/qt-embedded-kmap2qmap.html
  3332. share/doc/qt5/qtdoc/qt-embedded-makeqpf.html
  3333. share/doc/qt5/qtdoc/qt-gui-concepts.html
  3334. share/doc/qt5/qtdoc/qt5-intro.html
  3335. share/doc/qt5/qtdoc/qtconcurrent-mtexamples.html
  3336. share/doc/qt5/qtdoc/qtconcurrentexamples.html
  3337. share/doc/qt5/qtdoc/qtdoc.index
  3338. share/doc/qt5/qtdoc/qtdoc.qhp
  3339. share/doc/qt5/qtdoc/qtdoc.qhp.sha1
  3340. share/doc/qt5/qtdoc/qtexamples.html
  3341. share/doc/qt5/qtdoc/qtexamplesandtutorials.html
  3342. share/doc/qt5/qtdoc/qtmain.html
  3343. share/doc/qt5/qtdoc/qtmodules.html
  3344. share/doc/qt5/qtdoc/qtquick-debugging.html
  3345. share/doc/qt5/qtdoc/qtquick-deployment.html
  3346. share/doc/qt5/qtdoc/qtquick-internationalization.html
  3347. share/doc/qt5/qtdoc/qtquick-performance.html
  3348. share/doc/qt5/qtdoc/qtquick-porting-qt5.html
  3349. share/doc/qt5/qtdoc/qtquick-qmlscene.html
  3350. share/doc/qt5/qtdoc/qtquick-qtquicktest.html
  3351. share/doc/qt5/qtdoc/qtquick-usecase-animations.html
  3352. share/doc/qt5/qtdoc/qtquick-usecase-integratingjs.html
  3353. share/doc/qt5/qtdoc/qtquick-usecase-layouts.html
  3354. share/doc/qt5/qtdoc/qtquick-usecase-styling.html
  3355. share/doc/qt5/qtdoc/qtquick-usecase-text.html
  3356. share/doc/qt5/qtdoc/qtquick-usecase-userinput.html
  3357. share/doc/qt5/qtdoc/qtquick-usecase-visual.html
  3358. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-action.html
  3359. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-logic.html
  3360. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-ui.html
  3361. share/doc/qt5/qtdoc/qtquickcontrols-texteditor.html
  3362. share/doc/qt5/qtdoc/qundo.html
  3363. share/doc/qt5/qtdoc/rcc.html
  3364. share/doc/qt5/qtdoc/reference-overview.html
  3365. share/doc/qt5/qtdoc/restoring-geometry.html
  3366. share/doc/qt5/qtdoc/scalability.html
  3367. share/doc/qt5/qtdoc/session.html
  3368. share/doc/qt5/qtdoc/sharedlibrary.html
  3369. share/doc/qt5/qtdoc/signalsandslots-syntaxes.html
  3370. share/doc/qt5/qtdoc/sourcebreaks.html
  3371. share/doc/qt5/qtdoc/sql-examples.html
  3372. share/doc/qt5/qtdoc/string-processing.html
  3373. share/doc/qt5/qtdoc/style/offline-simple.css
  3374. share/doc/qt5/qtdoc/style/offline.css
  3375. share/doc/qt5/qtdoc/style/qt5-sidebar.html
  3376. share/doc/qt5/qtdoc/supported-platforms-and-configurations.html
  3377. share/doc/qt5/qtdoc/supported-platforms.html
  3378. share/doc/qt5/qtdoc/testing-and-debugging.html
  3379. share/doc/qt5/qtdoc/third-party-libraries.html
  3380. share/doc/qt5/qtdoc/thread-basics.html
  3381. share/doc/qt5/qtdoc/thread.html
  3382. share/doc/qt5/qtdoc/threads-modules.html
  3383. share/doc/qt5/qtdoc/threads-qobject.html
  3384. share/doc/qt5/qtdoc/threads-reentrancy.html
  3385. share/doc/qt5/qtdoc/threads-synchronizing.html
  3386. share/doc/qt5/qtdoc/threads-technologies.html
  3387. share/doc/qt5/qtdoc/threads.html
  3388. share/doc/qt5/qtdoc/topics-app-development.html
  3389. share/doc/qt5/qtdoc/topics-core.html
  3390. share/doc/qt5/qtdoc/topics-data-storage.html
  3391. share/doc/qt5/qtdoc/topics-graphics.html
  3392. share/doc/qt5/qtdoc/topics-network-connectivity.html
  3393. share/doc/qt5/qtdoc/topics-scripting.html
  3394. share/doc/qt5/qtdoc/topics-ui.html
  3395. share/doc/qt5/qtdoc/topics-web-content.html
  3396. share/doc/qt5/qtdoc/touchinputexamples.html
  3397. share/doc/qt5/qtdoc/trademarks.html
  3398. share/doc/qt5/qtdoc/uic.html
  3399. share/doc/qt5/qtdoc/unicode.html
  3400. share/doc/qt5/qtdoc/unix-signals.html
  3401. share/doc/qt5/qtdoc/vxworks.html
  3402. share/doc/qt5/qtdoc/whatsnew50.html
  3403. share/doc/qt5/qtdoc/whatsnew51.html
  3404. share/doc/qt5/qtdoc/whatsnew52.html
  3405. share/doc/qt5/qtdoc/whatsnew53.html
  3406. share/doc/qt5/qtdoc/whatsnew54.html
  3407. share/doc/qt5/qtdoc/whatsnew55.html
  3408. share/doc/qt5/qtdoc/whatsnew56.html
  3409. share/doc/qt5/qtdoc/whatsnew57.html
  3410. share/doc/qt5/qtdoc/whatsnew58.html
  3411. share/doc/qt5/qtdoc/whatsnew59.html
  3412. share/doc/qt5/qtdoc/why-moc.html
  3413. share/doc/qt5/qtdoc/windows-building.html
  3414. share/doc/qt5/qtdoc/windows-deployment.html
  3415. share/doc/qt5/qtdoc/windows-issues.html
  3416. share/doc/qt5/qtdoc/windows-requirements.html
  3417. share/doc/qt5/qtdoc/windows-support.html
  3418. share/doc/qt5/qtdoc/winrt-support.html
  3419. share/doc/qt5/qtdoc/xml-examples.html
  3420. share/doc/qt5/qtgamepad.qch
  3421. share/doc/qt5/qtgamepad/examples-manifest.xml
  3422. share/doc/qt5/qtgamepad/images/arrow_bc.png
  3423. share/doc/qt5/qtgamepad/images/bgrContent.png
  3424. share/doc/qt5/qtgamepad/images/btn_next.png
  3425. share/doc/qt5/qtgamepad/images/btn_prev.png
  3426. share/doc/qt5/qtgamepad/images/bullet_dn.png
  3427. share/doc/qt5/qtgamepad/images/bullet_sq.png
  3428. share/doc/qt5/qtgamepad/images/configuregamepadbuttons-example.png
  3429. share/doc/qt5/qtgamepad/images/home.png
  3430. share/doc/qt5/qtgamepad/images/ico_note.png
  3431. share/doc/qt5/qtgamepad/images/ico_note_attention.png
  3432. share/doc/qt5/qtgamepad/images/ico_out.png
  3433. share/doc/qt5/qtgamepad/images/keynavigationgamepad-example.png
  3434. share/doc/qt5/qtgamepad/images/logo.png
  3435. share/doc/qt5/qtgamepad/images/qtquickgamepad-example.png
  3436. share/doc/qt5/qtgamepad/qgamepad-members.html
  3437. share/doc/qt5/qtgamepad/qgamepad.html
  3438. share/doc/qt5/qtgamepad/qgamepadkeynavigation-members.html
  3439. share/doc/qt5/qtgamepad/qgamepadkeynavigation.html
  3440. share/doc/qt5/qtgamepad/qgamepadmanager-members.html
  3441. share/doc/qt5/qtgamepad/qgamepadmanager.html
  3442. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-android-androidmanifest-xml.html
  3443. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-configurebuttons-pro.html
  3444. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-example.html
  3445. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-main-cpp.html
  3446. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-main-qml.html
  3447. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-qml-qrc.html
  3448. share/doc/qt5/qtgamepad/qtgamepad-examples.html
  3449. share/doc/qt5/qtgamepad/qtgamepad-index.html
  3450. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-example.html
  3451. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-keynavigation-pro.html
  3452. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-main-cpp.html
  3453. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-qml-main-qml.html
  3454. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-qml-qrc.html
  3455. share/doc/qt5/qtgamepad/qtgamepad-module.html
  3456. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-example.html
  3457. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-main-cpp.html
  3458. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-mouseitem-pro.html
  3459. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-qml-main-qml.html
  3460. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-qml-qrc.html
  3461. share/doc/qt5/qtgamepad/qtgamepad-qmlmodule.html
  3462. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-example.html
  3463. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-main-cpp.html
  3464. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-buttonimage-qml.html
  3465. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-dpad-qml.html
  3466. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-joystickviewer-qml.html
  3467. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-leftthumbstick-qml.html
  3468. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-main-qml.html
  3469. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-qrc.html
  3470. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-rightthumbstick-qml.html
  3471. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-quickgamepad-pro.html
  3472. share/doc/qt5/qtgamepad/qtgamepad-simple-android-androidmanifest-xml.html
  3473. share/doc/qt5/qtgamepad/qtgamepad-simple-example.html
  3474. share/doc/qt5/qtgamepad/qtgamepad-simple-gamepadmonitor-cpp.html
  3475. share/doc/qt5/qtgamepad/qtgamepad-simple-gamepadmonitor-h.html
  3476. share/doc/qt5/qtgamepad/qtgamepad-simple-main-cpp.html
  3477. share/doc/qt5/qtgamepad/qtgamepad-simple-simple-pro.html
  3478. share/doc/qt5/qtgamepad/qtgamepad.index
  3479. share/doc/qt5/qtgamepad/qtgamepad.qhp
  3480. share/doc/qt5/qtgamepad/qtgamepad.qhp.sha1
  3481. share/doc/qt5/qtgamepad/style/offline-simple.css
  3482. share/doc/qt5/qtgamepad/style/offline.css
  3483. share/doc/qt5/qtgraphicaleffects.qch
  3484. share/doc/qt5/qtgraphicaleffects/graphicaleffects.html
  3485. share/doc/qt5/qtgraphicaleffects/images/Blend_bug_and_butterfly.png
  3486. share/doc/qt5/qtgraphicaleffects/images/Blend_mode1.png
  3487. share/doc/qt5/qtgraphicaleffects/images/Blend_mode10.png
  3488. share/doc/qt5/qtgraphicaleffects/images/Blend_mode11.png
  3489. share/doc/qt5/qtgraphicaleffects/images/Blend_mode12.png
  3490. share/doc/qt5/qtgraphicaleffects/images/Blend_mode13.png
  3491. share/doc/qt5/qtgraphicaleffects/images/Blend_mode14.png
  3492. share/doc/qt5/qtgraphicaleffects/images/Blend_mode15.png
  3493. share/doc/qt5/qtgraphicaleffects/images/Blend_mode16.png
  3494. share/doc/qt5/qtgraphicaleffects/images/Blend_mode17.png
  3495. share/doc/qt5/qtgraphicaleffects/images/Blend_mode18.png
  3496. share/doc/qt5/qtgraphicaleffects/images/Blend_mode19.png
  3497. share/doc/qt5/qtgraphicaleffects/images/Blend_mode2.png
  3498. share/doc/qt5/qtgraphicaleffects/images/Blend_mode20.png
  3499. share/doc/qt5/qtgraphicaleffects/images/Blend_mode21.png
  3500. share/doc/qt5/qtgraphicaleffects/images/Blend_mode22.png
  3501. share/doc/qt5/qtgraphicaleffects/images/Blend_mode3.png
  3502. share/doc/qt5/qtgraphicaleffects/images/Blend_mode4.png
  3503. share/doc/qt5/qtgraphicaleffects/images/Blend_mode5.png
  3504. share/doc/qt5/qtgraphicaleffects/images/Blend_mode6.png
  3505. share/doc/qt5/qtgraphicaleffects/images/Blend_mode7.png
  3506. share/doc/qt5/qtgraphicaleffects/images/Blend_mode8.png
  3507. share/doc/qt5/qtgraphicaleffects/images/Blend_mode9.png
  3508. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness1.png
  3509. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness2.png
  3510. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness3.png
  3511. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_bug.png
  3512. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast1.png
  3513. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast2.png
  3514. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast3.png
  3515. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast_graph.png
  3516. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_butterfly.png
  3517. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color1.png
  3518. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color2.png
  3519. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color3.png
  3520. share/doc/qt5/qtgraphicaleffects/images/Colorize_bug.png
  3521. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue1.png
  3522. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue2.png
  3523. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue3.png
  3524. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue_scale.png
  3525. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness1.png
  3526. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness2.png
  3527. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness3.png
  3528. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation1.png
  3529. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation2.png
  3530. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation3.png
  3531. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient.png
  3532. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle1.png
  3533. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle2.png
  3534. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle3.png
  3535. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient1.png
  3536. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient2.png
  3537. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient3.png
  3538. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset1.png
  3539. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset2.png
  3540. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset3.png
  3541. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_maskSource1.png
  3542. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_maskSource2.png
  3543. share/doc/qt5/qtgraphicaleffects/images/Desaturate_bug.png
  3544. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation1.png
  3545. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation2.png
  3546. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation3.png
  3547. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle1.png
  3548. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle2.png
  3549. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle3.png
  3550. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_bug.png
  3551. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length1.png
  3552. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length2.png
  3553. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length3.png
  3554. share/doc/qt5/qtgraphicaleffects/images/Displace_bug.png
  3555. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement1.png
  3556. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement2.png
  3557. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement3.png
  3558. share/doc/qt5/qtgraphicaleffects/images/Displace_map.png
  3559. share/doc/qt5/qtgraphicaleffects/images/DropShadow-transparentBorder.png
  3560. share/doc/qt5/qtgraphicaleffects/images/DropShadow_butterfly.png
  3561. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color1.png
  3562. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color2.png
  3563. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color3.png
  3564. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset1.png
  3565. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset2.png
  3566. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset3.png
  3567. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius1.png
  3568. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius2.png
  3569. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius3.png
  3570. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread1.png
  3571. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread2.png
  3572. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread3.png
  3573. share/doc/qt5/qtgraphicaleffects/images/FastBlur_bug.png
  3574. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius1.png
  3575. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius2.png
  3576. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius3.png
  3577. share/doc/qt5/qtgraphicaleffects/images/FastBlur_transparentBorder1.png
  3578. share/doc/qt5/qtgraphicaleffects/images/FastBlur_transparentBorder2.png
  3579. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_bug.png
  3580. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma1.png
  3581. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma1_graph.png
  3582. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma2.png
  3583. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma2_graph.png
  3584. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma3.png
  3585. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma3_graph.png
  3586. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_bug.png
  3587. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation1.png
  3588. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation2.png
  3589. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation3.png
  3590. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation_graph.png
  3591. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius1.png
  3592. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius2.png
  3593. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius3.png
  3594. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_transparentBorder1.png
  3595. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_transparentBorder2.png
  3596. share/doc/qt5/qtgraphicaleffects/images/Glow-transparentBorder.png
  3597. share/doc/qt5/qtgraphicaleffects/images/Glow_butterfly.png
  3598. share/doc/qt5/qtgraphicaleffects/images/Glow_color1.png
  3599. share/doc/qt5/qtgraphicaleffects/images/Glow_color2.png
  3600. share/doc/qt5/qtgraphicaleffects/images/Glow_color3.png
  3601. share/doc/qt5/qtgraphicaleffects/images/Glow_radius1.png
  3602. share/doc/qt5/qtgraphicaleffects/images/Glow_radius2.png
  3603. share/doc/qt5/qtgraphicaleffects/images/Glow_radius3.png
  3604. share/doc/qt5/qtgraphicaleffects/images/Glow_spread1.png
  3605. share/doc/qt5/qtgraphicaleffects/images/Glow_spread2.png
  3606. share/doc/qt5/qtgraphicaleffects/images/Glow_spread3.png
  3607. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_bug.png
  3608. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue1.png
  3609. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue2.png
  3610. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue3.png
  3611. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness1.png
  3612. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness2.png
  3613. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness3.png
  3614. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation1.png
  3615. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation2.png
  3616. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation3.png
  3617. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_butterfly.png
  3618. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color1.png
  3619. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color2.png
  3620. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color3.png
  3621. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_fast1.png
  3622. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_fast2.png
  3623. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset1.png
  3624. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset2.png
  3625. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset3.png
  3626. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius1.png
  3627. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius2.png
  3628. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius3.png
  3629. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread1.png
  3630. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread2.png
  3631. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread3.png
  3632. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_butterfly.png
  3633. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_default_curve.png
  3634. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma1.png
  3635. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma2.png
  3636. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma2_curve.png
  3637. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma3.png
  3638. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma3_curve.png
  3639. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput1.png
  3640. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput2.png
  3641. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput2_curve.png
  3642. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput3.png
  3643. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput3_curve.png
  3644. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput1.png
  3645. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput2.png
  3646. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput2_curve.png
  3647. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput3.png
  3648. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput3_curve.png
  3649. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput1.png
  3650. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput2.png
  3651. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput2_curve.png
  3652. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput3.png
  3653. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput3_curve.png
  3654. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput1.png
  3655. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput2.png
  3656. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput2_curve.png
  3657. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput3.png
  3658. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput3_curve.png
  3659. share/doc/qt5/qtgraphicaleffects/images/LinearGradient.png
  3660. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end1.png
  3661. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end2.png
  3662. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end3.png
  3663. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient1.png
  3664. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient2.png
  3665. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient3.png
  3666. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_maskSource1.png
  3667. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_maskSource2.png
  3668. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start1.png
  3669. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start2.png
  3670. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start3.png
  3671. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_bug.png
  3672. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_mask.png
  3673. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius1.png
  3674. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius2.png
  3675. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius3.png
  3676. share/doc/qt5/qtgraphicaleffects/images/OpacityMask_bug.png
  3677. share/doc/qt5/qtgraphicaleffects/images/OpacityMask_mask.png
  3678. share/doc/qt5/qtgraphicaleffects/images/Original_bug.png
  3679. share/doc/qt5/qtgraphicaleffects/images/Original_butterfly.png
  3680. share/doc/qt5/qtgraphicaleffects/images/Original_butterfly_black.png
  3681. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle1.png
  3682. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle2.png
  3683. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle3.png
  3684. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_bug.png
  3685. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset1.png
  3686. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset2.png
  3687. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset3.png
  3688. share/doc/qt5/qtgraphicaleffects/images/RadialGradient.png
  3689. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle1.png
  3690. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle2.png
  3691. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle3.png
  3692. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient1.png
  3693. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient2.png
  3694. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient3.png
  3695. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset1.png
  3696. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset2.png
  3697. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset3.png
  3698. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalRadius1.png
  3699. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalRadius2.png
  3700. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_maskSource1.png
  3701. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_maskSource2.png
  3702. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_applied.png
  3703. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color1.png
  3704. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color2.png
  3705. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color3.png
  3706. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius1.png
  3707. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius2.png
  3708. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius3.png
  3709. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius1.png
  3710. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius2.png
  3711. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius3.png
  3712. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread1.png
  3713. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread2.png
  3714. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread3.png
  3715. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_bug.png
  3716. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops1.png
  3717. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops2.png
  3718. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops3.png
  3719. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius1.png
  3720. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius2.png
  3721. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius3.png
  3722. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_transparentBorder1.png
  3723. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_transparentBorder2.png
  3724. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_bug.png
  3725. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_mask.png
  3726. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread1.png
  3727. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread2.png
  3728. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread3.png
  3729. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold1.png
  3730. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold2.png
  3731. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold3.png
  3732. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_bug.png
  3733. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset1.png
  3734. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset2.png
  3735. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset3.png
  3736. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length1.png
  3737. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length2.png
  3738. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length3.png
  3739. share/doc/qt5/qtgraphicaleffects/images/arrow_bc.png
  3740. share/doc/qt5/qtgraphicaleffects/images/bgrContent.png
  3741. share/doc/qt5/qtgraphicaleffects/images/btn_next.png
  3742. share/doc/qt5/qtgraphicaleffects/images/btn_prev.png
  3743. share/doc/qt5/qtgraphicaleffects/images/bullet_dn.png
  3744. share/doc/qt5/qtgraphicaleffects/images/bullet_sq.png
  3745. share/doc/qt5/qtgraphicaleffects/images/home.png
  3746. share/doc/qt5/qtgraphicaleffects/images/ico_note.png
  3747. share/doc/qt5/qtgraphicaleffects/images/ico_note_attention.png
  3748. share/doc/qt5/qtgraphicaleffects/images/ico_out.png
  3749. share/doc/qt5/qtgraphicaleffects/images/logo.png
  3750. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-blend-members.html
  3751. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-blend.html
  3752. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast-members.html
  3753. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast.html
  3754. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-colorize-members.html
  3755. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-colorize.html
  3756. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay-members.html
  3757. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay.html
  3758. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient-members.html
  3759. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient.html
  3760. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate-members.html
  3761. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate.html
  3762. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur-members.html
  3763. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur.html
  3764. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-displace-members.html
  3765. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-displace.html
  3766. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow-members.html
  3767. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow.html
  3768. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur-members.html
  3769. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur.html
  3770. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust-members.html
  3771. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust.html
  3772. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur-members.html
  3773. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur.html
  3774. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-glow-members.html
  3775. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-glow.html
  3776. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation-members.html
  3777. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation.html
  3778. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow-members.html
  3779. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow.html
  3780. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust-members.html
  3781. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust.html
  3782. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient-members.html
  3783. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient.html
  3784. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur-members.html
  3785. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur.html
  3786. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask-members.html
  3787. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask.html
  3788. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur-members.html
  3789. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur.html
  3790. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient-members.html
  3791. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient.html
  3792. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow-members.html
  3793. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow.html
  3794. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur-members.html
  3795. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur.html
  3796. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask-members.html
  3797. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask.html
  3798. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur-members.html
  3799. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur.html
  3800. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects-index.html
  3801. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects-qmlmodule.html
  3802. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.index
  3803. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.qhp
  3804. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.qhp.sha1
  3805. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.tags
  3806. share/doc/qt5/qtgraphicaleffects/style/offline-simple.css
  3807. share/doc/qt5/qtgraphicaleffects/style/offline.css
  3808. share/doc/qt5/qtgui.qch
  3809. share/doc/qt5/qtgui/coordsys.html
  3810. share/doc/qt5/qtgui/dnd.html
  3811. share/doc/qt5/qtgui/examples-manifest.xml
  3812. share/doc/qt5/qtgui/images/alphafill.png
  3813. share/doc/qt5/qtgui/images/analogclock-window-example.png
  3814. share/doc/qt5/qtgui/images/analogclockwindow-viewport.png
  3815. share/doc/qt5/qtgui/images/arrow_bc.png
  3816. share/doc/qt5/qtgui/images/bearings.png
  3817. share/doc/qt5/qtgui/images/bgrContent.png
  3818. share/doc/qt5/qtgui/images/brush-outline.png
  3819. share/doc/qt5/qtgui/images/brush-styles.png
  3820. share/doc/qt5/qtgui/images/btn_next.png
  3821. share/doc/qt5/qtgui/images/btn_prev.png
  3822. share/doc/qt5/qtgui/images/bullet_dn.png
  3823. share/doc/qt5/qtgui/images/bullet_sq.png
  3824. share/doc/qt5/qtgui/images/coordinatesystem-analogclock.png
  3825. share/doc/qt5/qtgui/images/coordinatesystem-line-antialias.png
  3826. share/doc/qt5/qtgui/images/coordinatesystem-line-raster.png
  3827. share/doc/qt5/qtgui/images/coordinatesystem-line.png
  3828. share/doc/qt5/qtgui/images/coordinatesystem-rect-antialias.png
  3829. share/doc/qt5/qtgui/images/coordinatesystem-rect-raster.png
  3830. share/doc/qt5/qtgui/images/coordinatesystem-rect.png
  3831. share/doc/qt5/qtgui/images/coordinatesystem-transformations.png
  3832. share/doc/qt5/qtgui/images/cursor-arrow.png
  3833. share/doc/qt5/qtgui/images/cursor-busy.png
  3834. share/doc/qt5/qtgui/images/cursor-closedhand.png
  3835. share/doc/qt5/qtgui/images/cursor-cross.png
  3836. share/doc/qt5/qtgui/images/cursor-forbidden.png
  3837. share/doc/qt5/qtgui/images/cursor-hand.png
  3838. share/doc/qt5/qtgui/images/cursor-hsplit.png
  3839. share/doc/qt5/qtgui/images/cursor-ibeam.png
  3840. share/doc/qt5/qtgui/images/cursor-openhand.png
  3841. share/doc/qt5/qtgui/images/cursor-sizeall.png
  3842. share/doc/qt5/qtgui/images/cursor-sizeb.png
  3843. share/doc/qt5/qtgui/images/cursor-sizef.png
  3844. share/doc/qt5/qtgui/images/cursor-sizeh.png
  3845. share/doc/qt5/qtgui/images/cursor-sizev.png
  3846. share/doc/qt5/qtgui/images/cursor-uparrow.png
  3847. share/doc/qt5/qtgui/images/cursor-vsplit.png
  3848. share/doc/qt5/qtgui/images/cursor-wait.png
  3849. share/doc/qt5/qtgui/images/cursor-whatsthis.png
  3850. share/doc/qt5/qtgui/images/home.png
  3851. share/doc/qt5/qtgui/images/hoverevents.png
  3852. share/doc/qt5/qtgui/images/ico_note.png
  3853. share/doc/qt5/qtgui/images/ico_note_attention.png
  3854. share/doc/qt5/qtgui/images/ico_out.png
  3855. share/doc/qt5/qtgui/images/icon.png
  3856. share/doc/qt5/qtgui/images/logo.png
  3857. share/doc/qt5/qtgui/images/openglwindow-example.png
  3858. share/doc/qt5/qtgui/images/paintsystem-antialiasing.png
  3859. share/doc/qt5/qtgui/images/paintsystem-core.png
  3860. share/doc/qt5/qtgui/images/paintsystem-fancygradient.png
  3861. share/doc/qt5/qtgui/images/paintsystem-gradients.png
  3862. share/doc/qt5/qtgui/images/paintsystem-movie.png
  3863. share/doc/qt5/qtgui/images/paintsystem-painterpath.png
  3864. share/doc/qt5/qtgui/images/palette.png
  3865. share/doc/qt5/qtgui/images/plaintext-layout.png
  3866. share/doc/qt5/qtgui/images/qcolor-cmyk.png
  3867. share/doc/qt5/qtgui/images/qcolor-hsv.png
  3868. share/doc/qt5/qtgui/images/qcolor-hue.png
  3869. share/doc/qt5/qtgui/images/qcolor-rgb.png
  3870. share/doc/qt5/qtgui/images/qcolor-saturation.png
  3871. share/doc/qt5/qtgui/images/qcolor-value.png
  3872. share/doc/qt5/qtgui/images/qconicalgradient.png
  3873. share/doc/qt5/qtgui/images/qgradient-conical.png
  3874. share/doc/qt5/qtgui/images/qgradient-linear.png
  3875. share/doc/qt5/qtgui/images/qgradient-radial.png
  3876. share/doc/qt5/qtgui/images/qimage-32bit_scaled.png
  3877. share/doc/qt5/qtgui/images/qimage-8bit_scaled.png
  3878. share/doc/qt5/qtgui/images/qimage-scaling.png
  3879. share/doc/qt5/qtgui/images/qlineargradient-pad.png
  3880. share/doc/qt5/qtgui/images/qlineargradient-reflect.png
  3881. share/doc/qt5/qtgui/images/qlineargradient-repeat.png
  3882. share/doc/qt5/qtgui/images/qmatrix-combinedtransformation.png
  3883. share/doc/qt5/qtgui/images/qmatrix-representation.png
  3884. share/doc/qt5/qtgui/images/qmatrix-simpletransformation.png
  3885. share/doc/qt5/qtgui/images/qpainter-affinetransformations.png
  3886. share/doc/qt5/qtgui/images/qpainter-arc.png
  3887. share/doc/qt5/qtgui/images/qpainter-basicdrawing.png
  3888. share/doc/qt5/qtgui/images/qpainter-chord.png
  3889. share/doc/qt5/qtgui/images/qpainter-clock.png
  3890. share/doc/qt5/qtgui/images/qpainter-compositiondemo.png
  3891. share/doc/qt5/qtgui/images/qpainter-compositionmode1.png
  3892. share/doc/qt5/qtgui/images/qpainter-compositionmode2.png
  3893. share/doc/qt5/qtgui/images/qpainter-concentriccircles.png
  3894. share/doc/qt5/qtgui/images/qpainter-ellipse.png
  3895. share/doc/qt5/qtgui/images/qpainter-gradients.png
  3896. share/doc/qt5/qtgui/images/qpainter-line.png
  3897. share/doc/qt5/qtgui/images/qpainter-painterpaths.png
  3898. share/doc/qt5/qtgui/images/qpainter-path.png
  3899. share/doc/qt5/qtgui/images/qpainter-pathstroking.png
  3900. share/doc/qt5/qtgui/images/qpainter-pie.png
  3901. share/doc/qt5/qtgui/images/qpainter-polygon.png
  3902. share/doc/qt5/qtgui/images/qpainter-rectangle.png
  3903. share/doc/qt5/qtgui/images/qpainter-rotation.png
  3904. share/doc/qt5/qtgui/images/qpainter-roundrect.png
  3905. share/doc/qt5/qtgui/images/qpainter-scale.png
  3906. share/doc/qt5/qtgui/images/qpainter-text-bounds.png
  3907. share/doc/qt5/qtgui/images/qpainter-text.png
  3908. share/doc/qt5/qtgui/images/qpainter-translation.png
  3909. share/doc/qt5/qtgui/images/qpainter-vectordeformation.png
  3910. share/doc/qt5/qtgui/images/qpainterpath-addellipse.png
  3911. share/doc/qt5/qtgui/images/qpainterpath-addpolygon.png
  3912. share/doc/qt5/qtgui/images/qpainterpath-addrectangle.png
  3913. share/doc/qt5/qtgui/images/qpainterpath-addtext.png
  3914. share/doc/qt5/qtgui/images/qpainterpath-arcto.png
  3915. share/doc/qt5/qtgui/images/qpainterpath-construction.png
  3916. share/doc/qt5/qtgui/images/qpainterpath-cubicto.png
  3917. share/doc/qt5/qtgui/images/qpainterpath-demo.png
  3918. share/doc/qt5/qtgui/images/qpainterpath-example.png
  3919. share/doc/qt5/qtgui/images/qpen-bevel.png
  3920. share/doc/qt5/qtgui/images/qpen-custom.png
  3921. share/doc/qt5/qtgui/images/qpen-dash.png
  3922. share/doc/qt5/qtgui/images/qpen-dashdot.png
  3923. share/doc/qt5/qtgui/images/qpen-dashdotdot.png
  3924. share/doc/qt5/qtgui/images/qpen-dashpattern.png
  3925. share/doc/qt5/qtgui/images/qpen-demo.png
  3926. share/doc/qt5/qtgui/images/qpen-dot.png
  3927. share/doc/qt5/qtgui/images/qpen-flat.png
  3928. share/doc/qt5/qtgui/images/qpen-miter.png
  3929. share/doc/qt5/qtgui/images/qpen-miterlimit.png
  3930. share/doc/qt5/qtgui/images/qpen-roundcap.png
  3931. share/doc/qt5/qtgui/images/qpen-roundjoin.png
  3932. share/doc/qt5/qtgui/images/qpen-solid.png
  3933. share/doc/qt5/qtgui/images/qpen-square.png
  3934. share/doc/qt5/qtgui/images/qpixelformat-argb32buffer.png
  3935. share/doc/qt5/qtgui/images/qradialgradient-pad.png
  3936. share/doc/qt5/qtgui/images/qradialgradient-reflect.png
  3937. share/doc/qt5/qtgui/images/qradialgradient-repeat.png
  3938. share/doc/qt5/qtgui/images/qrect-diagram-zero.png
  3939. share/doc/qt5/qtgui/images/qrectf-diagram-one.png
  3940. share/doc/qt5/qtgui/images/qrectf-diagram-three.png
  3941. share/doc/qt5/qtgui/images/qrectf-diagram-two.png
  3942. share/doc/qt5/qtgui/images/qstatustipevent-action.png
  3943. share/doc/qt5/qtgui/images/qstatustipevent-widget.png
  3944. share/doc/qt5/qtgui/images/qt-colors.png
  3945. share/doc/qt5/qtgui/images/qt-fillrule-oddeven.png
  3946. share/doc/qt5/qtgui/images/qt-fillrule-winding.png
  3947. share/doc/qt5/qtgui/images/qtabletevent-tilt.png
  3948. share/doc/qt5/qtgui/images/qtextblock-sequence.png
  3949. share/doc/qt5/qtgui/images/qtextfragment-split.png
  3950. share/doc/qt5/qtgui/images/qtextframe-style.png
  3951. share/doc/qt5/qtgui/images/qtexttableformat-cell.png
  3952. share/doc/qt5/qtgui/images/qtransform-combinedtransformation.png
  3953. share/doc/qt5/qtgui/images/qtransform-combinedtransformation2.png
  3954. share/doc/qt5/qtgui/images/qtransform-representation.png
  3955. share/doc/qt5/qtgui/images/qtransform-simpletransformation.png
  3956. share/doc/qt5/qtgui/images/richtext-document.png
  3957. share/doc/qt5/qtgui/images/rintersect.png
  3958. share/doc/qt5/qtgui/images/rsubtract.png
  3959. share/doc/qt5/qtgui/images/runion.png
  3960. share/doc/qt5/qtgui/images/rxor.png
  3961. share/doc/qt5/qtgui/images/texttable-merge.png
  3962. share/doc/qt5/qtgui/images/texttable-split.png
  3963. share/doc/qt5/qtgui/images/touchpoint-metrics.png
  3964. share/doc/qt5/qtgui/painting-3d.html
  3965. share/doc/qt5/qtgui/painting.html
  3966. share/doc/qt5/qtgui/paintsystem-devices.html
  3967. share/doc/qt5/qtgui/paintsystem-drawing.html
  3968. share/doc/qt5/qtgui/paintsystem-images.html
  3969. share/doc/qt5/qtgui/paintsystem.html
  3970. share/doc/qt5/qtgui/qabstractopenglfunctions-members.html
  3971. share/doc/qt5/qtgui/qabstractopenglfunctions.html
  3972. share/doc/qt5/qtgui/qabstracttextdocumentlayout-members.html
  3973. share/doc/qt5/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
  3974. share/doc/qt5/qtgui/qabstracttextdocumentlayout-paintcontext.html
  3975. share/doc/qt5/qtgui/qabstracttextdocumentlayout-selection-members.html
  3976. share/doc/qt5/qtgui/qabstracttextdocumentlayout-selection.html
  3977. share/doc/qt5/qtgui/qabstracttextdocumentlayout.html
  3978. share/doc/qt5/qtgui/qaccessible-members.html
  3979. share/doc/qt5/qtgui/qaccessible-obsolete.html
  3980. share/doc/qt5/qtgui/qaccessible-state-members.html
  3981. share/doc/qt5/qtgui/qaccessible-state.html
  3982. share/doc/qt5/qtgui/qaccessible.html
  3983. share/doc/qt5/qtgui/qaccessibleactioninterface-members.html
  3984. share/doc/qt5/qtgui/qaccessibleactioninterface.html
  3985. share/doc/qt5/qtgui/qaccessibleeditabletextinterface-members.html
  3986. share/doc/qt5/qtgui/qaccessibleeditabletextinterface.html
  3987. share/doc/qt5/qtgui/qaccessibleevent-members.html
  3988. share/doc/qt5/qtgui/qaccessibleevent.html
  3989. share/doc/qt5/qtgui/qaccessibleinterface-members.html
  3990. share/doc/qt5/qtgui/qaccessibleinterface.html
  3991. share/doc/qt5/qtgui/qaccessibleobject-members.html
  3992. share/doc/qt5/qtgui/qaccessibleobject.html
  3993. share/doc/qt5/qtgui/qaccessibleplugin-members.html
  3994. share/doc/qt5/qtgui/qaccessibleplugin.html
  3995. share/doc/qt5/qtgui/qaccessiblestatechangeevent-members.html
  3996. share/doc/qt5/qtgui/qaccessiblestatechangeevent.html
  3997. share/doc/qt5/qtgui/qaccessibletablecellinterface-members.html
  3998. share/doc/qt5/qtgui/qaccessibletablecellinterface.html
  3999. share/doc/qt5/qtgui/qaccessibletableinterface-members.html
  4000. share/doc/qt5/qtgui/qaccessibletableinterface.html
  4001. share/doc/qt5/qtgui/qaccessibletablemodelchangeevent-members.html
  4002. share/doc/qt5/qtgui/qaccessibletablemodelchangeevent.html
  4003. share/doc/qt5/qtgui/qaccessibletextcursorevent-members.html
  4004. share/doc/qt5/qtgui/qaccessibletextcursorevent.html
  4005. share/doc/qt5/qtgui/qaccessibletextinsertevent-members.html
  4006. share/doc/qt5/qtgui/qaccessibletextinsertevent.html
  4007. share/doc/qt5/qtgui/qaccessibletextinterface-members.html
  4008. share/doc/qt5/qtgui/qaccessibletextinterface.html
  4009. share/doc/qt5/qtgui/qaccessibletextremoveevent-members.html
  4010. share/doc/qt5/qtgui/qaccessibletextremoveevent.html
  4011. share/doc/qt5/qtgui/qaccessibletextselectionevent-members.html
  4012. share/doc/qt5/qtgui/qaccessibletextselectionevent.html
  4013. share/doc/qt5/qtgui/qaccessibletextupdateevent-members.html
  4014. share/doc/qt5/qtgui/qaccessibletextupdateevent.html
  4015. share/doc/qt5/qtgui/qaccessiblevaluechangeevent-members.html
  4016. share/doc/qt5/qtgui/qaccessiblevaluechangeevent.html
  4017. share/doc/qt5/qtgui/qaccessiblevalueinterface-members.html
  4018. share/doc/qt5/qtgui/qaccessiblevalueinterface.html
  4019. share/doc/qt5/qtgui/qactionevent-members.html
  4020. share/doc/qt5/qtgui/qactionevent.html
  4021. share/doc/qt5/qtgui/qbackingstore-members.html
  4022. share/doc/qt5/qtgui/qbackingstore.html
  4023. share/doc/qt5/qtgui/qbitmap-members.html
  4024. share/doc/qt5/qtgui/qbitmap-obsolete.html
  4025. share/doc/qt5/qtgui/qbitmap.html
  4026. share/doc/qt5/qtgui/qbrush-members.html
  4027. share/doc/qt5/qtgui/qbrush.html
  4028. share/doc/qt5/qtgui/qclipboard-members.html
  4029. share/doc/qt5/qtgui/qclipboard.html
  4030. share/doc/qt5/qtgui/qcloseevent-members.html
  4031. share/doc/qt5/qtgui/qcloseevent.html
  4032. share/doc/qt5/qtgui/qcolor-members.html
  4033. share/doc/qt5/qtgui/qcolor-obsolete.html
  4034. share/doc/qt5/qtgui/qcolor.html
  4035. share/doc/qt5/qtgui/qconicalgradient-members.html
  4036. share/doc/qt5/qtgui/qconicalgradient.html
  4037. share/doc/qt5/qtgui/qcontextmenuevent-members.html
  4038. share/doc/qt5/qtgui/qcontextmenuevent.html
  4039. share/doc/qt5/qtgui/qcursor-members.html
  4040. share/doc/qt5/qtgui/qcursor.html
  4041. share/doc/qt5/qtgui/qdesktopservices-members.html
  4042. share/doc/qt5/qtgui/qdesktopservices-obsolete.html
  4043. share/doc/qt5/qtgui/qdesktopservices.html
  4044. share/doc/qt5/qtgui/qdoublevalidator-members.html
  4045. share/doc/qt5/qtgui/qdoublevalidator.html
  4046. share/doc/qt5/qtgui/qdrag-members.html
  4047. share/doc/qt5/qtgui/qdrag-obsolete.html
  4048. share/doc/qt5/qtgui/qdrag.html
  4049. share/doc/qt5/qtgui/qdragenterevent-members.html
  4050. share/doc/qt5/qtgui/qdragenterevent.html
  4051. share/doc/qt5/qtgui/qdragleaveevent-members.html
  4052. share/doc/qt5/qtgui/qdragleaveevent.html
  4053. share/doc/qt5/qtgui/qdragmoveevent-members.html
  4054. share/doc/qt5/qtgui/qdragmoveevent.html
  4055. share/doc/qt5/qtgui/qdropevent-members.html
  4056. share/doc/qt5/qtgui/qdropevent.html
  4057. share/doc/qt5/qtgui/qenterevent-members.html
  4058. share/doc/qt5/qtgui/qenterevent.html
  4059. share/doc/qt5/qtgui/qexposeevent-members.html
  4060. share/doc/qt5/qtgui/qexposeevent.html
  4061. share/doc/qt5/qtgui/qfileopenevent-members.html
  4062. share/doc/qt5/qtgui/qfileopenevent.html
  4063. share/doc/qt5/qtgui/qfocusevent-members.html
  4064. share/doc/qt5/qtgui/qfocusevent.html
  4065. share/doc/qt5/qtgui/qfont-members.html
  4066. share/doc/qt5/qtgui/qfont-obsolete.html
  4067. share/doc/qt5/qtgui/qfont.html
  4068. share/doc/qt5/qtgui/qfontdatabase-members.html
  4069. share/doc/qt5/qtgui/qfontdatabase-obsolete.html
  4070. share/doc/qt5/qtgui/qfontdatabase.html
  4071. share/doc/qt5/qtgui/qfontinfo-members.html
  4072. share/doc/qt5/qtgui/qfontinfo-obsolete.html
  4073. share/doc/qt5/qtgui/qfontinfo.html
  4074. share/doc/qt5/qtgui/qfontmetrics-members.html
  4075. share/doc/qt5/qtgui/qfontmetrics-obsolete.html
  4076. share/doc/qt5/qtgui/qfontmetrics.html
  4077. share/doc/qt5/qtgui/qfontmetricsf-members.html
  4078. share/doc/qt5/qtgui/qfontmetricsf.html
  4079. share/doc/qt5/qtgui/qgenericmatrix-members.html
  4080. share/doc/qt5/qtgui/qgenericmatrix.html
  4081. share/doc/qt5/qtgui/qgenericplugin-members.html
  4082. share/doc/qt5/qtgui/qgenericplugin.html
  4083. share/doc/qt5/qtgui/qgenericpluginfactory-members.html
  4084. share/doc/qt5/qtgui/qgenericpluginfactory.html
  4085. share/doc/qt5/qtgui/qglyphrun-members.html
  4086. share/doc/qt5/qtgui/qglyphrun.html
  4087. share/doc/qt5/qtgui/qgradient-members.html
  4088. share/doc/qt5/qtgui/qgradient.html
  4089. share/doc/qt5/qtgui/qguiapplication-members.html
  4090. share/doc/qt5/qtgui/qguiapplication.html
  4091. share/doc/qt5/qtgui/qhelpevent-members.html
  4092. share/doc/qt5/qtgui/qhelpevent.html
  4093. share/doc/qt5/qtgui/qhideevent-members.html
  4094. share/doc/qt5/qtgui/qhideevent.html
  4095. share/doc/qt5/qtgui/qhoverevent-members.html
  4096. share/doc/qt5/qtgui/qhoverevent.html
  4097. share/doc/qt5/qtgui/qicon-members.html
  4098. share/doc/qt5/qtgui/qicon-obsolete.html
  4099. share/doc/qt5/qtgui/qicon.html
  4100. share/doc/qt5/qtgui/qicondragevent-members.html
  4101. share/doc/qt5/qtgui/qicondragevent.html
  4102. share/doc/qt5/qtgui/qiconengine-availablesizesargument-members.html
  4103. share/doc/qt5/qtgui/qiconengine-availablesizesargument.html
  4104. share/doc/qt5/qtgui/qiconengine-members.html
  4105. share/doc/qt5/qtgui/qiconengine-scaledpixmapargument-members.html
  4106. share/doc/qt5/qtgui/qiconengine-scaledpixmapargument.html
  4107. share/doc/qt5/qtgui/qiconengine.html
  4108. share/doc/qt5/qtgui/qiconengineplugin-members.html
  4109. share/doc/qt5/qtgui/qiconengineplugin.html
  4110. share/doc/qt5/qtgui/qimage-members.html
  4111. share/doc/qt5/qtgui/qimage-obsolete.html
  4112. share/doc/qt5/qtgui/qimage.html
  4113. share/doc/qt5/qtgui/qimageiohandler-members.html
  4114. share/doc/qt5/qtgui/qimageiohandler-obsolete.html
  4115. share/doc/qt5/qtgui/qimageiohandler.html
  4116. share/doc/qt5/qtgui/qimageioplugin-members.html
  4117. share/doc/qt5/qtgui/qimageioplugin.html
  4118. share/doc/qt5/qtgui/qimagereader-members.html
  4119. share/doc/qt5/qtgui/qimagereader.html
  4120. share/doc/qt5/qtgui/qimagewriter-members.html
  4121. share/doc/qt5/qtgui/qimagewriter-obsolete.html
  4122. share/doc/qt5/qtgui/qimagewriter.html
  4123. share/doc/qt5/qtgui/qinputevent-members.html
  4124. share/doc/qt5/qtgui/qinputevent.html
  4125. share/doc/qt5/qtgui/qinputmethod-members.html
  4126. share/doc/qt5/qtgui/qinputmethod.html
  4127. share/doc/qt5/qtgui/qinputmethodevent-attribute-members.html
  4128. share/doc/qt5/qtgui/qinputmethodevent-attribute.html
  4129. share/doc/qt5/qtgui/qinputmethodevent-members.html
  4130. share/doc/qt5/qtgui/qinputmethodevent.html
  4131. share/doc/qt5/qtgui/qinputmethodqueryevent-members.html
  4132. share/doc/qt5/qtgui/qinputmethodqueryevent.html
  4133. share/doc/qt5/qtgui/qintvalidator-members.html
  4134. share/doc/qt5/qtgui/qintvalidator.html
  4135. share/doc/qt5/qtgui/qkeyevent-members.html
  4136. share/doc/qt5/qtgui/qkeyevent.html
  4137. share/doc/qt5/qtgui/qkeysequence-members.html
  4138. share/doc/qt5/qtgui/qkeysequence-obsolete.html
  4139. share/doc/qt5/qtgui/qkeysequence.html
  4140. share/doc/qt5/qtgui/qlineargradient-members.html
  4141. share/doc/qt5/qtgui/qlineargradient.html
  4142. share/doc/qt5/qtgui/qmatrix-members.html
  4143. share/doc/qt5/qtgui/qmatrix.html
  4144. share/doc/qt5/qtgui/qmatrix4x4-members.html
  4145. share/doc/qt5/qtgui/qmatrix4x4-obsolete.html
  4146. share/doc/qt5/qtgui/qmatrix4x4.html
  4147. share/doc/qt5/qtgui/qmouseevent-members.html
  4148. share/doc/qt5/qtgui/qmouseevent-obsolete.html
  4149. share/doc/qt5/qtgui/qmouseevent.html
  4150. share/doc/qt5/qtgui/qmoveevent-members.html
  4151. share/doc/qt5/qtgui/qmoveevent.html
  4152. share/doc/qt5/qtgui/qmovie-members.html
  4153. share/doc/qt5/qtgui/qmovie.html
  4154. share/doc/qt5/qtgui/qnativegestureevent-members.html
  4155. share/doc/qt5/qtgui/qnativegestureevent.html
  4156. share/doc/qt5/qtgui/qoffscreensurface-members.html
  4157. share/doc/qt5/qtgui/qoffscreensurface.html
  4158. share/doc/qt5/qtgui/qopenglbuffer-members.html
  4159. share/doc/qt5/qtgui/qopenglbuffer.html
  4160. share/doc/qt5/qtgui/qopenglcontext-members.html
  4161. share/doc/qt5/qtgui/qopenglcontext.html
  4162. share/doc/qt5/qtgui/qopenglcontextgroup-members.html
  4163. share/doc/qt5/qtgui/qopenglcontextgroup.html
  4164. share/doc/qt5/qtgui/qopengldebuglogger-members.html
  4165. share/doc/qt5/qtgui/qopengldebuglogger.html
  4166. share/doc/qt5/qtgui/qopengldebugmessage-members.html
  4167. share/doc/qt5/qtgui/qopengldebugmessage.html
  4168. share/doc/qt5/qtgui/qopenglextrafunctions-members.html
  4169. share/doc/qt5/qtgui/qopenglextrafunctions.html
  4170. share/doc/qt5/qtgui/qopenglframebufferobject-members.html
  4171. share/doc/qt5/qtgui/qopenglframebufferobject.html
  4172. share/doc/qt5/qtgui/qopenglframebufferobjectformat-members.html
  4173. share/doc/qt5/qtgui/qopenglframebufferobjectformat.html
  4174. share/doc/qt5/qtgui/qopenglfunctions-1-0-members.html
  4175. share/doc/qt5/qtgui/qopenglfunctions-1-0.html
  4176. share/doc/qt5/qtgui/qopenglfunctions-1-1-members.html
  4177. share/doc/qt5/qtgui/qopenglfunctions-1-1.html
  4178. share/doc/qt5/qtgui/qopenglfunctions-1-2-members.html
  4179. share/doc/qt5/qtgui/qopenglfunctions-1-2.html
  4180. share/doc/qt5/qtgui/qopenglfunctions-1-3-members.html
  4181. share/doc/qt5/qtgui/qopenglfunctions-1-3.html
  4182. share/doc/qt5/qtgui/qopenglfunctions-1-4-members.html
  4183. share/doc/qt5/qtgui/qopenglfunctions-1-4.html
  4184. share/doc/qt5/qtgui/qopenglfunctions-1-5-members.html
  4185. share/doc/qt5/qtgui/qopenglfunctions-1-5.html
  4186. share/doc/qt5/qtgui/qopenglfunctions-2-0-members.html
  4187. share/doc/qt5/qtgui/qopenglfunctions-2-0.html
  4188. share/doc/qt5/qtgui/qopenglfunctions-2-1-members.html
  4189. share/doc/qt5/qtgui/qopenglfunctions-2-1.html
  4190. share/doc/qt5/qtgui/qopenglfunctions-3-0-members.html
  4191. share/doc/qt5/qtgui/qopenglfunctions-3-0.html
  4192. share/doc/qt5/qtgui/qopenglfunctions-3-1-members.html
  4193. share/doc/qt5/qtgui/qopenglfunctions-3-1.html
  4194. share/doc/qt5/qtgui/qopenglfunctions-3-2-compatibility-members.html
  4195. share/doc/qt5/qtgui/qopenglfunctions-3-2-compatibility.html
  4196. share/doc/qt5/qtgui/qopenglfunctions-3-2-core-members.html
  4197. share/doc/qt5/qtgui/qopenglfunctions-3-2-core.html
  4198. share/doc/qt5/qtgui/qopenglfunctions-3-3-compatibility-members.html
  4199. share/doc/qt5/qtgui/qopenglfunctions-3-3-compatibility.html
  4200. share/doc/qt5/qtgui/qopenglfunctions-3-3-core-members.html
  4201. share/doc/qt5/qtgui/qopenglfunctions-3-3-core.html
  4202. share/doc/qt5/qtgui/qopenglfunctions-4-0-compatibility-members.html
  4203. share/doc/qt5/qtgui/qopenglfunctions-4-0-compatibility.html
  4204. share/doc/qt5/qtgui/qopenglfunctions-4-0-core-members.html
  4205. share/doc/qt5/qtgui/qopenglfunctions-4-0-core.html
  4206. share/doc/qt5/qtgui/qopenglfunctions-4-1-compatibility-members.html
  4207. share/doc/qt5/qtgui/qopenglfunctions-4-1-compatibility.html
  4208. share/doc/qt5/qtgui/qopenglfunctions-4-1-core-members.html
  4209. share/doc/qt5/qtgui/qopenglfunctions-4-1-core.html
  4210. share/doc/qt5/qtgui/qopenglfunctions-4-2-compatibility-members.html
  4211. share/doc/qt5/qtgui/qopenglfunctions-4-2-compatibility.html
  4212. share/doc/qt5/qtgui/qopenglfunctions-4-2-core-members.html
  4213. share/doc/qt5/qtgui/qopenglfunctions-4-2-core.html
  4214. share/doc/qt5/qtgui/qopenglfunctions-4-3-compatibility-members.html
  4215. share/doc/qt5/qtgui/qopenglfunctions-4-3-compatibility.html
  4216. share/doc/qt5/qtgui/qopenglfunctions-4-3-core-members.html
  4217. share/doc/qt5/qtgui/qopenglfunctions-4-3-core.html
  4218. share/doc/qt5/qtgui/qopenglfunctions-4-4-compatibility-members.html
  4219. share/doc/qt5/qtgui/qopenglfunctions-4-4-compatibility.html
  4220. share/doc/qt5/qtgui/qopenglfunctions-4-4-core-members.html
  4221. share/doc/qt5/qtgui/qopenglfunctions-4-4-core.html
  4222. share/doc/qt5/qtgui/qopenglfunctions-4-5-compatibility-members.html
  4223. share/doc/qt5/qtgui/qopenglfunctions-4-5-compatibility.html
  4224. share/doc/qt5/qtgui/qopenglfunctions-4-5-core-members.html
  4225. share/doc/qt5/qtgui/qopenglfunctions-4-5-core.html
  4226. share/doc/qt5/qtgui/qopenglfunctions-es2-members.html
  4227. share/doc/qt5/qtgui/qopenglfunctions-es2.html
  4228. share/doc/qt5/qtgui/qopenglfunctions-members.html
  4229. share/doc/qt5/qtgui/qopenglfunctions-obsolete.html
  4230. share/doc/qt5/qtgui/qopenglfunctions.html
  4231. share/doc/qt5/qtgui/qopenglpaintdevice-members.html
  4232. share/doc/qt5/qtgui/qopenglpaintdevice.html
  4233. share/doc/qt5/qtgui/qopenglpixeltransferoptions-members.html
  4234. share/doc/qt5/qtgui/qopenglpixeltransferoptions.html
  4235. share/doc/qt5/qtgui/qopenglshader-members.html
  4236. share/doc/qt5/qtgui/qopenglshader.html
  4237. share/doc/qt5/qtgui/qopenglshaderprogram-members.html
  4238. share/doc/qt5/qtgui/qopenglshaderprogram.html
  4239. share/doc/qt5/qtgui/qopengltexture-members.html
  4240. share/doc/qt5/qtgui/qopengltexture-obsolete.html
  4241. share/doc/qt5/qtgui/qopengltexture.html
  4242. share/doc/qt5/qtgui/qopengltextureblitter-members.html
  4243. share/doc/qt5/qtgui/qopengltextureblitter.html
  4244. share/doc/qt5/qtgui/qopengltimemonitor-members.html
  4245. share/doc/qt5/qtgui/qopengltimemonitor.html
  4246. share/doc/qt5/qtgui/qopengltimerquery-members.html
  4247. share/doc/qt5/qtgui/qopengltimerquery.html
  4248. share/doc/qt5/qtgui/qopenglversionprofile-members.html
  4249. share/doc/qt5/qtgui/qopenglversionprofile.html
  4250. share/doc/qt5/qtgui/qopenglvertexarrayobject-binder-members.html
  4251. share/doc/qt5/qtgui/qopenglvertexarrayobject-binder.html
  4252. share/doc/qt5/qtgui/qopenglvertexarrayobject-members.html
  4253. share/doc/qt5/qtgui/qopenglvertexarrayobject.html
  4254. share/doc/qt5/qtgui/qopenglwindow-members.html
  4255. share/doc/qt5/qtgui/qopenglwindow.html
  4256. share/doc/qt5/qtgui/qpagedpaintdevice-margins-members.html
  4257. share/doc/qt5/qtgui/qpagedpaintdevice-margins.html
  4258. share/doc/qt5/qtgui/qpagedpaintdevice-members.html
  4259. share/doc/qt5/qtgui/qpagedpaintdevice.html
  4260. share/doc/qt5/qtgui/qpagelayout-members.html
  4261. share/doc/qt5/qtgui/qpagelayout.html
  4262. share/doc/qt5/qtgui/qpagesize-members.html
  4263. share/doc/qt5/qtgui/qpagesize.html
  4264. share/doc/qt5/qtgui/qpaintdevice-members.html
  4265. share/doc/qt5/qtgui/qpaintdevice.html
  4266. share/doc/qt5/qtgui/qpaintdevicewindow-members.html
  4267. share/doc/qt5/qtgui/qpaintdevicewindow.html
  4268. share/doc/qt5/qtgui/qpaintengine-members.html
  4269. share/doc/qt5/qtgui/qpaintengine.html
  4270. share/doc/qt5/qtgui/qpaintenginestate-members.html
  4271. share/doc/qt5/qtgui/qpaintenginestate-obsolete.html
  4272. share/doc/qt5/qtgui/qpaintenginestate.html
  4273. share/doc/qt5/qtgui/qpainter-members.html
  4274. share/doc/qt5/qtgui/qpainter-obsolete.html
  4275. share/doc/qt5/qtgui/qpainter-pixmapfragment-members.html
  4276. share/doc/qt5/qtgui/qpainter-pixmapfragment.html
  4277. share/doc/qt5/qtgui/qpainter.html
  4278. share/doc/qt5/qtgui/qpainterpath-element-members.html
  4279. share/doc/qt5/qtgui/qpainterpath-element.html
  4280. share/doc/qt5/qtgui/qpainterpath-members.html
  4281. share/doc/qt5/qtgui/qpainterpath-obsolete.html
  4282. share/doc/qt5/qtgui/qpainterpath.html
  4283. share/doc/qt5/qtgui/qpainterpathstroker-members.html
  4284. share/doc/qt5/qtgui/qpainterpathstroker.html
  4285. share/doc/qt5/qtgui/qpaintevent-members.html
  4286. share/doc/qt5/qtgui/qpaintevent.html
  4287. share/doc/qt5/qtgui/qpalette-members.html
  4288. share/doc/qt5/qtgui/qpalette-obsolete.html
  4289. share/doc/qt5/qtgui/qpalette.html
  4290. share/doc/qt5/qtgui/qpdfwriter-members.html
  4291. share/doc/qt5/qtgui/qpdfwriter-obsolete.html
  4292. share/doc/qt5/qtgui/qpdfwriter.html
  4293. share/doc/qt5/qtgui/qpen-members.html
  4294. share/doc/qt5/qtgui/qpen.html
  4295. share/doc/qt5/qtgui/qpicture-members.html
  4296. share/doc/qt5/qtgui/qpicture-obsolete.html
  4297. share/doc/qt5/qtgui/qpicture.html
  4298. share/doc/qt5/qtgui/qpictureformatplugin-members.html
  4299. share/doc/qt5/qtgui/qpictureformatplugin.html
  4300. share/doc/qt5/qtgui/qpictureio-members.html
  4301. share/doc/qt5/qtgui/qpictureio.html
  4302. share/doc/qt5/qtgui/qpixelformat-members.html
  4303. share/doc/qt5/qtgui/qpixelformat.html
  4304. share/doc/qt5/qtgui/qpixmap-members.html
  4305. share/doc/qt5/qtgui/qpixmap-obsolete.html
  4306. share/doc/qt5/qtgui/qpixmap.html
  4307. share/doc/qt5/qtgui/qpixmapcache-key-members.html
  4308. share/doc/qt5/qtgui/qpixmapcache-key.html
  4309. share/doc/qt5/qtgui/qpixmapcache-keydata-members.html
  4310. share/doc/qt5/qtgui/qpixmapcache-keydata.html
  4311. share/doc/qt5/qtgui/qpixmapcache-members.html
  4312. share/doc/qt5/qtgui/qpixmapcache-obsolete.html
  4313. share/doc/qt5/qtgui/qpixmapcache.html
  4314. share/doc/qt5/qtgui/qplatformsurfaceevent-members.html
  4315. share/doc/qt5/qtgui/qplatformsurfaceevent.html
  4316. share/doc/qt5/qtgui/qpointingdeviceuniqueid-members.html
  4317. share/doc/qt5/qtgui/qpointingdeviceuniqueid.html
  4318. share/doc/qt5/qtgui/qpolygon-members.html
  4319. share/doc/qt5/qtgui/qpolygon.html
  4320. share/doc/qt5/qtgui/qpolygonf-members.html
  4321. share/doc/qt5/qtgui/qpolygonf.html
  4322. share/doc/qt5/qtgui/qquaternion-members.html
  4323. share/doc/qt5/qtgui/qquaternion-obsolete.html
  4324. share/doc/qt5/qtgui/qquaternion.html
  4325. share/doc/qt5/qtgui/qradialgradient-members.html
  4326. share/doc/qt5/qtgui/qradialgradient.html
  4327. share/doc/qt5/qtgui/qrasterpaintengine-members.html
  4328. share/doc/qt5/qtgui/qrasterpaintengine.html
  4329. share/doc/qt5/qtgui/qrasterwindow-members.html
  4330. share/doc/qt5/qtgui/qrasterwindow.html
  4331. share/doc/qt5/qtgui/qrawfont-members.html
  4332. share/doc/qt5/qtgui/qrawfont.html
  4333. share/doc/qt5/qtgui/qregexpvalidator-members.html
  4334. share/doc/qt5/qtgui/qregexpvalidator.html
  4335. share/doc/qt5/qtgui/qregion-members.html
  4336. share/doc/qt5/qtgui/qregion-obsolete.html
  4337. share/doc/qt5/qtgui/qregion.html
  4338. share/doc/qt5/qtgui/qregularexpressionvalidator-members.html
  4339. share/doc/qt5/qtgui/qregularexpressionvalidator.html
  4340. share/doc/qt5/qtgui/qresizeevent-members.html
  4341. share/doc/qt5/qtgui/qresizeevent.html
  4342. share/doc/qt5/qtgui/qrgba64-members.html
  4343. share/doc/qt5/qtgui/qrgba64.html
  4344. share/doc/qt5/qtgui/qscreen-members.html
  4345. share/doc/qt5/qtgui/qscreen.html
  4346. share/doc/qt5/qtgui/qscrollevent-members.html
  4347. share/doc/qt5/qtgui/qscrollevent.html
  4348. share/doc/qt5/qtgui/qscrollprepareevent-members.html
  4349. share/doc/qt5/qtgui/qscrollprepareevent.html
  4350. share/doc/qt5/qtgui/qsessionmanager-members.html
  4351. share/doc/qt5/qtgui/qsessionmanager.html
  4352. share/doc/qt5/qtgui/qshortcutevent-members.html
  4353. share/doc/qt5/qtgui/qshortcutevent.html
  4354. share/doc/qt5/qtgui/qshowevent-members.html
  4355. share/doc/qt5/qtgui/qshowevent.html
  4356. share/doc/qt5/qtgui/qstandarditem-members.html
  4357. share/doc/qt5/qtgui/qstandarditem-obsolete.html
  4358. share/doc/qt5/qtgui/qstandarditem.html
  4359. share/doc/qt5/qtgui/qstandarditemmodel-members.html
  4360. share/doc/qt5/qtgui/qstandarditemmodel.html
  4361. share/doc/qt5/qtgui/qstatictext-members.html
  4362. share/doc/qt5/qtgui/qstatictext.html
  4363. share/doc/qt5/qtgui/qstatustipevent-members.html
  4364. share/doc/qt5/qtgui/qstatustipevent.html
  4365. share/doc/qt5/qtgui/qstylehints-members.html
  4366. share/doc/qt5/qtgui/qstylehints.html
  4367. share/doc/qt5/qtgui/qsupportedwritingsystems-members.html
  4368. share/doc/qt5/qtgui/qsupportedwritingsystems.html
  4369. share/doc/qt5/qtgui/qsurface-members.html
  4370. share/doc/qt5/qtgui/qsurface.html
  4371. share/doc/qt5/qtgui/qsurfaceformat-members.html
  4372. share/doc/qt5/qtgui/qsurfaceformat-obsolete.html
  4373. share/doc/qt5/qtgui/qsurfaceformat.html
  4374. share/doc/qt5/qtgui/qsyntaxhighlighter-members.html
  4375. share/doc/qt5/qtgui/qsyntaxhighlighter.html
  4376. share/doc/qt5/qtgui/qtabletevent-members.html
  4377. share/doc/qt5/qtgui/qtabletevent-obsolete.html
  4378. share/doc/qt5/qtgui/qtabletevent.html
  4379. share/doc/qt5/qtgui/qtextblock-iterator-members.html
  4380. share/doc/qt5/qtgui/qtextblock-iterator.html
  4381. share/doc/qt5/qtgui/qtextblock-members.html
  4382. share/doc/qt5/qtgui/qtextblock.html
  4383. share/doc/qt5/qtgui/qtextblockformat-members.html
  4384. share/doc/qt5/qtgui/qtextblockformat.html
  4385. share/doc/qt5/qtgui/qtextblockgroup-members.html
  4386. share/doc/qt5/qtgui/qtextblockgroup.html
  4387. share/doc/qt5/qtgui/qtextblockuserdata-members.html
  4388. share/doc/qt5/qtgui/qtextblockuserdata.html
  4389. share/doc/qt5/qtgui/qtextcharformat-members.html
  4390. share/doc/qt5/qtgui/qtextcharformat-obsolete.html
  4391. share/doc/qt5/qtgui/qtextcharformat.html
  4392. share/doc/qt5/qtgui/qtextcursor-members.html
  4393. share/doc/qt5/qtgui/qtextcursor.html
  4394. share/doc/qt5/qtgui/qtextdocument-members.html
  4395. share/doc/qt5/qtgui/qtextdocument.html
  4396. share/doc/qt5/qtgui/qtextdocumentfragment-members.html
  4397. share/doc/qt5/qtgui/qtextdocumentfragment.html
  4398. share/doc/qt5/qtgui/qtextdocumentwriter-members.html
  4399. share/doc/qt5/qtgui/qtextdocumentwriter.html
  4400. share/doc/qt5/qtgui/qtextformat-members.html
  4401. share/doc/qt5/qtgui/qtextformat.html
  4402. share/doc/qt5/qtgui/qtextfragment-members.html
  4403. share/doc/qt5/qtgui/qtextfragment.html
  4404. share/doc/qt5/qtgui/qtextframe-iterator-members.html
  4405. share/doc/qt5/qtgui/qtextframe-iterator.html
  4406. share/doc/qt5/qtgui/qtextframe-members.html
  4407. share/doc/qt5/qtgui/qtextframe.html
  4408. share/doc/qt5/qtgui/qtextframeformat-members.html
  4409. share/doc/qt5/qtgui/qtextframeformat.html
  4410. share/doc/qt5/qtgui/qtextimageformat-members.html
  4411. share/doc/qt5/qtgui/qtextimageformat.html
  4412. share/doc/qt5/qtgui/qtextinlineobject-members.html
  4413. share/doc/qt5/qtgui/qtextinlineobject.html
  4414. share/doc/qt5/qtgui/qtextitem-members.html
  4415. share/doc/qt5/qtgui/qtextitem.html
  4416. share/doc/qt5/qtgui/qtextlayout-formatrange-members.html
  4417. share/doc/qt5/qtgui/qtextlayout-formatrange.html
  4418. share/doc/qt5/qtgui/qtextlayout-members.html
  4419. share/doc/qt5/qtgui/qtextlayout-obsolete.html
  4420. share/doc/qt5/qtgui/qtextlayout.html
  4421. share/doc/qt5/qtgui/qtextlength-members.html
  4422. share/doc/qt5/qtgui/qtextlength.html
  4423. share/doc/qt5/qtgui/qtextline-members.html
  4424. share/doc/qt5/qtgui/qtextline.html
  4425. share/doc/qt5/qtgui/qtextlist-members.html
  4426. share/doc/qt5/qtgui/qtextlist-obsolete.html
  4427. share/doc/qt5/qtgui/qtextlist.html
  4428. share/doc/qt5/qtgui/qtextlistformat-members.html
  4429. share/doc/qt5/qtgui/qtextlistformat.html
  4430. share/doc/qt5/qtgui/qtextobject-members.html
  4431. share/doc/qt5/qtgui/qtextobject.html
  4432. share/doc/qt5/qtgui/qtextobjectinterface-members.html
  4433. share/doc/qt5/qtgui/qtextobjectinterface.html
  4434. share/doc/qt5/qtgui/qtextoption-members.html
  4435. share/doc/qt5/qtgui/qtextoption-tab-members.html
  4436. share/doc/qt5/qtgui/qtextoption-tab.html
  4437. share/doc/qt5/qtgui/qtextoption.html
  4438. share/doc/qt5/qtgui/qtexttable-members.html
  4439. share/doc/qt5/qtgui/qtexttable.html
  4440. share/doc/qt5/qtgui/qtexttablecell-members.html
  4441. share/doc/qt5/qtgui/qtexttablecell.html
  4442. share/doc/qt5/qtgui/qtexttablecellformat-members.html
  4443. share/doc/qt5/qtgui/qtexttablecellformat.html
  4444. share/doc/qt5/qtgui/qtexttableformat-members.html
  4445. share/doc/qt5/qtgui/qtexttableformat.html
  4446. share/doc/qt5/qtgui/qtgui-analogclock-analogclock-pro.html
  4447. share/doc/qt5/qtgui/qtgui-analogclock-example.html
  4448. share/doc/qt5/qtgui/qtgui-analogclock-main-cpp.html
  4449. share/doc/qt5/qtgui/qtgui-attribution-android-native-style.html
  4450. share/doc/qt5/qtgui/qtgui-attribution-angle-arrayboundsclamper.html
  4451. share/doc/qt5/qtgui/qtgui-attribution-angle-murmurhash.html
  4452. share/doc/qt5/qtgui/qtgui-attribution-angle-systeminfo.html
  4453. share/doc/qt5/qtgui/qtgui-attribution-angle-trace-event.html
  4454. share/doc/qt5/qtgui/qtgui-attribution-angle.html
  4455. share/doc/qt5/qtgui/qtgui-attribution-cocoa-platform-plugin.html
  4456. share/doc/qt5/qtgui/qtgui-attribution-freetype-bdf.html
  4457. share/doc/qt5/qtgui/qtgui-attribution-freetype-pcf.html
  4458. share/doc/qt5/qtgui/qtgui-attribution-freetype-zlib.html
  4459. share/doc/qt5/qtgui/qtgui-attribution-freetype.html
  4460. share/doc/qt5/qtgui/qtgui-attribution-grayraster.html
  4461. share/doc/qt5/qtgui/qtgui-attribution-harfbuzz-ng.html
  4462. share/doc/qt5/qtgui/qtgui-attribution-harfbuzz.html
  4463. share/doc/qt5/qtgui/qtgui-attribution-iaccessible2.html
  4464. share/doc/qt5/qtgui/qtgui-attribution-libjpeg.html
  4465. share/doc/qt5/qtgui/qtgui-attribution-libpng.html
  4466. share/doc/qt5/qtgui/qtgui-attribution-opengl-es2-headers.html
  4467. share/doc/qt5/qtgui/qtgui-attribution-opengl-headers.html
  4468. share/doc/qt5/qtgui/qtgui-attribution-pixman.html
  4469. share/doc/qt5/qtgui/qtgui-attribution-smooth-scaling-algorithm.html
  4470. share/doc/qt5/qtgui/qtgui-attribution-wintab.html
  4471. share/doc/qt5/qtgui/qtgui-attribution-xcb.html
  4472. share/doc/qt5/qtgui/qtgui-attribution-xkbcommon.html
  4473. share/doc/qt5/qtgui/qtgui-index.html
  4474. share/doc/qt5/qtgui/qtgui-module.html
  4475. share/doc/qt5/qtgui/qtgui-openglwindow-example.html
  4476. share/doc/qt5/qtgui/qtgui-openglwindow-main-cpp.html
  4477. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-cpp.html
  4478. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-h.html
  4479. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-pro.html
  4480. share/doc/qt5/qtgui/qtgui-rasterwindow-example.html
  4481. share/doc/qt5/qtgui/qtgui-rasterwindow-main-cpp.html
  4482. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-cpp.html
  4483. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-h.html
  4484. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-pro.html
  4485. share/doc/qt5/qtgui/qtgui.index
  4486. share/doc/qt5/qtgui/qtgui.qhp
  4487. share/doc/qt5/qtgui/qtgui.qhp.sha1
  4488. share/doc/qt5/qtgui/qtgui.tags
  4489. share/doc/qt5/qtgui/qtouchdevice-members.html
  4490. share/doc/qt5/qtgui/qtouchdevice.html
  4491. share/doc/qt5/qtgui/qtouchevent-members.html
  4492. share/doc/qt5/qtgui/qtouchevent-obsolete.html
  4493. share/doc/qt5/qtgui/qtouchevent-touchpoint-members.html
  4494. share/doc/qt5/qtgui/qtouchevent-touchpoint-obsolete.html
  4495. share/doc/qt5/qtgui/qtouchevent-touchpoint.html
  4496. share/doc/qt5/qtgui/qtouchevent.html
  4497. share/doc/qt5/qtgui/qtransform-members.html
  4498. share/doc/qt5/qtgui/qtransform-obsolete.html
  4499. share/doc/qt5/qtgui/qtransform.html
  4500. share/doc/qt5/qtgui/qvalidator-members.html
  4501. share/doc/qt5/qtgui/qvalidator.html
  4502. share/doc/qt5/qtgui/qvector2d-members.html
  4503. share/doc/qt5/qtgui/qvector2d.html
  4504. share/doc/qt5/qtgui/qvector3d-members.html
  4505. share/doc/qt5/qtgui/qvector3d.html
  4506. share/doc/qt5/qtgui/qvector4d-members.html
  4507. share/doc/qt5/qtgui/qvector4d.html
  4508. share/doc/qt5/qtgui/qwhatsthisclickedevent-members.html
  4509. share/doc/qt5/qtgui/qwhatsthisclickedevent.html
  4510. share/doc/qt5/qtgui/qwheelevent-members.html
  4511. share/doc/qt5/qtgui/qwheelevent-obsolete.html
  4512. share/doc/qt5/qtgui/qwheelevent.html
  4513. share/doc/qt5/qtgui/qwindow-members.html
  4514. share/doc/qt5/qtgui/qwindow.html
  4515. share/doc/qt5/qtgui/qwindowstatechangeevent-members.html
  4516. share/doc/qt5/qtgui/qwindowstatechangeevent.html
  4517. share/doc/qt5/qtgui/richtext-advanced-processing.html
  4518. share/doc/qt5/qtgui/richtext-common-tasks.html
  4519. share/doc/qt5/qtgui/richtext-cursor.html
  4520. share/doc/qt5/qtgui/richtext-html-subset.html
  4521. share/doc/qt5/qtgui/richtext-layouts.html
  4522. share/doc/qt5/qtgui/richtext-processing.html
  4523. share/doc/qt5/qtgui/richtext-structure.html
  4524. share/doc/qt5/qtgui/richtext.html
  4525. share/doc/qt5/qtgui/style/offline-simple.css
  4526. share/doc/qt5/qtgui/style/offline.css
  4527. share/doc/qt5/qthelp.qch
  4528. share/doc/qt5/qthelp/examples-manifest.xml
  4529. share/doc/qt5/qthelp/examples-qthelp.html
  4530. share/doc/qt5/qthelp/helpsystem.html
  4531. share/doc/qt5/qthelp/images/arrow_bc.png
  4532. share/doc/qt5/qthelp/images/bgrContent.png
  4533. share/doc/qt5/qthelp/images/btn_next.png
  4534. share/doc/qt5/qthelp/images/btn_prev.png
  4535. share/doc/qt5/qthelp/images/bullet_dn.png
  4536. share/doc/qt5/qthelp/images/bullet_sq.png
  4537. share/doc/qt5/qthelp/images/home.png
  4538. share/doc/qt5/qthelp/images/ico_note.png
  4539. share/doc/qt5/qthelp/images/ico_note_attention.png
  4540. share/doc/qt5/qthelp/images/ico_out.png
  4541. share/doc/qt5/qthelp/images/logo.png
  4542. share/doc/qt5/qthelp/qhelpcontentitem-members.html
  4543. share/doc/qt5/qthelp/qhelpcontentitem.html
  4544. share/doc/qt5/qthelp/qhelpcontentmodel-members.html
  4545. share/doc/qt5/qthelp/qhelpcontentmodel.html
  4546. share/doc/qt5/qthelp/qhelpcontentwidget-members.html
  4547. share/doc/qt5/qthelp/qhelpcontentwidget.html
  4548. share/doc/qt5/qthelp/qhelpengine-members.html
  4549. share/doc/qt5/qthelp/qhelpengine.html
  4550. share/doc/qt5/qthelp/qhelpenginecore-members.html
  4551. share/doc/qt5/qthelp/qhelpenginecore.html
  4552. share/doc/qt5/qthelp/qhelpindexmodel-members.html
  4553. share/doc/qt5/qthelp/qhelpindexmodel-obsolete.html
  4554. share/doc/qt5/qthelp/qhelpindexmodel.html
  4555. share/doc/qt5/qthelp/qhelpindexwidget-members.html
  4556. share/doc/qt5/qthelp/qhelpindexwidget.html
  4557. share/doc/qt5/qthelp/qhelpsearchengine-members.html
  4558. share/doc/qt5/qthelp/qhelpsearchengine-obsolete.html
  4559. share/doc/qt5/qthelp/qhelpsearchengine.html
  4560. share/doc/qt5/qthelp/qhelpsearchquery-members.html
  4561. share/doc/qt5/qthelp/qhelpsearchquery-obsolete.html
  4562. share/doc/qt5/qthelp/qhelpsearchquery.html
  4563. share/doc/qt5/qthelp/qhelpsearchquerywidget-members.html
  4564. share/doc/qt5/qthelp/qhelpsearchquerywidget-obsolete.html
  4565. share/doc/qt5/qthelp/qhelpsearchquerywidget.html
  4566. share/doc/qt5/qthelp/qhelpsearchresult-members.html
  4567. share/doc/qt5/qthelp/qhelpsearchresult.html
  4568. share/doc/qt5/qthelp/qhelpsearchresultwidget-members.html
  4569. share/doc/qt5/qthelp/qhelpsearchresultwidget.html
  4570. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-contextsensitivehelp-pro.html
  4571. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhcp.html
  4572. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhp.html
  4573. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-example.html
  4574. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-helpbrowser-cpp.html
  4575. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-helpbrowser-h.html
  4576. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-main-cpp.html
  4577. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-cpp.html
  4578. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-h.html
  4579. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-ui.html
  4580. share/doc/qt5/qthelp/qthelp-framework.html
  4581. share/doc/qt5/qthelp/qthelp-index.html
  4582. share/doc/qt5/qthelp/qthelp-module.html
  4583. share/doc/qt5/qthelp/qthelp.index
  4584. share/doc/qt5/qthelp/qthelp.qhp
  4585. share/doc/qt5/qthelp/qthelp.qhp.sha1
  4586. share/doc/qt5/qthelp/qthelpproject.html
  4587. share/doc/qt5/qthelp/style/offline-simple.css
  4588. share/doc/qt5/qthelp/style/offline.css
  4589. share/doc/qt5/qtimageformats.qch
  4590. share/doc/qt5/qtimageformats/images/arrow_bc.png
  4591. share/doc/qt5/qtimageformats/images/bgrContent.png
  4592. share/doc/qt5/qtimageformats/images/btn_next.png
  4593. share/doc/qt5/qtimageformats/images/btn_prev.png
  4594. share/doc/qt5/qtimageformats/images/bullet_dn.png
  4595. share/doc/qt5/qtimageformats/images/bullet_sq.png
  4596. share/doc/qt5/qtimageformats/images/home.png
  4597. share/doc/qt5/qtimageformats/images/ico_note.png
  4598. share/doc/qt5/qtimageformats/images/ico_note_attention.png
  4599. share/doc/qt5/qtimageformats/images/ico_out.png
  4600. share/doc/qt5/qtimageformats/images/logo.png
  4601. share/doc/qt5/qtimageformats/qtimageformats-attribution-jasper.html
  4602. share/doc/qt5/qtimageformats/qtimageformats-attribution-libmng.html
  4603. share/doc/qt5/qtimageformats/qtimageformats-attribution-libtiff.html
  4604. share/doc/qt5/qtimageformats/qtimageformats-attribution-libwebp.html
  4605. share/doc/qt5/qtimageformats/qtimageformats-index.html
  4606. share/doc/qt5/qtimageformats/qtimageformats.index
  4607. share/doc/qt5/qtimageformats/qtimageformats.qhp
  4608. share/doc/qt5/qtimageformats/qtimageformats.qhp.sha1
  4609. share/doc/qt5/qtimageformats/style/offline-simple.css
  4610. share/doc/qt5/qtimageformats/style/offline.css
  4611. share/doc/qt5/qtlabscalendar.qch
  4612. share/doc/qt5/qtlabscalendar/images/arrow_bc.png
  4613. share/doc/qt5/qtlabscalendar/images/bgrContent.png
  4614. share/doc/qt5/qtlabscalendar/images/btn_next.png
  4615. share/doc/qt5/qtlabscalendar/images/btn_prev.png
  4616. share/doc/qt5/qtlabscalendar/images/bullet_dn.png
  4617. share/doc/qt5/qtlabscalendar/images/bullet_sq.png
  4618. share/doc/qt5/qtlabscalendar/images/home.png
  4619. share/doc/qt5/qtlabscalendar/images/ico_note.png
  4620. share/doc/qt5/qtlabscalendar/images/ico_note_attention.png
  4621. share/doc/qt5/qtlabscalendar/images/ico_out.png
  4622. share/doc/qt5/qtlabscalendar/images/logo.png
  4623. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-dayofweekrow-layout.png
  4624. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-dayofweekrow.png
  4625. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-monthgrid-layout.png
  4626. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-monthgrid.png
  4627. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn-layout.png
  4628. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn.png
  4629. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendar-members.html
  4630. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendar.html
  4631. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendarmodel-members.html
  4632. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendarmodel.html
  4633. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow-members.html
  4634. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow.html
  4635. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-monthgrid-members.html
  4636. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-monthgrid.html
  4637. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn-members.html
  4638. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn.html
  4639. share/doc/qt5/qtlabscalendar/qt-labs-calendar-qmlmodule.html
  4640. share/doc/qt5/qtlabscalendar/qtlabscalendar-index.html
  4641. share/doc/qt5/qtlabscalendar/qtlabscalendar.index
  4642. share/doc/qt5/qtlabscalendar/qtlabscalendar.qhp
  4643. share/doc/qt5/qtlabscalendar/qtlabscalendar.qhp.sha1
  4644. share/doc/qt5/qtlabscalendar/qtlabscalendar.tags
  4645. share/doc/qt5/qtlabscalendar/style/offline-simple.css
  4646. share/doc/qt5/qtlabscalendar/style/offline.css
  4647. share/doc/qt5/qtlabsplatform.qch
  4648. share/doc/qt5/qtlabsplatform/images/arrow_bc.png
  4649. share/doc/qt5/qtlabsplatform/images/bgrContent.png
  4650. share/doc/qt5/qtlabsplatform/images/btn_next.png
  4651. share/doc/qt5/qtlabsplatform/images/btn_prev.png
  4652. share/doc/qt5/qtlabsplatform/images/bullet_dn.png
  4653. share/doc/qt5/qtlabsplatform/images/bullet_sq.png
  4654. share/doc/qt5/qtlabsplatform/images/home.png
  4655. share/doc/qt5/qtlabsplatform/images/ico_note.png
  4656. share/doc/qt5/qtlabsplatform/images/ico_note_attention.png
  4657. share/doc/qt5/qtlabsplatform/images/ico_out.png
  4658. share/doc/qt5/qtlabsplatform/images/logo.png
  4659. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-colordialog-gtk.png
  4660. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-filedialog-gtk.png
  4661. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-folderdialog-gtk.png
  4662. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-fontdialog-gtk.png
  4663. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-menu.png
  4664. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-menubar.png
  4665. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-messagedialog-android.png
  4666. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-messagedialog-informative-android.png
  4667. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon-menu.png
  4668. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon-message.png
  4669. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon.png
  4670. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-colordialog-members.html
  4671. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-colordialog.html
  4672. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-dialog-members.html
  4673. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-dialog.html
  4674. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-filedialog-members.html
  4675. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-filedialog.html
  4676. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-folderdialog-members.html
  4677. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-folderdialog.html
  4678. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-fontdialog-members.html
  4679. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-fontdialog.html
  4680. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu-members.html
  4681. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu.html
  4682. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menubar-members.html
  4683. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menubar.html
  4684. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem-members.html
  4685. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem.html
  4686. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitemgroup-members.html
  4687. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitemgroup.html
  4688. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuseparator-members.html
  4689. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuseparator.html
  4690. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-messagedialog-members.html
  4691. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-messagedialog.html
  4692. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-standardpaths-members.html
  4693. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-standardpaths.html
  4694. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-members.html
  4695. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon.html
  4696. share/doc/qt5/qtlabsplatform/qt-labs-platform-qmlmodule.html
  4697. share/doc/qt5/qtlabsplatform/qtlabsplatform-index.html
  4698. share/doc/qt5/qtlabsplatform/qtlabsplatform.index
  4699. share/doc/qt5/qtlabsplatform/qtlabsplatform.qhp
  4700. share/doc/qt5/qtlabsplatform/qtlabsplatform.qhp.sha1
  4701. share/doc/qt5/qtlabsplatform/qtlabsplatform.tags
  4702. share/doc/qt5/qtlabsplatform/style/offline-simple.css
  4703. share/doc/qt5/qtlabsplatform/style/offline.css
  4704. share/doc/qt5/qtlinguist.qch
  4705. share/doc/qt5/qtlinguist/examples-linguist.html
  4706. share/doc/qt5/qtlinguist/examples-manifest.xml
  4707. share/doc/qt5/qtlinguist/images/arrow_bc.png
  4708. share/doc/qt5/qtlinguist/images/bgrContent.png
  4709. share/doc/qt5/qtlinguist/images/btn_next.png
  4710. share/doc/qt5/qtlinguist/images/btn_prev.png
  4711. share/doc/qt5/qtlinguist/images/bullet_dn.png
  4712. share/doc/qt5/qtlinguist/images/bullet_sq.png
  4713. share/doc/qt5/qtlinguist/images/home.png
  4714. share/doc/qt5/qtlinguist/images/ico_note.png
  4715. share/doc/qt5/qtlinguist/images/ico_note_attention.png
  4716. share/doc/qt5/qtlinguist/images/ico_out.png
  4717. share/doc/qt5/qtlinguist/images/linguist-arrowpad_en.png
  4718. share/doc/qt5/qtlinguist/images/linguist-arrowpad_fr.png
  4719. share/doc/qt5/qtlinguist/images/linguist-arrowpad_nl.png
  4720. share/doc/qt5/qtlinguist/images/linguist-batchtranslation.png
  4721. share/doc/qt5/qtlinguist/images/linguist-check-empty.png
  4722. share/doc/qt5/qtlinguist/images/linguist-check-obsolete.png
  4723. share/doc/qt5/qtlinguist/images/linguist-check-off.png
  4724. share/doc/qt5/qtlinguist/images/linguist-check-on.png
  4725. share/doc/qt5/qtlinguist/images/linguist-check-warning.png
  4726. share/doc/qt5/qtlinguist/images/linguist-danger.png
  4727. share/doc/qt5/qtlinguist/images/linguist-doneandnext.png
  4728. share/doc/qt5/qtlinguist/images/linguist-hellotr_en.png
  4729. share/doc/qt5/qtlinguist/images/linguist-hellotr_la.png
  4730. share/doc/qt5/qtlinguist/images/linguist-linguist.png
  4731. share/doc/qt5/qtlinguist/images/linguist-linguist_2.png
  4732. share/doc/qt5/qtlinguist/images/linguist-phrasebookdialog.png
  4733. share/doc/qt5/qtlinguist/images/linguist-translationfilesettings.png
  4734. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_en.png
  4735. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_pt_bad.png
  4736. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_pt_good.png
  4737. share/doc/qt5/qtlinguist/images/linguist-trollprint_11_en.png
  4738. share/doc/qt5/qtlinguist/images/linguist-trollprint_11_pt.png
  4739. share/doc/qt5/qtlinguist/images/logo.png
  4740. share/doc/qt5/qtlinguist/linguist-id-based-i18n.html
  4741. share/doc/qt5/qtlinguist/linguist-manager.html
  4742. share/doc/qt5/qtlinguist/linguist-overview.html
  4743. share/doc/qt5/qtlinguist/linguist-programmers.html
  4744. share/doc/qt5/qtlinguist/linguist-translators.html
  4745. share/doc/qt5/qtlinguist/linguist-ts-file-format.html
  4746. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-cpp.html
  4747. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-h.html
  4748. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-pro.html
  4749. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-example.html
  4750. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-main-cpp.html
  4751. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-mainwindow-cpp.html
  4752. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-mainwindow-h.html
  4753. share/doc/qt5/qtlinguist/qtlinguist-hellotr-example.html
  4754. share/doc/qt5/qtlinguist/qtlinguist-hellotr-hellotr-pro.html
  4755. share/doc/qt5/qtlinguist/qtlinguist-hellotr-main-cpp.html
  4756. share/doc/qt5/qtlinguist/qtlinguist-index.html
  4757. share/doc/qt5/qtlinguist/qtlinguist-trollprint-example.html
  4758. share/doc/qt5/qtlinguist/qtlinguist-trollprint-main-cpp.html
  4759. share/doc/qt5/qtlinguist/qtlinguist-trollprint-mainwindow-cpp.html
  4760. share/doc/qt5/qtlinguist/qtlinguist-trollprint-mainwindow-h.html
  4761. share/doc/qt5/qtlinguist/qtlinguist-trollprint-printpanel-cpp.html
  4762. share/doc/qt5/qtlinguist/qtlinguist-trollprint-printpanel-h.html
  4763. share/doc/qt5/qtlinguist/qtlinguist-trollprint-trollprint-pro.html
  4764. share/doc/qt5/qtlinguist/qtlinguist.index
  4765. share/doc/qt5/qtlinguist/qtlinguist.qhp
  4766. share/doc/qt5/qtlinguist/qtlinguist.qhp.sha1
  4767. share/doc/qt5/qtlinguist/style/offline-simple.css
  4768. share/doc/qt5/qtlinguist/style/offline.css
  4769. share/doc/qt5/qtlocation.qch
  4770. share/doc/qt5/qtlocation/examples-manifest.xml
  4771. share/doc/qt5/qtlocation/images/api-mapcircle.png
  4772. share/doc/qt5/qtlocation/images/api-mapitemgroup.png
  4773. share/doc/qt5/qtlocation/images/api-mappolygon.png
  4774. share/doc/qt5/qtlocation/images/api-mappolyline.png
  4775. share/doc/qt5/qtlocation/images/api-mapquickitem-anchor.png
  4776. share/doc/qt5/qtlocation/images/api-mapquickitem.png
  4777. share/doc/qt5/qtlocation/images/api-maprectangle.png
  4778. share/doc/qt5/qtlocation/images/arrow_bc.png
  4779. share/doc/qt5/qtlocation/images/bgrContent.png
  4780. share/doc/qt5/qtlocation/images/btn_next.png
  4781. share/doc/qt5/qtlocation/images/btn_prev.png
  4782. share/doc/qt5/qtlocation/images/bullet_dn.png
  4783. share/doc/qt5/qtlocation/images/bullet_sq.png
  4784. share/doc/qt5/qtlocation/images/home.png
  4785. share/doc/qt5/qtlocation/images/ico_note.png
  4786. share/doc/qt5/qtlocation/images/ico_note_attention.png
  4787. share/doc/qt5/qtlocation/images/ico_out.png
  4788. share/doc/qt5/qtlocation/images/logo.png
  4789. share/doc/qt5/qtlocation/images/mapviewer.png
  4790. share/doc/qt5/qtlocation/images/minimal_map.png
  4791. share/doc/qt5/qtlocation/images/places.png
  4792. share/doc/qt5/qtlocation/images/places_list.png
  4793. share/doc/qt5/qtlocation/images/places_map.png
  4794. share/doc/qt5/qtlocation/images/planespotter.png
  4795. share/doc/qt5/qtlocation/location-cpp-qml.html
  4796. share/doc/qt5/qtlocation/location-maps-cpp.html
  4797. share/doc/qt5/qtlocation/location-maps-qml.html
  4798. share/doc/qt5/qtlocation/location-places-backend.html
  4799. share/doc/qt5/qtlocation/location-places-cpp.html
  4800. share/doc/qt5/qtlocation/location-places-qml.html
  4801. share/doc/qt5/qtlocation/location-plugin-esri.html
  4802. share/doc/qt5/qtlocation/location-plugin-here.html
  4803. share/doc/qt5/qtlocation/location-plugin-itemsoverlay.html
  4804. share/doc/qt5/qtlocation/location-plugin-mapbox.html
  4805. share/doc/qt5/qtlocation/location-plugin-mapboxgl.html
  4806. share/doc/qt5/qtlocation/location-plugin-osm.html
  4807. share/doc/qt5/qtlocation/qgeocodereply-members.html
  4808. share/doc/qt5/qtlocation/qgeocodereply.html
  4809. share/doc/qt5/qtlocation/qgeocodingmanager-members.html
  4810. share/doc/qt5/qtlocation/qgeocodingmanager.html
  4811. share/doc/qt5/qtlocation/qgeocodingmanagerengine-members.html
  4812. share/doc/qt5/qtlocation/qgeocodingmanagerengine.html
  4813. share/doc/qt5/qtlocation/qgeomaneuver-members.html
  4814. share/doc/qt5/qtlocation/qgeomaneuver.html
  4815. share/doc/qt5/qtlocation/qgeoroute-members.html
  4816. share/doc/qt5/qtlocation/qgeoroute.html
  4817. share/doc/qt5/qtlocation/qgeoroutereply-members.html
  4818. share/doc/qt5/qtlocation/qgeoroutereply.html
  4819. share/doc/qt5/qtlocation/qgeorouterequest-members.html
  4820. share/doc/qt5/qtlocation/qgeorouterequest.html
  4821. share/doc/qt5/qtlocation/qgeoroutesegment-members.html
  4822. share/doc/qt5/qtlocation/qgeoroutesegment.html
  4823. share/doc/qt5/qtlocation/qgeoroutingmanager-members.html
  4824. share/doc/qt5/qtlocation/qgeoroutingmanager.html
  4825. share/doc/qt5/qtlocation/qgeoroutingmanagerengine-members.html
  4826. share/doc/qt5/qtlocation/qgeoroutingmanagerengine.html
  4827. share/doc/qt5/qtlocation/qgeoserviceprovider-members.html
  4828. share/doc/qt5/qtlocation/qgeoserviceprovider.html
  4829. share/doc/qt5/qtlocation/qgeoserviceproviderfactory-members.html
  4830. share/doc/qt5/qtlocation/qgeoserviceproviderfactory.html
  4831. share/doc/qt5/qtlocation/qlocation.html
  4832. share/doc/qt5/qtlocation/qml-location5-maps.html
  4833. share/doc/qt5/qtlocation/qml-qtlocation-category-members.html
  4834. share/doc/qt5/qtlocation/qml-qtlocation-category.html
  4835. share/doc/qt5/qtlocation/qml-qtlocation-categorymodel-members.html
  4836. share/doc/qt5/qtlocation/qml-qtlocation-categorymodel.html
  4837. share/doc/qt5/qtlocation/qml-qtlocation-contactdetail-members.html
  4838. share/doc/qt5/qtlocation/qml-qtlocation-contactdetail.html
  4839. share/doc/qt5/qtlocation/qml-qtlocation-contactdetails-members.html
  4840. share/doc/qt5/qtlocation/qml-qtlocation-contactdetails.html
  4841. share/doc/qt5/qtlocation/qml-qtlocation-editorialmodel-members.html
  4842. share/doc/qt5/qtlocation/qml-qtlocation-editorialmodel.html
  4843. share/doc/qt5/qtlocation/qml-qtlocation-extendedattributes-members.html
  4844. share/doc/qt5/qtlocation/qml-qtlocation-extendedattributes.html
  4845. share/doc/qt5/qtlocation/qml-qtlocation-geocodemodel-members.html
  4846. share/doc/qt5/qtlocation/qml-qtlocation-geocodemodel.html
  4847. share/doc/qt5/qtlocation/qml-qtlocation-icon-members.html
  4848. share/doc/qt5/qtlocation/qml-qtlocation-icon.html
  4849. share/doc/qt5/qtlocation/qml-qtlocation-imagemodel-members.html
  4850. share/doc/qt5/qtlocation/qml-qtlocation-imagemodel.html
  4851. share/doc/qt5/qtlocation/qml-qtlocation-map-members.html
  4852. share/doc/qt5/qtlocation/qml-qtlocation-map.html
  4853. share/doc/qt5/qtlocation/qml-qtlocation-mapcircle-members.html
  4854. share/doc/qt5/qtlocation/qml-qtlocation-mapcircle.html
  4855. share/doc/qt5/qtlocation/qml-qtlocation-mapcopyrightnotice-members.html
  4856. share/doc/qt5/qtlocation/qml-qtlocation-mapcopyrightnotice.html
  4857. share/doc/qt5/qtlocation/qml-qtlocation-mapgesturearea-members.html
  4858. share/doc/qt5/qtlocation/qml-qtlocation-mapgesturearea.html
  4859. share/doc/qt5/qtlocation/qml-qtlocation-mapitemgroup-members.html
  4860. share/doc/qt5/qtlocation/qml-qtlocation-mapitemgroup.html
  4861. share/doc/qt5/qtlocation/qml-qtlocation-mapitemview-members.html
  4862. share/doc/qt5/qtlocation/qml-qtlocation-mapitemview.html
  4863. share/doc/qt5/qtlocation/qml-qtlocation-mapparameter-members.html
  4864. share/doc/qt5/qtlocation/qml-qtlocation-mapparameter.html
  4865. share/doc/qt5/qtlocation/qml-qtlocation-mappinchevent-members.html
  4866. share/doc/qt5/qtlocation/qml-qtlocation-mappinchevent.html
  4867. share/doc/qt5/qtlocation/qml-qtlocation-mappolygon-members.html
  4868. share/doc/qt5/qtlocation/qml-qtlocation-mappolygon.html
  4869. share/doc/qt5/qtlocation/qml-qtlocation-mappolyline-members.html
  4870. share/doc/qt5/qtlocation/qml-qtlocation-mappolyline.html
  4871. share/doc/qt5/qtlocation/qml-qtlocation-mapquickitem-members.html
  4872. share/doc/qt5/qtlocation/qml-qtlocation-mapquickitem.html
  4873. share/doc/qt5/qtlocation/qml-qtlocation-maprectangle-members.html
  4874. share/doc/qt5/qtlocation/qml-qtlocation-maprectangle.html
  4875. share/doc/qt5/qtlocation/qml-qtlocation-maproute-members.html
  4876. share/doc/qt5/qtlocation/qml-qtlocation-maproute.html
  4877. share/doc/qt5/qtlocation/qml-qtlocation-maptype-members.html
  4878. share/doc/qt5/qtlocation/qml-qtlocation-maptype.html
  4879. share/doc/qt5/qtlocation/qml-qtlocation-place-members.html
  4880. share/doc/qt5/qtlocation/qml-qtlocation-place.html
  4881. share/doc/qt5/qtlocation/qml-qtlocation-placeattribute-members.html
  4882. share/doc/qt5/qtlocation/qml-qtlocation-placeattribute.html
  4883. share/doc/qt5/qtlocation/qml-qtlocation-placesearchmodel-members.html
  4884. share/doc/qt5/qtlocation/qml-qtlocation-placesearchmodel.html
  4885. share/doc/qt5/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
  4886. share/doc/qt5/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
  4887. share/doc/qt5/qtlocation/qml-qtlocation-plugin-members.html
  4888. share/doc/qt5/qtlocation/qml-qtlocation-plugin.html
  4889. share/doc/qt5/qtlocation/qml-qtlocation-pluginparameter-members.html
  4890. share/doc/qt5/qtlocation/qml-qtlocation-pluginparameter.html
  4891. share/doc/qt5/qtlocation/qml-qtlocation-ratings-members.html
  4892. share/doc/qt5/qtlocation/qml-qtlocation-ratings.html
  4893. share/doc/qt5/qtlocation/qml-qtlocation-reviewmodel-members.html
  4894. share/doc/qt5/qtlocation/qml-qtlocation-reviewmodel.html
  4895. share/doc/qt5/qtlocation/qml-qtlocation-route-members.html
  4896. share/doc/qt5/qtlocation/qml-qtlocation-route.html
  4897. share/doc/qt5/qtlocation/qml-qtlocation-routemaneuver-members.html
  4898. share/doc/qt5/qtlocation/qml-qtlocation-routemaneuver.html
  4899. share/doc/qt5/qtlocation/qml-qtlocation-routemodel-members.html
  4900. share/doc/qt5/qtlocation/qml-qtlocation-routemodel.html
  4901. share/doc/qt5/qtlocation/qml-qtlocation-routequery-members.html
  4902. share/doc/qt5/qtlocation/qml-qtlocation-routequery.html
  4903. share/doc/qt5/qtlocation/qml-qtlocation-routesegment-members.html
  4904. share/doc/qt5/qtlocation/qml-qtlocation-routesegment.html
  4905. share/doc/qt5/qtlocation/qml-qtlocation-supplier-members.html
  4906. share/doc/qt5/qtlocation/qml-qtlocation-supplier.html
  4907. share/doc/qt5/qtlocation/qml-qtlocation-user-members.html
  4908. share/doc/qt5/qtlocation/qml-qtlocation-user.html
  4909. share/doc/qt5/qtlocation/qml-qtlocation5-maps.html
  4910. share/doc/qt5/qtlocation/qplace-members.html
  4911. share/doc/qt5/qtlocation/qplace.html
  4912. share/doc/qt5/qtlocation/qplaceattribute-members.html
  4913. share/doc/qt5/qtlocation/qplaceattribute.html
  4914. share/doc/qt5/qtlocation/qplacecategory-members.html
  4915. share/doc/qt5/qtlocation/qplacecategory.html
  4916. share/doc/qt5/qtlocation/qplacecontactdetail-members.html
  4917. share/doc/qt5/qtlocation/qplacecontactdetail.html
  4918. share/doc/qt5/qtlocation/qplacecontent-members.html
  4919. share/doc/qt5/qtlocation/qplacecontent.html
  4920. share/doc/qt5/qtlocation/qplacecontentreply-members.html
  4921. share/doc/qt5/qtlocation/qplacecontentreply.html
  4922. share/doc/qt5/qtlocation/qplacecontentrequest-members.html
  4923. share/doc/qt5/qtlocation/qplacecontentrequest.html
  4924. share/doc/qt5/qtlocation/qplacedetailsreply-members.html
  4925. share/doc/qt5/qtlocation/qplacedetailsreply.html
  4926. share/doc/qt5/qtlocation/qplaceeditorial-members.html
  4927. share/doc/qt5/qtlocation/qplaceeditorial.html
  4928. share/doc/qt5/qtlocation/qplaceicon-members.html
  4929. share/doc/qt5/qtlocation/qplaceicon.html
  4930. share/doc/qt5/qtlocation/qplaceidreply-members.html
  4931. share/doc/qt5/qtlocation/qplaceidreply.html
  4932. share/doc/qt5/qtlocation/qplaceimage-members.html
  4933. share/doc/qt5/qtlocation/qplaceimage.html
  4934. share/doc/qt5/qtlocation/qplacemanager-members.html
  4935. share/doc/qt5/qtlocation/qplacemanager.html
  4936. share/doc/qt5/qtlocation/qplacemanagerengine-members.html
  4937. share/doc/qt5/qtlocation/qplacemanagerengine.html
  4938. share/doc/qt5/qtlocation/qplacematchreply-members.html
  4939. share/doc/qt5/qtlocation/qplacematchreply.html
  4940. share/doc/qt5/qtlocation/qplacematchrequest-members.html
  4941. share/doc/qt5/qtlocation/qplacematchrequest.html
  4942. share/doc/qt5/qtlocation/qplaceproposedsearchresult-members.html
  4943. share/doc/qt5/qtlocation/qplaceproposedsearchresult.html
  4944. share/doc/qt5/qtlocation/qplaceratings-members.html
  4945. share/doc/qt5/qtlocation/qplaceratings.html
  4946. share/doc/qt5/qtlocation/qplacereply-members.html
  4947. share/doc/qt5/qtlocation/qplacereply.html
  4948. share/doc/qt5/qtlocation/qplaceresult-members.html
  4949. share/doc/qt5/qtlocation/qplaceresult.html
  4950. share/doc/qt5/qtlocation/qplacereview-members.html
  4951. share/doc/qt5/qtlocation/qplacereview.html
  4952. share/doc/qt5/qtlocation/qplacesearchreply-members.html
  4953. share/doc/qt5/qtlocation/qplacesearchreply.html
  4954. share/doc/qt5/qtlocation/qplacesearchrequest-members.html
  4955. share/doc/qt5/qtlocation/qplacesearchrequest.html
  4956. share/doc/qt5/qtlocation/qplacesearchresult-members.html
  4957. share/doc/qt5/qtlocation/qplacesearchresult.html
  4958. share/doc/qt5/qtlocation/qplacesearchsuggestionreply-members.html
  4959. share/doc/qt5/qtlocation/qplacesearchsuggestionreply.html
  4960. share/doc/qt5/qtlocation/qplacesupplier-members.html
  4961. share/doc/qt5/qtlocation/qplacesupplier.html
  4962. share/doc/qt5/qtlocation/qplaceuser-members.html
  4963. share/doc/qt5/qtlocation/qplaceuser.html
  4964. share/doc/qt5/qtlocation/qtlocation-attribution-clip2tri.html
  4965. share/doc/qt5/qtlocation/qtlocation-attribution-clipper.html
  4966. share/doc/qt5/qtlocation/qtlocation-attribution-earcut.html
  4967. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-boost.html
  4968. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-css-color-parser.html
  4969. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-earcut.html
  4970. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geojson.html
  4971. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geojsonvt.html
  4972. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geometry.html
  4973. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-kdbush.html
  4974. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-libcxx.html
  4975. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-parsedate.html
  4976. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-polylabel.html
  4977. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-protozero.html
  4978. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-rapidjson.html
  4979. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-shelfpack.html
  4980. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-supercluster.html
  4981. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-unique-resource.html
  4982. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-variant.html
  4983. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-vectortile.html
  4984. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-wagyu.html
  4985. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl.html
  4986. share/doc/qt5/qtlocation/qtlocation-attribution-poly2tri.html
  4987. share/doc/qt5/qtlocation/qtlocation-changes.html
  4988. share/doc/qt5/qtlocation/qtlocation-cpp.html
  4989. share/doc/qt5/qtlocation/qtlocation-examples.html
  4990. share/doc/qt5/qtlocation/qtlocation-geoservices.html
  4991. share/doc/qt5/qtlocation/qtlocation-index.html
  4992. share/doc/qt5/qtlocation/qtlocation-mapviewer-example.html
  4993. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-geocode-qml.html
  4994. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-geocodeform-ui-qml.html
  4995. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-locale-qml.html
  4996. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-localeform-ui-qml.html
  4997. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-message-qml.html
  4998. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-messageform-ui-qml.html
  4999. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-reversegeocode-qml.html
  5000. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-reversegeocodeform-ui-qml.html
  5001. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routeaddress-qml.html
  5002. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routeaddressform-ui-qml.html
  5003. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routecoordinate-qml.html
  5004. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routecoordinateform-ui-qml.html
  5005. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelist-qml.html
  5006. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelistdelegate-qml.html
  5007. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelistheader-qml.html
  5008. share/doc/qt5/qtlocation/qtlocation-mapviewer-helper-js.html
  5009. share/doc/qt5/qtlocation/qtlocation-mapviewer-main-cpp.html
  5010. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-circleitem-qml.html
  5011. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-imageitem-qml.html
  5012. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-mapcomponent-qml.html
  5013. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-mapsliders-qml.html
  5014. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-marker-qml.html
  5015. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-minimap-qml.html
  5016. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-polygonitem-qml.html
  5017. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-polylineitem-qml.html
  5018. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-rectangleitem-qml.html
  5019. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-pro.html
  5020. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-qml.html
  5021. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-qrc.html
  5022. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-itempopupmenu-qml.html
  5023. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-mainmenu-qml.html
  5024. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-mappopupmenu-qml.html
  5025. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-markerpopupmenu-qml.html
  5026. share/doc/qt5/qtlocation/qtlocation-minimal-map-example.html
  5027. share/doc/qt5/qtlocation/qtlocation-minimal-map-main-cpp.html
  5028. share/doc/qt5/qtlocation/qtlocation-minimal-map-main-qml.html
  5029. share/doc/qt5/qtlocation/qtlocation-minimal-map-minimal-map-pro.html
  5030. share/doc/qt5/qtlocation/qtlocation-minimal-map-qml-qrc.html
  5031. share/doc/qt5/qtlocation/qtlocation-module.html
  5032. share/doc/qt5/qtlocation/qtlocation-places-example.html
  5033. share/doc/qt5/qtlocation/qtlocation-places-forms-message-qml.html
  5034. share/doc/qt5/qtlocation/qtlocation-places-forms-messageform-ui-qml.html
  5035. share/doc/qt5/qtlocation/qtlocation-places-forms-placedetails-qml.html
  5036. share/doc/qt5/qtlocation/qtlocation-places-forms-placedetailsform-ui-qml.html
  5037. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingbox-qml.html
  5038. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingboxform-ui-qml.html
  5039. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingcircle-qml.html
  5040. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingcircleform-ui-qml.html
  5041. share/doc/qt5/qtlocation/qtlocation-places-forms-searchcenter-qml.html
  5042. share/doc/qt5/qtlocation/qtlocation-places-forms-searchcenterform-ui-qml.html
  5043. share/doc/qt5/qtlocation/qtlocation-places-forms-searchoptions-qml.html
  5044. share/doc/qt5/qtlocation/qtlocation-places-forms-searchoptionsform-ui-qml.html
  5045. share/doc/qt5/qtlocation/qtlocation-places-helper-js.html
  5046. share/doc/qt5/qtlocation/qtlocation-places-items-mainmenu-qml.html
  5047. share/doc/qt5/qtlocation/qtlocation-places-items-mapcomponent-qml.html
  5048. share/doc/qt5/qtlocation/qtlocation-places-items-searchbar-qml.html
  5049. share/doc/qt5/qtlocation/qtlocation-places-list-example.html
  5050. share/doc/qt5/qtlocation/qtlocation-places-list-main-cpp.html
  5051. share/doc/qt5/qtlocation/qtlocation-places-list-marker-qml.html
  5052. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-pro.html
  5053. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-qml.html
  5054. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-qrc.html
  5055. share/doc/qt5/qtlocation/qtlocation-places-main-cpp.html
  5056. share/doc/qt5/qtlocation/qtlocation-places-map-example.html
  5057. share/doc/qt5/qtlocation/qtlocation-places-map-main-cpp.html
  5058. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-pro.html
  5059. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-qml.html
  5060. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-qrc.html
  5061. share/doc/qt5/qtlocation/qtlocation-places-places-pro.html
  5062. share/doc/qt5/qtlocation/qtlocation-places-places-qml.html
  5063. share/doc/qt5/qtlocation/qtlocation-places-places-qrc.html
  5064. share/doc/qt5/qtlocation/qtlocation-places-views-categorydelegate-qml.html
  5065. share/doc/qt5/qtlocation/qtlocation-places-views-categoryview-qml.html
  5066. share/doc/qt5/qtlocation/qtlocation-places-views-editorialdelegate-qml.html
  5067. share/doc/qt5/qtlocation/qtlocation-places-views-editorialpage-qml.html
  5068. share/doc/qt5/qtlocation/qtlocation-places-views-editorialview-qml.html
  5069. share/doc/qt5/qtlocation/qtlocation-places-views-imageview-qml.html
  5070. share/doc/qt5/qtlocation/qtlocation-places-views-ratingview-qml.html
  5071. share/doc/qt5/qtlocation/qtlocation-places-views-reviewdelegate-qml.html
  5072. share/doc/qt5/qtlocation/qtlocation-places-views-reviewpage-qml.html
  5073. share/doc/qt5/qtlocation/qtlocation-places-views-reviewview-qml.html
  5074. share/doc/qt5/qtlocation/qtlocation-places-views-searchresultdelegate-qml.html
  5075. share/doc/qt5/qtlocation/qtlocation-places-views-searchresultview-qml.html
  5076. share/doc/qt5/qtlocation/qtlocation-places-views-suggestionview-qml.html
  5077. share/doc/qt5/qtlocation/qtlocation-planespotter-example.html
  5078. share/doc/qt5/qtlocation/qtlocation-planespotter-main-cpp.html
  5079. share/doc/qt5/qtlocation/qtlocation-planespotter-plane-qml.html
  5080. share/doc/qt5/qtlocation/qtlocation-planespotter-planespotter-pro.html
  5081. share/doc/qt5/qtlocation/qtlocation-planespotter-planespotter-qml.html
  5082. share/doc/qt5/qtlocation/qtlocation-planespotter-qml-qrc.html
  5083. share/doc/qt5/qtlocation/qtlocation-qmlmodule.html
  5084. share/doc/qt5/qtlocation/qtlocation.index
  5085. share/doc/qt5/qtlocation/qtlocation.qhp
  5086. share/doc/qt5/qtlocation/qtlocation.qhp.sha1
  5087. share/doc/qt5/qtlocation/qtlocation.tags
  5088. share/doc/qt5/qtlocation/style/offline-simple.css
  5089. share/doc/qt5/qtlocation/style/offline.css
  5090. share/doc/qt5/qtmacextras.qch
  5091. share/doc/qt5/qtmacextras/examples-manifest.xml
  5092. share/doc/qt5/qtmacextras/examples-qtmacextras.html
  5093. share/doc/qt5/qtmacextras/images/arrow_bc.png
  5094. share/doc/qt5/qtmacextras/images/bgrContent.png
  5095. share/doc/qt5/qtmacextras/images/btn_next.png
  5096. share/doc/qt5/qtmacextras/images/btn_prev.png
  5097. share/doc/qt5/qtmacextras/images/bullet_dn.png
  5098. share/doc/qt5/qtmacextras/images/bullet_sq.png
  5099. share/doc/qt5/qtmacextras/images/home.png
  5100. share/doc/qt5/qtmacextras/images/ico_note.png
  5101. share/doc/qt5/qtmacextras/images/ico_note_attention.png
  5102. share/doc/qt5/qtmacextras/images/ico_out.png
  5103. share/doc/qt5/qtmacextras/images/logo.png
  5104. share/doc/qt5/qtmacextras/qmacpasteboardmime-members.html
  5105. share/doc/qt5/qtmacextras/qmacpasteboardmime.html
  5106. share/doc/qt5/qtmacextras/qmactoolbar-members.html
  5107. share/doc/qt5/qtmacextras/qmactoolbar.html
  5108. share/doc/qt5/qtmacextras/qmactoolbaritem-members.html
  5109. share/doc/qt5/qtmacextras/qmactoolbaritem.html
  5110. share/doc/qt5/qtmacextras/qtmac-obsolete.html
  5111. share/doc/qt5/qtmacextras/qtmac.html
  5112. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-embeddedqwindow-pro.html
  5113. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-example.html
  5114. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-window-cpp.html
  5115. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-window-h.html
  5116. share/doc/qt5/qtmacextras/qtmacextras-index.html
  5117. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-example.html
  5118. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-macfunctions-pro.html
  5119. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-macfunctions-qrc.html
  5120. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-main-cpp.html
  5121. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-example.html
  5122. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-macpasteboardmime-pro.html
  5123. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-main-cpp.html
  5124. share/doc/qt5/qtmacextras/qtmacextras-module.html
  5125. share/doc/qt5/qtmacextras/qtmacextras.index
  5126. share/doc/qt5/qtmacextras/qtmacextras.qhp
  5127. share/doc/qt5/qtmacextras/qtmacextras.qhp.sha1
  5128. share/doc/qt5/qtmacextras/style/offline-simple.css
  5129. share/doc/qt5/qtmacextras/style/offline.css
  5130. share/doc/qt5/qtmultimedia.qch
  5131. share/doc/qt5/qtmultimedia/audiooverview.html
  5132. share/doc/qt5/qtmultimedia/cameraoverview.html
  5133. share/doc/qt5/qtmultimedia/changes.html
  5134. share/doc/qt5/qtmultimedia/examples-manifest.xml
  5135. share/doc/qt5/qtmultimedia/images/arrow_bc.png
  5136. share/doc/qt5/qtmultimedia/images/audiodevices.png
  5137. share/doc/qt5/qtmultimedia/images/audioinput-example.png
  5138. share/doc/qt5/qtmultimedia/images/audiooutput-example.png
  5139. share/doc/qt5/qtmultimedia/images/audiorecorder.png
  5140. share/doc/qt5/qtmultimedia/images/bgrContent.png
  5141. share/doc/qt5/qtmultimedia/images/btn_next.png
  5142. share/doc/qt5/qtmultimedia/images/btn_prev.png
  5143. share/doc/qt5/qtmultimedia/images/bullet_dn.png
  5144. share/doc/qt5/qtmultimedia/images/bullet_sq.png
  5145. share/doc/qt5/qtmultimedia/images/camera-example.png
  5146. share/doc/qt5/qtmultimedia/images/declarative-radio-example.png
  5147. share/doc/qt5/qtmultimedia/images/home.png
  5148. share/doc/qt5/qtmultimedia/images/ico_note.png
  5149. share/doc/qt5/qtmultimedia/images/ico_note_attention.png
  5150. share/doc/qt5/qtmultimedia/images/ico_out.png
  5151. share/doc/qt5/qtmultimedia/images/logo.png
  5152. share/doc/qt5/qtmultimedia/images/mediaplayerex.jpg
  5153. share/doc/qt5/qtmultimedia/images/qml-camera.png
  5154. share/doc/qt5/qtmultimedia/images/qmlvideo-menu.jpg
  5155. share/doc/qt5/qtmultimedia/images/qmlvideo-overlay.jpg
  5156. share/doc/qt5/qtmultimedia/images/qmlvideofx-camera-glow.jpg
  5157. share/doc/qt5/qtmultimedia/images/qmlvideofx-camera-wobble.jpg
  5158. share/doc/qt5/qtmultimedia/images/qmlvideofx-effects-menu.jpg
  5159. share/doc/qt5/qtmultimedia/images/qmlvideofx-video-edgedetection.jpg
  5160. share/doc/qt5/qtmultimedia/images/qmlvideofx-video-pagecurl.jpg
  5161. share/doc/qt5/qtmultimedia/images/radio-example.png
  5162. share/doc/qt5/qtmultimedia/images/spectrum-demo.png
  5163. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_auto_mode.png
  5164. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_camera_setting.png
  5165. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_auto.png
  5166. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_fill.png
  5167. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_off.png
  5168. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_redeye.png
  5169. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_cloudy.png
  5170. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_flourescent.png
  5171. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_incandescent.png
  5172. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_sunny.png
  5173. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/toolbutton.png
  5174. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/folder.png
  5175. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/leaves.jpg
  5176. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/up.png
  5177. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Dropdown_arrows.png
  5178. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_bar.png
  5179. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_handle.png
  5180. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_Top.png
  5181. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_bottom.png
  5182. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_BackArrow.png
  5183. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Folder.png
  5184. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Menu.png
  5185. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/qt-logo.png
  5186. share/doc/qt5/qtmultimedia/images/video-qml-paint-rate.png
  5187. share/doc/qt5/qtmultimedia/images/video-videographicsitem.png
  5188. share/doc/qt5/qtmultimedia/images/video-videowidget.png
  5189. share/doc/qt5/qtmultimedia/multimedia-examples.html
  5190. share/doc/qt5/qtmultimedia/multimediabackend.html
  5191. share/doc/qt5/qtmultimedia/multimediaoverview.html
  5192. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo-members.html
  5193. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo.html
  5194. share/doc/qt5/qtmultimedia/qabstractaudioinput-members.html
  5195. share/doc/qt5/qtmultimedia/qabstractaudioinput.html
  5196. share/doc/qt5/qtmultimedia/qabstractaudiooutput-members.html
  5197. share/doc/qt5/qtmultimedia/qabstractaudiooutput.html
  5198. share/doc/qt5/qtmultimedia/qabstractplanarvideobuffer-members.html
  5199. share/doc/qt5/qtmultimedia/qabstractplanarvideobuffer.html
  5200. share/doc/qt5/qtmultimedia/qabstractvideobuffer-members.html
  5201. share/doc/qt5/qtmultimedia/qabstractvideobuffer.html
  5202. share/doc/qt5/qtmultimedia/qabstractvideofilter-members.html
  5203. share/doc/qt5/qtmultimedia/qabstractvideofilter.html
  5204. share/doc/qt5/qtmultimedia/qabstractvideosurface-members.html
  5205. share/doc/qt5/qtmultimedia/qabstractvideosurface.html
  5206. share/doc/qt5/qtmultimedia/qaudio.html
  5207. share/doc/qt5/qtmultimedia/qaudiobuffer-members.html
  5208. share/doc/qt5/qtmultimedia/qaudiobuffer-stereoframe-members.html
  5209. share/doc/qt5/qtmultimedia/qaudiobuffer-stereoframe.html
  5210. share/doc/qt5/qtmultimedia/qaudiobuffer.html
  5211. share/doc/qt5/qtmultimedia/qaudiodecoder-members.html
  5212. share/doc/qt5/qtmultimedia/qaudiodecoder.html
  5213. share/doc/qt5/qtmultimedia/qaudiodecodercontrol-members.html
  5214. share/doc/qt5/qtmultimedia/qaudiodecodercontrol.html
  5215. share/doc/qt5/qtmultimedia/qaudiodeviceinfo-members.html
  5216. share/doc/qt5/qtmultimedia/qaudiodeviceinfo.html
  5217. share/doc/qt5/qtmultimedia/qaudioencodersettings-members.html
  5218. share/doc/qt5/qtmultimedia/qaudioencodersettings.html
  5219. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol-members.html
  5220. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol.html
  5221. share/doc/qt5/qtmultimedia/qaudioformat-members.html
  5222. share/doc/qt5/qtmultimedia/qaudioformat.html
  5223. share/doc/qt5/qtmultimedia/qaudioinput-members.html
  5224. share/doc/qt5/qtmultimedia/qaudioinput.html
  5225. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol-members.html
  5226. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol.html
  5227. share/doc/qt5/qtmultimedia/qaudiooutput-members.html
  5228. share/doc/qt5/qtmultimedia/qaudiooutput.html
  5229. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol-members.html
  5230. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol.html
  5231. share/doc/qt5/qtmultimedia/qaudioprobe-members.html
  5232. share/doc/qt5/qtmultimedia/qaudioprobe.html
  5233. share/doc/qt5/qtmultimedia/qaudiorecorder-members.html
  5234. share/doc/qt5/qtmultimedia/qaudiorecorder.html
  5235. share/doc/qt5/qtmultimedia/qaudiorolecontrol-members.html
  5236. share/doc/qt5/qtmultimedia/qaudiorolecontrol.html
  5237. share/doc/qt5/qtmultimedia/qaudiosystemplugin-members.html
  5238. share/doc/qt5/qtmultimedia/qaudiosystemplugin.html
  5239. share/doc/qt5/qtmultimedia/qcamera-frameraterange-members.html
  5240. share/doc/qt5/qtmultimedia/qcamera-frameraterange.html
  5241. share/doc/qt5/qtmultimedia/qcamera-members.html
  5242. share/doc/qt5/qtmultimedia/qcamera-obsolete.html
  5243. share/doc/qt5/qtmultimedia/qcamera.html
  5244. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol-members.html
  5245. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol.html
  5246. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol-members.html
  5247. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol.html
  5248. share/doc/qt5/qtmultimedia/qcameracontrol-members.html
  5249. share/doc/qt5/qtmultimedia/qcameracontrol.html
  5250. share/doc/qt5/qtmultimedia/qcameraexposure-members.html
  5251. share/doc/qt5/qtmultimedia/qcameraexposure.html
  5252. share/doc/qt5/qtmultimedia/qcameraexposurecontrol-members.html
  5253. share/doc/qt5/qtmultimedia/qcameraexposurecontrol.html
  5254. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol-members.html
  5255. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol.html
  5256. share/doc/qt5/qtmultimedia/qcameraflashcontrol-members.html
  5257. share/doc/qt5/qtmultimedia/qcameraflashcontrol.html
  5258. share/doc/qt5/qtmultimedia/qcamerafocus-members.html
  5259. share/doc/qt5/qtmultimedia/qcamerafocus.html
  5260. share/doc/qt5/qtmultimedia/qcamerafocuscontrol-members.html
  5261. share/doc/qt5/qtmultimedia/qcamerafocuscontrol.html
  5262. share/doc/qt5/qtmultimedia/qcamerafocuszone-members.html
  5263. share/doc/qt5/qtmultimedia/qcamerafocuszone.html
  5264. share/doc/qt5/qtmultimedia/qcameraimagecapture-members.html
  5265. share/doc/qt5/qtmultimedia/qcameraimagecapture.html
  5266. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol-members.html
  5267. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol.html
  5268. share/doc/qt5/qtmultimedia/qcameraimageprocessing-members.html
  5269. share/doc/qt5/qtmultimedia/qcameraimageprocessing.html
  5270. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol-members.html
  5271. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol.html
  5272. share/doc/qt5/qtmultimedia/qcamerainfo-members.html
  5273. share/doc/qt5/qtmultimedia/qcamerainfo.html
  5274. share/doc/qt5/qtmultimedia/qcamerainfocontrol-members.html
  5275. share/doc/qt5/qtmultimedia/qcamerainfocontrol.html
  5276. share/doc/qt5/qtmultimedia/qcameralockscontrol-members.html
  5277. share/doc/qt5/qtmultimedia/qcameralockscontrol.html
  5278. share/doc/qt5/qtmultimedia/qcameraviewfinder-members.html
  5279. share/doc/qt5/qtmultimedia/qcameraviewfinder.html
  5280. share/doc/qt5/qtmultimedia/qcameraviewfindersettings-members.html
  5281. share/doc/qt5/qtmultimedia/qcameraviewfindersettings.html
  5282. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol-members.html
  5283. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol.html
  5284. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2-members.html
  5285. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2.html
  5286. share/doc/qt5/qtmultimedia/qcamerazoomcontrol-members.html
  5287. share/doc/qt5/qtmultimedia/qcamerazoomcontrol.html
  5288. share/doc/qt5/qtmultimedia/qgraphicsvideoitem-members.html
  5289. share/doc/qt5/qtmultimedia/qgraphicsvideoitem.html
  5290. share/doc/qt5/qtmultimedia/qimageencodercontrol-members.html
  5291. share/doc/qt5/qtmultimedia/qimageencodercontrol.html
  5292. share/doc/qt5/qtmultimedia/qimageencodersettings-members.html
  5293. share/doc/qt5/qtmultimedia/qimageencodersettings.html
  5294. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol-members.html
  5295. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol.html
  5296. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol-members.html
  5297. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol.html
  5298. share/doc/qt5/qtmultimedia/qmediabindableinterface-members.html
  5299. share/doc/qt5/qtmultimedia/qmediabindableinterface.html
  5300. share/doc/qt5/qtmultimedia/qmediacontainercontrol-members.html
  5301. share/doc/qt5/qtmultimedia/qmediacontainercontrol.html
  5302. share/doc/qt5/qtmultimedia/qmediacontent-members.html
  5303. share/doc/qt5/qtmultimedia/qmediacontent.html
  5304. share/doc/qt5/qtmultimedia/qmediacontrol-members.html
  5305. share/doc/qt5/qtmultimedia/qmediacontrol.html
  5306. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol-members.html
  5307. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol.html
  5308. share/doc/qt5/qtmultimedia/qmediametadata.html
  5309. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol-members.html
  5310. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol.html
  5311. share/doc/qt5/qtmultimedia/qmediaobject-members.html
  5312. share/doc/qt5/qtmultimedia/qmediaobject.html
  5313. share/doc/qt5/qtmultimedia/qmediaplayer-members.html
  5314. share/doc/qt5/qtmultimedia/qmediaplayer-obsolete.html
  5315. share/doc/qt5/qtmultimedia/qmediaplayer.html
  5316. share/doc/qt5/qtmultimedia/qmediaplayercontrol-members.html
  5317. share/doc/qt5/qtmultimedia/qmediaplayercontrol.html
  5318. share/doc/qt5/qtmultimedia/qmediaplaylist-members.html
  5319. share/doc/qt5/qtmultimedia/qmediaplaylist.html
  5320. share/doc/qt5/qtmultimedia/qmediarecorder-members.html
  5321. share/doc/qt5/qtmultimedia/qmediarecorder.html
  5322. share/doc/qt5/qtmultimedia/qmediarecordercontrol-members.html
  5323. share/doc/qt5/qtmultimedia/qmediarecordercontrol.html
  5324. share/doc/qt5/qtmultimedia/qmediaresource-members.html
  5325. share/doc/qt5/qtmultimedia/qmediaresource.html
  5326. share/doc/qt5/qtmultimedia/qmediaservice-members.html
  5327. share/doc/qt5/qtmultimedia/qmediaservice.html
  5328. share/doc/qt5/qtmultimedia/qmediaservicecamerainfointerface-members.html
  5329. share/doc/qt5/qtmultimedia/qmediaservicecamerainfointerface.html
  5330. share/doc/qt5/qtmultimedia/qmediaservicedefaultdeviceinterface-members.html
  5331. share/doc/qt5/qtmultimedia/qmediaservicedefaultdeviceinterface.html
  5332. share/doc/qt5/qtmultimedia/qmediaservicefeaturesinterface-members.html
  5333. share/doc/qt5/qtmultimedia/qmediaservicefeaturesinterface.html
  5334. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin-members.html
  5335. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin.html
  5336. share/doc/qt5/qtmultimedia/qmediaservicesupporteddevicesinterface-members.html
  5337. share/doc/qt5/qtmultimedia/qmediaservicesupporteddevicesinterface.html
  5338. share/doc/qt5/qtmultimedia/qmediaservicesupportedformatsinterface-members.html
  5339. share/doc/qt5/qtmultimedia/qmediaservicesupportedformatsinterface.html
  5340. share/doc/qt5/qtmultimedia/qmediastreamscontrol-members.html
  5341. share/doc/qt5/qtmultimedia/qmediastreamscontrol.html
  5342. share/doc/qt5/qtmultimedia/qmediatimeinterval-members.html
  5343. share/doc/qt5/qtmultimedia/qmediatimeinterval.html
  5344. share/doc/qt5/qtmultimedia/qmediatimerange-members.html
  5345. share/doc/qt5/qtmultimedia/qmediatimerange.html
  5346. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol-members.html
  5347. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol.html
  5348. share/doc/qt5/qtmultimedia/qmetadatareadercontrol-members.html
  5349. share/doc/qt5/qtmultimedia/qmetadatareadercontrol.html
  5350. share/doc/qt5/qtmultimedia/qmetadatawritercontrol-members.html
  5351. share/doc/qt5/qtmultimedia/qmetadatawritercontrol.html
  5352. share/doc/qt5/qtmultimedia/qml-multimedia.html
  5353. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse-members.html
  5354. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse.html
  5355. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodellinear-members.html
  5356. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodellinear.html
  5357. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiocategory-members.html
  5358. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiocategory.html
  5359. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audioengine-members.html
  5360. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audioengine.html
  5361. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiolistener-members.html
  5362. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiolistener.html
  5363. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiosample-members.html
  5364. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiosample.html
  5365. share/doc/qt5/qtmultimedia/qml-qtaudioengine-playvariation-members.html
  5366. share/doc/qt5/qtmultimedia/qml-qtaudioengine-playvariation.html
  5367. share/doc/qt5/qtmultimedia/qml-qtaudioengine-sound-members.html
  5368. share/doc/qt5/qtmultimedia/qml-qtaudioengine-sound.html
  5369. share/doc/qt5/qtmultimedia/qml-qtaudioengine-soundinstance-members.html
  5370. share/doc/qt5/qtmultimedia/qml-qtaudioengine-soundinstance.html
  5371. share/doc/qt5/qtmultimedia/qml-qtmultimedia-audio-members.html
  5372. share/doc/qt5/qtmultimedia/qml-qtmultimedia-audio.html
  5373. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camera-members.html
  5374. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camera.html
  5375. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameracapture-members.html
  5376. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameracapture.html
  5377. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraexposure-members.html
  5378. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraexposure.html
  5379. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraflash-members.html
  5380. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraflash.html
  5381. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerafocus-members.html
  5382. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerafocus.html
  5383. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraimageprocessing-members.html
  5384. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraimageprocessing.html
  5385. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerarecorder-members.html
  5386. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerarecorder.html
  5387. share/doc/qt5/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
  5388. share/doc/qt5/qtmultimedia/qml-qtmultimedia-mediaplayer.html
  5389. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlist-members.html
  5390. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlist.html
  5391. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlistitem-members.html
  5392. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlistitem.html
  5393. share/doc/qt5/qtmultimedia/qml-qtmultimedia-qtmultimedia-members.html
  5394. share/doc/qt5/qtmultimedia/qml-qtmultimedia-qtmultimedia.html
  5395. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radio-members.html
  5396. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radio.html
  5397. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radiodata-members.html
  5398. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radiodata.html
  5399. share/doc/qt5/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
  5400. share/doc/qt5/qtmultimedia/qml-qtmultimedia-soundeffect.html
  5401. share/doc/qt5/qtmultimedia/qml-qtmultimedia-torch-members.html
  5402. share/doc/qt5/qtmultimedia/qml-qtmultimedia-torch.html
  5403. share/doc/qt5/qtmultimedia/qml-qtmultimedia-video-members.html
  5404. share/doc/qt5/qtmultimedia/qml-qtmultimedia-video.html
  5405. share/doc/qt5/qtmultimedia/qml-qtmultimedia-videooutput-members.html
  5406. share/doc/qt5/qtmultimedia/qml-qtmultimedia-videooutput.html
  5407. share/doc/qt5/qtmultimedia/qmultimedia.html
  5408. share/doc/qt5/qtmultimedia/qradiodata-members.html
  5409. share/doc/qt5/qtmultimedia/qradiodata.html
  5410. share/doc/qt5/qtmultimedia/qradiodatacontrol-members.html
  5411. share/doc/qt5/qtmultimedia/qradiodatacontrol.html
  5412. share/doc/qt5/qtmultimedia/qradiotuner-members.html
  5413. share/doc/qt5/qtmultimedia/qradiotuner.html
  5414. share/doc/qt5/qtmultimedia/qradiotunercontrol-members.html
  5415. share/doc/qt5/qtmultimedia/qradiotunercontrol.html
  5416. share/doc/qt5/qtmultimedia/qsound-members.html
  5417. share/doc/qt5/qtmultimedia/qsound.html
  5418. share/doc/qt5/qtmultimedia/qsoundeffect-members.html
  5419. share/doc/qt5/qtmultimedia/qsoundeffect.html
  5420. share/doc/qt5/qtmultimedia/qtaudioengine-qmlmodule.html
  5421. share/doc/qt5/qtmultimedia/qtmultimedia-index.html
  5422. share/doc/qt5/qtmultimedia/qtmultimedia-ios.html
  5423. share/doc/qt5/qtmultimedia/qtmultimedia-module.html
  5424. share/doc/qt5/qtmultimedia/qtmultimedia-modules.html
  5425. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-cpp.html
  5426. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-h.html
  5427. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-pro.html
  5428. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevicesbase-ui.html
  5429. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-example.html
  5430. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-main-cpp.html
  5431. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-audioengine-pro.html
  5432. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-example.html
  5433. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qml.html
  5434. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qmlproject.html
  5435. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-content-myaudioengine-qml.html
  5436. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-cpp.html
  5437. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-h.html
  5438. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-pro.html
  5439. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-example.html
  5440. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-main-cpp.html
  5441. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-cpp.html
  5442. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-h.html
  5443. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-pro.html
  5444. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-example.html
  5445. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-main-cpp.html
  5446. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-cpp.html
  5447. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-h.html
  5448. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-pro.html
  5449. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-ui.html
  5450. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-example.html
  5451. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-main-cpp.html
  5452. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-qaudiolevel-cpp.html
  5453. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-qaudiolevel-h.html
  5454. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerabutton-qml.html
  5455. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistbutton-qml.html
  5456. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistpopup-qml.html
  5457. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertybutton-qml.html
  5458. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertypopup-qml.html
  5459. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-pro.html
  5460. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qml.html
  5461. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qmlproject.html
  5462. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qrc.html
  5463. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-example.html
  5464. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-focusbutton-qml.html
  5465. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photocapturecontrols-qml.html
  5466. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photopreview-qml.html
  5467. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-popup-qml.html
  5468. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-qmlcamera-cpp.html
  5469. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videocapturecontrols-qml.html
  5470. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videopreview-qml.html
  5471. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-zoomcontrol-qml.html
  5472. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-pro.html
  5473. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-qrc.html
  5474. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-example.html
  5475. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-main-cpp.html
  5476. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-view-qml.html
  5477. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-array-h.html
  5478. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-def-h.html
  5479. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-dynarray-h.html
  5480. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-h.html
  5481. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-pro.html
  5482. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-cpp.html
  5483. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-h.html
  5484. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlen-h.html
  5485. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlenparam-h.html
  5486. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassdirect-h.html
  5487. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassinverse-h.html
  5488. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealselect-h.html
  5489. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealusetrigo-h.html
  5490. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-oscsincos-h.html
  5491. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-cpp.html
  5492. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-h.html
  5493. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-def-h.html
  5494. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-fnc-h.html
  5495. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-int64-h.html
  5496. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-cpp.html
  5497. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-h.html
  5498. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-cpp.html
  5499. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-fnc-h.html
  5500. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-settings-h.html
  5501. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testaccuracy-h.html
  5502. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelperfixlen-h.html
  5503. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelpernormal-h.html
  5504. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testspeed-h.html
  5505. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testwhitenoisegen-h.html
  5506. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-app-pro.html
  5507. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-cpp.html
  5508. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-h.html
  5509. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-cpp.html
  5510. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-h.html
  5511. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-cpp.html
  5512. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-h.html
  5513. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-main-cpp.html
  5514. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-cpp.html
  5515. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-h.html
  5516. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-cpp.html
  5517. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-h.html
  5518. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-cpp.html
  5519. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-h.html
  5520. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-cpp.html
  5521. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-h.html
  5522. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-h.html
  5523. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-qrc.html
  5524. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-cpp.html
  5525. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-h.html
  5526. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-cpp.html
  5527. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-h.html
  5528. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-cpp.html
  5529. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-h.html
  5530. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-cpp.html
  5531. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-h.html
  5532. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-cpp.html
  5533. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-h.html
  5534. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-cpp.html
  5535. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-h.html
  5536. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-example.html
  5537. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-spectrum-pro.html
  5538. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-example.html
  5539. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-main-cpp.html
  5540. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-button-qml.html
  5541. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerabasic-qml.html
  5542. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradrag-qml.html
  5543. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradummy-qml.html
  5544. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreen-qml.html
  5545. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreeninverted-qml.html
  5546. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraitem-qml.html
  5547. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameramove-qml.html
  5548. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraoverlay-qml.html
  5549. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraresize-qml.html
  5550. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerarotate-qml.html
  5551. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraspin-qml.html
  5552. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-content-qml.html
  5553. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-errordialog-qml.html
  5554. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-filebrowser-qml.html
  5555. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-main-qml.html
  5556. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scene-qml.html
  5557. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenebasic-qml.html
  5558. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenedrag-qml.html
  5559. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreen-qml.html
  5560. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreeninverted-qml.html
  5561. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemove-qml.html
  5562. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemulti-qml.html
  5563. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneoverlay-qml.html
  5564. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneresize-qml.html
  5565. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenerotate-qml.html
  5566. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneselectionpanel-qml.html
  5567. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenespin-qml.html
  5568. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-seekcontrol-qml.html
  5569. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videobasic-qml.html
  5570. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodrag-qml.html
  5571. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodummy-qml.html
  5572. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofillmode-qml.html
  5573. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreen-qml.html
  5574. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreeninverted-qml.html
  5575. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoitem-qml.html
  5576. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videometadata-qml.html
  5577. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videomove-qml.html
  5578. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videooverlay-qml.html
  5579. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoplaybackrate-qml.html
  5580. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoresize-qml.html
  5581. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videorotate-qml.html
  5582. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoseek-qml.html
  5583. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videospin-qml.html
  5584. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-pro.html
  5585. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-qrc.html
  5586. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-svg.html
  5587. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-trace-h.html
  5588. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-example.html
  5589. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-cpp.html
  5590. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-h.html
  5591. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-main-cpp.html
  5592. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-button-qml.html
  5593. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-content-qml.html
  5594. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentcamera-qml.html
  5595. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentimage-qml.html
  5596. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentvideo-qml.html
  5597. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-curtain-qml.html
  5598. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-divider-qml.html
  5599. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effect-qml.html
  5600. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectbillboard-qml.html
  5601. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectblackandwhite-qml.html
  5602. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectemboss-qml.html
  5603. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectgaussianblur-qml.html
  5604. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectglow-qml.html
  5605. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectisolate-qml.html
  5606. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectmagnify-qml.html
  5607. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpagecurl-qml.html
  5608. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpassthrough-qml.html
  5609. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpixelate-qml.html
  5610. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectposterize-qml.html
  5611. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectripple-qml.html
  5612. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectselectionlist-qml.html
  5613. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsepia-qml.html
  5614. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsharpen-qml.html
  5615. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectshockwave-qml.html
  5616. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsobeledgedetection1-qml.html
  5617. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttiltshift-qml.html
  5618. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttoon-qml.html
  5619. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectvignette-qml.html
  5620. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwarhol-qml.html
  5621. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwobble-qml.html
  5622. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-filebrowser-qml.html
  5623. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-fileopen-qml.html
  5624. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-hintedmousearea-qml.html
  5625. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-main-qml.html
  5626. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-parameterpanel-qml.html
  5627. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-slider-qml.html
  5628. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-cpp.html
  5629. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-h.html
  5630. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-pro.html
  5631. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-qrc.html
  5632. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-svg.html
  5633. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-trace-h.html
  5634. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-cpp.html
  5635. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-h.html
  5636. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-pro.html
  5637. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-qrc.html
  5638. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-ui.html
  5639. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-example.html
  5640. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-images-shutter-svg.html
  5641. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-cpp.html
  5642. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-h.html
  5643. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-ui.html
  5644. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-main-cpp.html
  5645. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-cpp.html
  5646. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-h.html
  5647. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-ui.html
  5648. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-example.html
  5649. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-cpp.html
  5650. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-h.html
  5651. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-main-cpp.html
  5652. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-cpp.html
  5653. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-h.html
  5654. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-pro.html
  5655. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-cpp.html
  5656. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-h.html
  5657. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-cpp.html
  5658. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-h.html
  5659. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-cpp.html
  5660. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-h.html
  5661. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-example.html
  5662. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-main-cpp.html
  5663. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videographicsitem-pro.html
  5664. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-cpp.html
  5665. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-h.html
  5666. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-example.html
  5667. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-main-cpp.html
  5668. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-cpp.html
  5669. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-h.html
  5670. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videowidget-pro.html
  5671. share/doc/qt5/qtmultimedia/qtmultimedia-qmlmodule.html
  5672. share/doc/qt5/qtmultimedia/qtmultimedia-windows.html
  5673. share/doc/qt5/qtmultimedia/qtmultimedia.index
  5674. share/doc/qt5/qtmultimedia/qtmultimedia.qhp
  5675. share/doc/qt5/qtmultimedia/qtmultimedia.qhp.sha1
  5676. share/doc/qt5/qtmultimedia/qtmultimediawidgets-index.html
  5677. share/doc/qt5/qtmultimedia/qtmultimediawidgets-module.html
  5678. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol-members.html
  5679. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol.html
  5680. share/doc/qt5/qtmultimedia/qvideoencodersettings-members.html
  5681. share/doc/qt5/qtmultimedia/qvideoencodersettings.html
  5682. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol-members.html
  5683. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol.html
  5684. share/doc/qt5/qtmultimedia/qvideofilterrunnable-members.html
  5685. share/doc/qt5/qtmultimedia/qvideofilterrunnable.html
  5686. share/doc/qt5/qtmultimedia/qvideoframe-members.html
  5687. share/doc/qt5/qtmultimedia/qvideoframe.html
  5688. share/doc/qt5/qtmultimedia/qvideoprobe-members.html
  5689. share/doc/qt5/qtmultimedia/qvideoprobe.html
  5690. share/doc/qt5/qtmultimedia/qvideorenderercontrol-members.html
  5691. share/doc/qt5/qtmultimedia/qvideorenderercontrol.html
  5692. share/doc/qt5/qtmultimedia/qvideosurfaceformat-members.html
  5693. share/doc/qt5/qtmultimedia/qvideosurfaceformat.html
  5694. share/doc/qt5/qtmultimedia/qvideowidget-members.html
  5695. share/doc/qt5/qtmultimedia/qvideowidget.html
  5696. share/doc/qt5/qtmultimedia/qvideowidgetcontrol-members.html
  5697. share/doc/qt5/qtmultimedia/qvideowidgetcontrol.html
  5698. share/doc/qt5/qtmultimedia/qvideowindowcontrol-members.html
  5699. share/doc/qt5/qtmultimedia/qvideowindowcontrol.html
  5700. share/doc/qt5/qtmultimedia/radiooverview.html
  5701. share/doc/qt5/qtmultimedia/style/offline-simple.css
  5702. share/doc/qt5/qtmultimedia/style/offline.css
  5703. share/doc/qt5/qtmultimedia/videooverview.html
  5704. share/doc/qt5/qtnetwork.qch
  5705. share/doc/qt5/qtnetwork/bearer-management.html
  5706. share/doc/qt5/qtnetwork/examples-manifest.xml
  5707. share/doc/qt5/qtnetwork/examples-network.html
  5708. share/doc/qt5/qtnetwork/images/arrow_bc.png
  5709. share/doc/qt5/qtnetwork/images/bgrContent.png
  5710. share/doc/qt5/qtnetwork/images/blockingfortuneclient-example.png
  5711. share/doc/qt5/qtnetwork/images/broadcastreceiver-example.png
  5712. share/doc/qt5/qtnetwork/images/broadcastsender-example.png
  5713. share/doc/qt5/qtnetwork/images/btn_next.png
  5714. share/doc/qt5/qtnetwork/images/btn_prev.png
  5715. share/doc/qt5/qtnetwork/images/bullet_dn.png
  5716. share/doc/qt5/qtnetwork/images/bullet_sq.png
  5717. share/doc/qt5/qtnetwork/images/fortuneclient-example.png
  5718. share/doc/qt5/qtnetwork/images/fortuneserver-example.png
  5719. share/doc/qt5/qtnetwork/images/googlesuggest-example.png
  5720. share/doc/qt5/qtnetwork/images/home.png
  5721. share/doc/qt5/qtnetwork/images/http-example.png
  5722. share/doc/qt5/qtnetwork/images/ico_note.png
  5723. share/doc/qt5/qtnetwork/images/ico_note_attention.png
  5724. share/doc/qt5/qtnetwork/images/ico_out.png
  5725. share/doc/qt5/qtnetwork/images/logo.png
  5726. share/doc/qt5/qtnetwork/images/loopback-example.png
  5727. share/doc/qt5/qtnetwork/images/multicastreceiver-example.png
  5728. share/doc/qt5/qtnetwork/images/multicastsender-example.png
  5729. share/doc/qt5/qtnetwork/images/network-chat-example.png
  5730. share/doc/qt5/qtnetwork/images/network-examples.png
  5731. share/doc/qt5/qtnetwork/images/roaming-states.png
  5732. share/doc/qt5/qtnetwork/images/securesocketclient.png
  5733. share/doc/qt5/qtnetwork/images/securesocketclient2.png
  5734. share/doc/qt5/qtnetwork/images/tcpstream.png
  5735. share/doc/qt5/qtnetwork/images/threadedfortuneserver-example.png
  5736. share/doc/qt5/qtnetwork/images/torrent-example.png
  5737. share/doc/qt5/qtnetwork/images/udppackets.png
  5738. share/doc/qt5/qtnetwork/network.html
  5739. share/doc/qt5/qtnetwork/qabstractnetworkcache-members.html
  5740. share/doc/qt5/qtnetwork/qabstractnetworkcache.html
  5741. share/doc/qt5/qtnetwork/qabstractsocket-members.html
  5742. share/doc/qt5/qtnetwork/qabstractsocket.html
  5743. share/doc/qt5/qtnetwork/qauthenticator-members.html
  5744. share/doc/qt5/qtnetwork/qauthenticator.html
  5745. share/doc/qt5/qtnetwork/qdnsdomainnamerecord-members.html
  5746. share/doc/qt5/qtnetwork/qdnsdomainnamerecord.html
  5747. share/doc/qt5/qtnetwork/qdnshostaddressrecord-members.html
  5748. share/doc/qt5/qtnetwork/qdnshostaddressrecord.html
  5749. share/doc/qt5/qtnetwork/qdnslookup-members.html
  5750. share/doc/qt5/qtnetwork/qdnslookup.html
  5751. share/doc/qt5/qtnetwork/qdnsmailexchangerecord-members.html
  5752. share/doc/qt5/qtnetwork/qdnsmailexchangerecord.html
  5753. share/doc/qt5/qtnetwork/qdnsservicerecord-members.html
  5754. share/doc/qt5/qtnetwork/qdnsservicerecord.html
  5755. share/doc/qt5/qtnetwork/qdnstextrecord-members.html
  5756. share/doc/qt5/qtnetwork/qdnstextrecord.html
  5757. share/doc/qt5/qtnetwork/qhostaddress-members.html
  5758. share/doc/qt5/qtnetwork/qhostaddress.html
  5759. share/doc/qt5/qtnetwork/qhostinfo-members.html
  5760. share/doc/qt5/qtnetwork/qhostinfo.html
  5761. share/doc/qt5/qtnetwork/qhstspolicy-members.html
  5762. share/doc/qt5/qtnetwork/qhstspolicy.html
  5763. share/doc/qt5/qtnetwork/qhttpmultipart-members.html
  5764. share/doc/qt5/qtnetwork/qhttpmultipart.html
  5765. share/doc/qt5/qtnetwork/qhttppart-members.html
  5766. share/doc/qt5/qtnetwork/qhttppart.html
  5767. share/doc/qt5/qtnetwork/qlocalserver-members.html
  5768. share/doc/qt5/qtnetwork/qlocalserver.html
  5769. share/doc/qt5/qtnetwork/qlocalsocket-members.html
  5770. share/doc/qt5/qtnetwork/qlocalsocket.html
  5771. share/doc/qt5/qtnetwork/qnetworkaccessmanager-members.html
  5772. share/doc/qt5/qtnetwork/qnetworkaccessmanager.html
  5773. share/doc/qt5/qtnetwork/qnetworkaddressentry-members.html
  5774. share/doc/qt5/qtnetwork/qnetworkaddressentry.html
  5775. share/doc/qt5/qtnetwork/qnetworkcachemetadata-members.html
  5776. share/doc/qt5/qtnetwork/qnetworkcachemetadata.html
  5777. share/doc/qt5/qtnetwork/qnetworkconfiguration-members.html
  5778. share/doc/qt5/qtnetwork/qnetworkconfiguration.html
  5779. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager-members.html
  5780. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager.html
  5781. share/doc/qt5/qtnetwork/qnetworkcookie-members.html
  5782. share/doc/qt5/qtnetwork/qnetworkcookie.html
  5783. share/doc/qt5/qtnetwork/qnetworkcookiejar-members.html
  5784. share/doc/qt5/qtnetwork/qnetworkcookiejar.html
  5785. share/doc/qt5/qtnetwork/qnetworkdatagram-members.html
  5786. share/doc/qt5/qtnetwork/qnetworkdatagram.html
  5787. share/doc/qt5/qtnetwork/qnetworkdiskcache-members.html
  5788. share/doc/qt5/qtnetwork/qnetworkdiskcache.html
  5789. share/doc/qt5/qtnetwork/qnetworkinterface-members.html
  5790. share/doc/qt5/qtnetwork/qnetworkinterface.html
  5791. share/doc/qt5/qtnetwork/qnetworkproxy-members.html
  5792. share/doc/qt5/qtnetwork/qnetworkproxy.html
  5793. share/doc/qt5/qtnetwork/qnetworkproxyfactory-members.html
  5794. share/doc/qt5/qtnetwork/qnetworkproxyfactory.html
  5795. share/doc/qt5/qtnetwork/qnetworkproxyquery-members.html
  5796. share/doc/qt5/qtnetwork/qnetworkproxyquery.html
  5797. share/doc/qt5/qtnetwork/qnetworkreply-members.html
  5798. share/doc/qt5/qtnetwork/qnetworkreply.html
  5799. share/doc/qt5/qtnetwork/qnetworkrequest-members.html
  5800. share/doc/qt5/qtnetwork/qnetworkrequest.html
  5801. share/doc/qt5/qtnetwork/qnetworksession-members.html
  5802. share/doc/qt5/qtnetwork/qnetworksession.html
  5803. share/doc/qt5/qtnetwork/qsctpserver-members.html
  5804. share/doc/qt5/qtnetwork/qsctpserver.html
  5805. share/doc/qt5/qtnetwork/qsctpsocket-members.html
  5806. share/doc/qt5/qtnetwork/qsctpsocket.html
  5807. share/doc/qt5/qtnetwork/qssl-obsolete.html
  5808. share/doc/qt5/qtnetwork/qssl.html
  5809. share/doc/qt5/qtnetwork/qsslcertificate-members.html
  5810. share/doc/qt5/qtnetwork/qsslcertificate-obsolete.html
  5811. share/doc/qt5/qtnetwork/qsslcertificate.html
  5812. share/doc/qt5/qtnetwork/qsslcertificateextension-members.html
  5813. share/doc/qt5/qtnetwork/qsslcertificateextension.html
  5814. share/doc/qt5/qtnetwork/qsslcipher-members.html
  5815. share/doc/qt5/qtnetwork/qsslcipher.html
  5816. share/doc/qt5/qtnetwork/qsslconfiguration-members.html
  5817. share/doc/qt5/qtnetwork/qsslconfiguration.html
  5818. share/doc/qt5/qtnetwork/qssldiffiehellmanparameters-members.html
  5819. share/doc/qt5/qtnetwork/qssldiffiehellmanparameters.html
  5820. share/doc/qt5/qtnetwork/qsslellipticcurve-members.html
  5821. share/doc/qt5/qtnetwork/qsslellipticcurve.html
  5822. share/doc/qt5/qtnetwork/qsslerror-members.html
  5823. share/doc/qt5/qtnetwork/qsslerror.html
  5824. share/doc/qt5/qtnetwork/qsslkey-members.html
  5825. share/doc/qt5/qtnetwork/qsslkey.html
  5826. share/doc/qt5/qtnetwork/qsslpresharedkeyauthenticator-members.html
  5827. share/doc/qt5/qtnetwork/qsslpresharedkeyauthenticator.html
  5828. share/doc/qt5/qtnetwork/qsslsocket-members.html
  5829. share/doc/qt5/qtnetwork/qsslsocket-obsolete.html
  5830. share/doc/qt5/qtnetwork/qsslsocket.html
  5831. share/doc/qt5/qtnetwork/qtcpserver-members.html
  5832. share/doc/qt5/qtnetwork/qtcpserver.html
  5833. share/doc/qt5/qtnetwork/qtcpsocket-members.html
  5834. share/doc/qt5/qtnetwork/qtcpsocket.html
  5835. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-cpp.html
  5836. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-h.html
  5837. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingfortuneclient-pro.html
  5838. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-example.html
  5839. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-cpp.html
  5840. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-h.html
  5841. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-main-cpp.html
  5842. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-broadcastreceiver-pro.html
  5843. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-example.html
  5844. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-main-cpp.html
  5845. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-receiver-cpp.html
  5846. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-receiver-h.html
  5847. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-broadcastsender-pro.html
  5848. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-example.html
  5849. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-main-cpp.html
  5850. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-sender-cpp.html
  5851. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-sender-h.html
  5852. share/doc/qt5/qtnetwork/qtnetwork-download-download-pro.html
  5853. share/doc/qt5/qtnetwork/qtnetwork-download-example.html
  5854. share/doc/qt5/qtnetwork/qtnetwork-download-main-cpp.html
  5855. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-cpp.html
  5856. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-h.html
  5857. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-pro.html
  5858. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-example.html
  5859. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-main-cpp.html
  5860. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-textprogressbar-cpp.html
  5861. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-textprogressbar-h.html
  5862. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-client-cpp.html
  5863. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-client-h.html
  5864. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-example.html
  5865. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-fortuneclient-pro.html
  5866. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-main-cpp.html
  5867. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-example.html
  5868. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-fortuneserver-pro.html
  5869. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-main-cpp.html
  5870. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-server-cpp.html
  5871. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-server-h.html
  5872. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-example.html
  5873. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-cpp.html
  5874. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-h.html
  5875. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-pro.html
  5876. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-main-cpp.html
  5877. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-searchbox-cpp.html
  5878. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-searchbox-h.html
  5879. share/doc/qt5/qtnetwork/qtnetwork-http-authenticationdialog-ui.html
  5880. share/doc/qt5/qtnetwork/qtnetwork-http-example.html
  5881. share/doc/qt5/qtnetwork/qtnetwork-http-http-pro.html
  5882. share/doc/qt5/qtnetwork/qtnetwork-http-httpwindow-cpp.html
  5883. share/doc/qt5/qtnetwork/qtnetwork-http-httpwindow-h.html
  5884. share/doc/qt5/qtnetwork/qtnetwork-http-main-cpp.html
  5885. share/doc/qt5/qtnetwork/qtnetwork-index.html
  5886. share/doc/qt5/qtnetwork/qtnetwork-loopback-dialog-cpp.html
  5887. share/doc/qt5/qtnetwork/qtnetwork-loopback-dialog-h.html
  5888. share/doc/qt5/qtnetwork/qtnetwork-loopback-example.html
  5889. share/doc/qt5/qtnetwork/qtnetwork-loopback-loopback-pro.html
  5890. share/doc/qt5/qtnetwork/qtnetwork-loopback-main-cpp.html
  5891. share/doc/qt5/qtnetwork/qtnetwork-module.html
  5892. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-example.html
  5893. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-main-cpp.html
  5894. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-multicastreceiver-pro.html
  5895. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-receiver-cpp.html
  5896. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-receiver-h.html
  5897. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-example.html
  5898. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-main-cpp.html
  5899. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-multicastsender-pro.html
  5900. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-sender-cpp.html
  5901. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-sender-h.html
  5902. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-cpp.html
  5903. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-h.html
  5904. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-ui.html
  5905. share/doc/qt5/qtnetwork/qtnetwork-network-chat-client-cpp.html
  5906. share/doc/qt5/qtnetwork/qtnetwork-network-chat-client-h.html
  5907. share/doc/qt5/qtnetwork/qtnetwork-network-chat-connection-cpp.html
  5908. share/doc/qt5/qtnetwork/qtnetwork-network-chat-connection-h.html
  5909. share/doc/qt5/qtnetwork/qtnetwork-network-chat-example.html
  5910. share/doc/qt5/qtnetwork/qtnetwork-network-chat-main-cpp.html
  5911. share/doc/qt5/qtnetwork/qtnetwork-network-chat-network-chat-pro.html
  5912. share/doc/qt5/qtnetwork/qtnetwork-network-chat-peermanager-cpp.html
  5913. share/doc/qt5/qtnetwork/qtnetwork-network-chat-peermanager-h.html
  5914. share/doc/qt5/qtnetwork/qtnetwork-network-chat-server-cpp.html
  5915. share/doc/qt5/qtnetwork/qtnetwork-network-chat-server-h.html
  5916. share/doc/qt5/qtnetwork/qtnetwork-programming.html
  5917. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-cpp.html
  5918. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-h.html
  5919. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-ui.html
  5920. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-example.html
  5921. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-main-cpp.html
  5922. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-securesocketclient-pro.html
  5923. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-securesocketclient-qrc.html
  5924. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-cpp.html
  5925. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-h.html
  5926. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-ui.html
  5927. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslerrors-ui.html
  5928. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-dialog-cpp.html
  5929. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-dialog-h.html
  5930. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-example.html
  5931. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-cpp.html
  5932. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-h.html
  5933. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-cpp.html
  5934. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-h.html
  5935. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-main-cpp.html
  5936. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-threadedfortuneserver-pro.html
  5937. share/doc/qt5/qtnetwork/qtnetwork-torrent-addtorrentdialog-cpp.html
  5938. share/doc/qt5/qtnetwork/qtnetwork-torrent-addtorrentdialog-h.html
  5939. share/doc/qt5/qtnetwork/qtnetwork-torrent-bencodeparser-cpp.html
  5940. share/doc/qt5/qtnetwork/qtnetwork-torrent-bencodeparser-h.html
  5941. share/doc/qt5/qtnetwork/qtnetwork-torrent-connectionmanager-cpp.html
  5942. share/doc/qt5/qtnetwork/qtnetwork-torrent-connectionmanager-h.html
  5943. share/doc/qt5/qtnetwork/qtnetwork-torrent-example.html
  5944. share/doc/qt5/qtnetwork/qtnetwork-torrent-filemanager-cpp.html
  5945. share/doc/qt5/qtnetwork/qtnetwork-torrent-filemanager-h.html
  5946. share/doc/qt5/qtnetwork/qtnetwork-torrent-forms-addtorrentform-ui.html
  5947. share/doc/qt5/qtnetwork/qtnetwork-torrent-icons-qrc.html
  5948. share/doc/qt5/qtnetwork/qtnetwork-torrent-main-cpp.html
  5949. share/doc/qt5/qtnetwork/qtnetwork-torrent-mainwindow-cpp.html
  5950. share/doc/qt5/qtnetwork/qtnetwork-torrent-mainwindow-h.html
  5951. share/doc/qt5/qtnetwork/qtnetwork-torrent-metainfo-cpp.html
  5952. share/doc/qt5/qtnetwork/qtnetwork-torrent-metainfo-h.html
  5953. share/doc/qt5/qtnetwork/qtnetwork-torrent-peerwireclient-cpp.html
  5954. share/doc/qt5/qtnetwork/qtnetwork-torrent-peerwireclient-h.html
  5955. share/doc/qt5/qtnetwork/qtnetwork-torrent-ratecontroller-cpp.html
  5956. share/doc/qt5/qtnetwork/qtnetwork-torrent-ratecontroller-h.html
  5957. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrent-pro.html
  5958. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentclient-cpp.html
  5959. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentclient-h.html
  5960. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentserver-cpp.html
  5961. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentserver-h.html
  5962. share/doc/qt5/qtnetwork/qtnetwork-torrent-trackerclient-cpp.html
  5963. share/doc/qt5/qtnetwork/qtnetwork-torrent-trackerclient-h.html
  5964. share/doc/qt5/qtnetwork/qtnetwork.index
  5965. share/doc/qt5/qtnetwork/qtnetwork.qhp
  5966. share/doc/qt5/qtnetwork/qtnetwork.qhp.sha1
  5967. share/doc/qt5/qtnetwork/qtnetwork.tags
  5968. share/doc/qt5/qtnetwork/qudpsocket-members.html
  5969. share/doc/qt5/qtnetwork/qudpsocket.html
  5970. share/doc/qt5/qtnetwork/ssl.html
  5971. share/doc/qt5/qtnetwork/style/offline-simple.css
  5972. share/doc/qt5/qtnetwork/style/offline.css
  5973. share/doc/qt5/qtnfc.qch
  5974. share/doc/qt5/qtnfc/examples-manifest.xml
  5975. share/doc/qt5/qtnfc/images/annotatedurl.png
  5976. share/doc/qt5/qtnfc/images/arrow_bc.png
  5977. share/doc/qt5/qtnfc/images/bgrContent.png
  5978. share/doc/qt5/qtnfc/images/btn_next.png
  5979. share/doc/qt5/qtnfc/images/btn_prev.png
  5980. share/doc/qt5/qtnfc/images/bullet_dn.png
  5981. share/doc/qt5/qtnfc/images/bullet_sq.png
  5982. share/doc/qt5/qtnfc/images/corkboard.png
  5983. share/doc/qt5/qtnfc/images/home.png
  5984. share/doc/qt5/qtnfc/images/ico_note.png
  5985. share/doc/qt5/qtnfc/images/ico_note_attention.png
  5986. share/doc/qt5/qtnfc/images/ico_out.png
  5987. share/doc/qt5/qtnfc/images/logo.png
  5988. share/doc/qt5/qtnfc/images/ndefeditor.png
  5989. share/doc/qt5/qtnfc/images/qml-poster-example.png
  5990. share/doc/qt5/qtnfc/nfc-android.html
  5991. share/doc/qt5/qtnfc/nfc-examples.html
  5992. share/doc/qt5/qtnfc/qml-qtnfc-ndeffilter-members.html
  5993. share/doc/qt5/qtnfc/qml-qtnfc-ndeffilter.html
  5994. share/doc/qt5/qtnfc/qml-qtnfc-ndefmimerecord-members.html
  5995. share/doc/qt5/qtnfc/qml-qtnfc-ndefmimerecord.html
  5996. share/doc/qt5/qtnfc/qml-qtnfc-ndefrecord-members.html
  5997. share/doc/qt5/qtnfc/qml-qtnfc-ndefrecord.html
  5998. share/doc/qt5/qtnfc/qml-qtnfc-ndeftextrecord-members.html
  5999. share/doc/qt5/qtnfc/qml-qtnfc-ndeftextrecord.html
  6000. share/doc/qt5/qtnfc/qml-qtnfc-ndefurirecord-members.html
  6001. share/doc/qt5/qtnfc/qml-qtnfc-ndefurirecord.html
  6002. share/doc/qt5/qtnfc/qml-qtnfc-nearfield-members.html
  6003. share/doc/qt5/qtnfc/qml-qtnfc-nearfield.html
  6004. share/doc/qt5/qtnfc/qndeffilter-members.html
  6005. share/doc/qt5/qtnfc/qndeffilter-record-members.html
  6006. share/doc/qt5/qtnfc/qndeffilter-record.html
  6007. share/doc/qt5/qtnfc/qndeffilter.html
  6008. share/doc/qt5/qtnfc/qndefmessage-members.html
  6009. share/doc/qt5/qtnfc/qndefmessage.html
  6010. share/doc/qt5/qtnfc/qndefnfcsmartposterrecord-members.html
  6011. share/doc/qt5/qtnfc/qndefnfcsmartposterrecord.html
  6012. share/doc/qt5/qtnfc/qndefnfctextrecord-members.html
  6013. share/doc/qt5/qtnfc/qndefnfctextrecord.html
  6014. share/doc/qt5/qtnfc/qndefnfcurirecord-members.html
  6015. share/doc/qt5/qtnfc/qndefnfcurirecord.html
  6016. share/doc/qt5/qtnfc/qndefrecord-members.html
  6017. share/doc/qt5/qtnfc/qndefrecord.html
  6018. share/doc/qt5/qtnfc/qnearfieldmanager-members.html
  6019. share/doc/qt5/qtnfc/qnearfieldmanager.html
  6020. share/doc/qt5/qtnfc/qnearfieldsharemanager-members.html
  6021. share/doc/qt5/qtnfc/qnearfieldsharemanager.html
  6022. share/doc/qt5/qtnfc/qnearfieldsharetarget-members.html
  6023. share/doc/qt5/qtnfc/qnearfieldsharetarget.html
  6024. share/doc/qt5/qtnfc/qnearfieldtarget-members.html
  6025. share/doc/qt5/qtnfc/qnearfieldtarget-requestid-members.html
  6026. share/doc/qt5/qtnfc/qnearfieldtarget-requestid.html
  6027. share/doc/qt5/qtnfc/qnearfieldtarget-requestidprivate.html
  6028. share/doc/qt5/qtnfc/qnearfieldtarget.html
  6029. share/doc/qt5/qtnfc/qqmlndefrecord-members.html
  6030. share/doc/qt5/qtnfc/qqmlndefrecord.html
  6031. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-cpp.html
  6032. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-h.html
  6033. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-pro.html
  6034. share/doc/qt5/qtnfc/qtnfc-annotatedurl-example.html
  6035. share/doc/qt5/qtnfc/qtnfc-annotatedurl-main-cpp.html
  6036. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-cpp.html
  6037. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-h.html
  6038. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-ui.html
  6039. share/doc/qt5/qtnfc/qtnfc-corkboard-android-androidmanifest-xml.html
  6040. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboard-pro.html
  6041. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboard-qrc.html
  6042. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboards-qml.html
  6043. share/doc/qt5/qtnfc/qtnfc-corkboard-example.html
  6044. share/doc/qt5/qtnfc/qtnfc-corkboard-main-cpp.html
  6045. share/doc/qt5/qtnfc/qtnfc-corkboard-mode-qml.html
  6046. share/doc/qt5/qtnfc/qtnfc-index.html
  6047. share/doc/qt5/qtnfc/qtnfc-module.html
  6048. share/doc/qt5/qtnfc/qtnfc-ndefeditor-example.html
  6049. share/doc/qt5/qtnfc/qtnfc-ndefeditor-main-cpp.html
  6050. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-cpp.html
  6051. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-h.html
  6052. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-ui.html
  6053. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-cpp.html
  6054. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-h.html
  6055. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-ui.html
  6056. share/doc/qt5/qtnfc/qtnfc-ndefeditor-ndefeditor-pro.html
  6057. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-cpp.html
  6058. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-h.html
  6059. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-ui.html
  6060. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-cpp.html
  6061. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-h.html
  6062. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-ui.html
  6063. share/doc/qt5/qtnfc/qtnfc-overview.html
  6064. share/doc/qt5/qtnfc/qtnfc-poster-example.html
  6065. share/doc/qt5/qtnfc/qtnfc-poster-poster-pro.html
  6066. share/doc/qt5/qtnfc/qtnfc-poster-poster-qml.html
  6067. share/doc/qt5/qtnfc/qtnfc-poster-poster-qrc.html
  6068. share/doc/qt5/qtnfc/qtnfc-poster-qmlposter-cpp.html
  6069. share/doc/qt5/qtnfc/qtnfc-qmlmodule.html
  6070. share/doc/qt5/qtnfc/qtnfc.index
  6071. share/doc/qt5/qtnfc/qtnfc.qhp
  6072. share/doc/qt5/qtnfc/qtnfc.qhp.sha1
  6073. share/doc/qt5/qtnfc/qtnfc.tags
  6074. share/doc/qt5/qtnfc/style/offline-simple.css
  6075. share/doc/qt5/qtnfc/style/offline.css
  6076. share/doc/qt5/qtopengl.qch
  6077. share/doc/qt5/qtopengl/examples-manifest.xml
  6078. share/doc/qt5/qtopengl/examples-widgets-opengl.html
  6079. share/doc/qt5/qtopengl/images/2dpainting-example.png
  6080. share/doc/qt5/qtopengl/images/arrow_bc.png
  6081. share/doc/qt5/qtopengl/images/bgrContent.png
  6082. share/doc/qt5/qtopengl/images/btn_next.png
  6083. share/doc/qt5/qtopengl/images/btn_prev.png
  6084. share/doc/qt5/qtopengl/images/bullet_dn.png
  6085. share/doc/qt5/qtopengl/images/bullet_sq.png
  6086. share/doc/qt5/qtopengl/images/cube.png
  6087. share/doc/qt5/qtopengl/images/cube_faces.png
  6088. share/doc/qt5/qtopengl/images/hellogl2-example.png
  6089. share/doc/qt5/qtopengl/images/home.png
  6090. share/doc/qt5/qtopengl/images/ico_note.png
  6091. share/doc/qt5/qtopengl/images/ico_note_attention.png
  6092. share/doc/qt5/qtopengl/images/ico_out.png
  6093. share/doc/qt5/qtopengl/images/logo.png
  6094. share/doc/qt5/qtopengl/images/opengl-examples.png
  6095. share/doc/qt5/qtopengl/images/textures-example.png
  6096. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side1.png
  6097. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side2.png
  6098. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side3.png
  6099. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side4.png
  6100. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side5.png
  6101. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side6.png
  6102. share/doc/qt5/qtopengl/qgl.html
  6103. share/doc/qt5/qtopengl/qglbuffer-members.html
  6104. share/doc/qt5/qtopengl/qglbuffer.html
  6105. share/doc/qt5/qtopengl/qglcolormap-members.html
  6106. share/doc/qt5/qtopengl/qglcolormap.html
  6107. share/doc/qt5/qtopengl/qglcontext-members.html
  6108. share/doc/qt5/qtopengl/qglcontext-obsolete.html
  6109. share/doc/qt5/qtopengl/qglcontext.html
  6110. share/doc/qt5/qtopengl/qglformat-members.html
  6111. share/doc/qt5/qtopengl/qglformat.html
  6112. share/doc/qt5/qtopengl/qglframebufferobject-members.html
  6113. share/doc/qt5/qtopengl/qglframebufferobject.html
  6114. share/doc/qt5/qtopengl/qglframebufferobjectformat-members.html
  6115. share/doc/qt5/qtopengl/qglframebufferobjectformat.html
  6116. share/doc/qt5/qtopengl/qglfunctions-members.html
  6117. share/doc/qt5/qtopengl/qglfunctions.html
  6118. share/doc/qt5/qtopengl/qglpixelbuffer-members.html
  6119. share/doc/qt5/qtopengl/qglpixelbuffer.html
  6120. share/doc/qt5/qtopengl/qglshader-members.html
  6121. share/doc/qt5/qtopengl/qglshader.html
  6122. share/doc/qt5/qtopengl/qglshaderprogram-members.html
  6123. share/doc/qt5/qtopengl/qglshaderprogram.html
  6124. share/doc/qt5/qtopengl/qglwidget-members.html
  6125. share/doc/qt5/qtopengl/qglwidget-obsolete.html
  6126. share/doc/qt5/qtopengl/qglwidget.html
  6127. share/doc/qt5/qtopengl/qtopengl-2dpainting-2dpainting-pro.html
  6128. share/doc/qt5/qtopengl/qtopengl-2dpainting-example.html
  6129. share/doc/qt5/qtopengl/qtopengl-2dpainting-glwidget-cpp.html
  6130. share/doc/qt5/qtopengl/qtopengl-2dpainting-glwidget-h.html
  6131. share/doc/qt5/qtopengl/qtopengl-2dpainting-helper-cpp.html
  6132. share/doc/qt5/qtopengl/qtopengl-2dpainting-helper-h.html
  6133. share/doc/qt5/qtopengl/qtopengl-2dpainting-main-cpp.html
  6134. share/doc/qt5/qtopengl/qtopengl-2dpainting-widget-cpp.html
  6135. share/doc/qt5/qtopengl/qtopengl-2dpainting-widget-h.html
  6136. share/doc/qt5/qtopengl/qtopengl-2dpainting-window-cpp.html
  6137. share/doc/qt5/qtopengl/qtopengl-2dpainting-window-h.html
  6138. share/doc/qt5/qtopengl/qtopengl-cube-cube-pro.html
  6139. share/doc/qt5/qtopengl/qtopengl-cube-example.html
  6140. share/doc/qt5/qtopengl/qtopengl-cube-fshader-glsl.html
  6141. share/doc/qt5/qtopengl/qtopengl-cube-geometryengine-cpp.html
  6142. share/doc/qt5/qtopengl/qtopengl-cube-geometryengine-h.html
  6143. share/doc/qt5/qtopengl/qtopengl-cube-main-cpp.html
  6144. share/doc/qt5/qtopengl/qtopengl-cube-mainwidget-cpp.html
  6145. share/doc/qt5/qtopengl/qtopengl-cube-mainwidget-h.html
  6146. share/doc/qt5/qtopengl/qtopengl-cube-shaders-qrc.html
  6147. share/doc/qt5/qtopengl/qtopengl-cube-textures-qrc.html
  6148. share/doc/qt5/qtopengl/qtopengl-cube-vshader-glsl.html
  6149. share/doc/qt5/qtopengl/qtopengl-hellogl2-example.html
  6150. share/doc/qt5/qtopengl/qtopengl-hellogl2-glwidget-cpp.html
  6151. share/doc/qt5/qtopengl/qtopengl-hellogl2-glwidget-h.html
  6152. share/doc/qt5/qtopengl/qtopengl-hellogl2-hellogl2-pro.html
  6153. share/doc/qt5/qtopengl/qtopengl-hellogl2-logo-cpp.html
  6154. share/doc/qt5/qtopengl/qtopengl-hellogl2-logo-h.html
  6155. share/doc/qt5/qtopengl/qtopengl-hellogl2-main-cpp.html
  6156. share/doc/qt5/qtopengl/qtopengl-hellogl2-mainwindow-cpp.html
  6157. share/doc/qt5/qtopengl/qtopengl-hellogl2-mainwindow-h.html
  6158. share/doc/qt5/qtopengl/qtopengl-hellogl2-window-cpp.html
  6159. share/doc/qt5/qtopengl/qtopengl-hellogl2-window-h.html
  6160. share/doc/qt5/qtopengl/qtopengl-index.html
  6161. share/doc/qt5/qtopengl/qtopengl-module.html
  6162. share/doc/qt5/qtopengl/qtopengl-textures-example.html
  6163. share/doc/qt5/qtopengl/qtopengl-textures-glwidget-cpp.html
  6164. share/doc/qt5/qtopengl/qtopengl-textures-glwidget-h.html
  6165. share/doc/qt5/qtopengl/qtopengl-textures-main-cpp.html
  6166. share/doc/qt5/qtopengl/qtopengl-textures-textures-pro.html
  6167. share/doc/qt5/qtopengl/qtopengl-textures-textures-qrc.html
  6168. share/doc/qt5/qtopengl/qtopengl-textures-window-cpp.html
  6169. share/doc/qt5/qtopengl/qtopengl-textures-window-h.html
  6170. share/doc/qt5/qtopengl/qtopengl.index
  6171. share/doc/qt5/qtopengl/qtopengl.qhp
  6172. share/doc/qt5/qtopengl/qtopengl.qhp.sha1
  6173. share/doc/qt5/qtopengl/style/offline-simple.css
  6174. share/doc/qt5/qtopengl/style/offline.css
  6175. share/doc/qt5/qtplatformheaders.qch
  6176. share/doc/qt5/qtplatformheaders/images/arrow_bc.png
  6177. share/doc/qt5/qtplatformheaders/images/bgrContent.png
  6178. share/doc/qt5/qtplatformheaders/images/btn_next.png
  6179. share/doc/qt5/qtplatformheaders/images/btn_prev.png
  6180. share/doc/qt5/qtplatformheaders/images/bullet_dn.png
  6181. share/doc/qt5/qtplatformheaders/images/bullet_sq.png
  6182. share/doc/qt5/qtplatformheaders/images/home.png
  6183. share/doc/qt5/qtplatformheaders/images/ico_note.png
  6184. share/doc/qt5/qtplatformheaders/images/ico_note_attention.png
  6185. share/doc/qt5/qtplatformheaders/images/ico_out.png
  6186. share/doc/qt5/qtplatformheaders/images/logo.png
  6187. share/doc/qt5/qtplatformheaders/qcocoanativecontext-members.html
  6188. share/doc/qt5/qtplatformheaders/qcocoanativecontext.html
  6189. share/doc/qt5/qtplatformheaders/qcocoawindowfunctions-members.html
  6190. share/doc/qt5/qtplatformheaders/qcocoawindowfunctions.html
  6191. share/doc/qt5/qtplatformheaders/qeglfsfunctions-members.html
  6192. share/doc/qt5/qtplatformheaders/qeglfsfunctions.html
  6193. share/doc/qt5/qtplatformheaders/qeglnativecontext-members.html
  6194. share/doc/qt5/qtplatformheaders/qeglnativecontext.html
  6195. share/doc/qt5/qtplatformheaders/qglxnativecontext-members.html
  6196. share/doc/qt5/qtplatformheaders/qglxnativecontext.html
  6197. share/doc/qt5/qtplatformheaders/qtplatformheaders-index.html
  6198. share/doc/qt5/qtplatformheaders/qtplatformheaders-module.html
  6199. share/doc/qt5/qtplatformheaders/qtplatformheaders.index
  6200. share/doc/qt5/qtplatformheaders/qtplatformheaders.qhp
  6201. share/doc/qt5/qtplatformheaders/qtplatformheaders.qhp.sha1
  6202. share/doc/qt5/qtplatformheaders/qwglnativecontext-members.html
  6203. share/doc/qt5/qtplatformheaders/qwglnativecontext.html
  6204. share/doc/qt5/qtplatformheaders/qwindowswindowfunctions-members.html
  6205. share/doc/qt5/qtplatformheaders/qwindowswindowfunctions.html
  6206. share/doc/qt5/qtplatformheaders/qxcbwindowfunctions-members.html
  6207. share/doc/qt5/qtplatformheaders/qxcbwindowfunctions.html
  6208. share/doc/qt5/qtplatformheaders/style/offline-simple.css
  6209. share/doc/qt5/qtplatformheaders/style/offline.css
  6210. share/doc/qt5/qtpositioning.qch
  6211. share/doc/qt5/qtpositioning/examples-manifest.xml
  6212. share/doc/qt5/qtpositioning/images/arrow_bc.png
  6213. share/doc/qt5/qtpositioning/images/bgrContent.png
  6214. share/doc/qt5/qtpositioning/images/btn_next.png
  6215. share/doc/qt5/qtpositioning/images/btn_prev.png
  6216. share/doc/qt5/qtpositioning/images/bullet_dn.png
  6217. share/doc/qt5/qtpositioning/images/bullet_sq.png
  6218. share/doc/qt5/qtpositioning/images/example-satelliteinfo.png
  6219. share/doc/qt5/qtpositioning/images/example-weatherinfo.png
  6220. share/doc/qt5/qtpositioning/images/home.png
  6221. share/doc/qt5/qtpositioning/images/ico_note.png
  6222. share/doc/qt5/qtpositioning/images/ico_note_attention.png
  6223. share/doc/qt5/qtpositioning/images/ico_out.png
  6224. share/doc/qt5/qtpositioning/images/logo.png
  6225. share/doc/qt5/qtpositioning/images/qml-flickr-1.jpg
  6226. share/doc/qt5/qtpositioning/location-positioning-cpp.html
  6227. share/doc/qt5/qtpositioning/location-positioning-qml.html
  6228. share/doc/qt5/qtpositioning/positioning-cpp-qml.html
  6229. share/doc/qt5/qtpositioning/qgeoaddress-members.html
  6230. share/doc/qt5/qtpositioning/qgeoaddress.html
  6231. share/doc/qt5/qtpositioning/qgeoareamonitorinfo-members.html
  6232. share/doc/qt5/qtpositioning/qgeoareamonitorinfo.html
  6233. share/doc/qt5/qtpositioning/qgeoareamonitorsource-members.html
  6234. share/doc/qt5/qtpositioning/qgeoareamonitorsource.html
  6235. share/doc/qt5/qtpositioning/qgeocircle-members.html
  6236. share/doc/qt5/qtpositioning/qgeocircle.html
  6237. share/doc/qt5/qtpositioning/qgeocoordinate-members.html
  6238. share/doc/qt5/qtpositioning/qgeocoordinate.html
  6239. share/doc/qt5/qtpositioning/qgeolocation-members.html
  6240. share/doc/qt5/qtpositioning/qgeolocation.html
  6241. share/doc/qt5/qtpositioning/qgeopath-members.html
  6242. share/doc/qt5/qtpositioning/qgeopath.html
  6243. share/doc/qt5/qtpositioning/qgeopositioninfo-members.html
  6244. share/doc/qt5/qtpositioning/qgeopositioninfo.html
  6245. share/doc/qt5/qtpositioning/qgeopositioninfosource-members.html
  6246. share/doc/qt5/qtpositioning/qgeopositioninfosource.html
  6247. share/doc/qt5/qtpositioning/qgeopositioninfosourcefactory-members.html
  6248. share/doc/qt5/qtpositioning/qgeopositioninfosourcefactory.html
  6249. share/doc/qt5/qtpositioning/qgeorectangle-members.html
  6250. share/doc/qt5/qtpositioning/qgeorectangle.html
  6251. share/doc/qt5/qtpositioning/qgeosatelliteinfo-members.html
  6252. share/doc/qt5/qtpositioning/qgeosatelliteinfo.html
  6253. share/doc/qt5/qtpositioning/qgeosatelliteinfosource-members.html
  6254. share/doc/qt5/qtpositioning/qgeosatelliteinfosource.html
  6255. share/doc/qt5/qtpositioning/qgeoshape-members.html
  6256. share/doc/qt5/qtpositioning/qgeoshape-obsolete.html
  6257. share/doc/qt5/qtpositioning/qgeoshape.html
  6258. share/doc/qt5/qtpositioning/qml-coordinate.html
  6259. share/doc/qt5/qtpositioning/qml-geocircle.html
  6260. share/doc/qt5/qtpositioning/qml-geopath.html
  6261. share/doc/qt5/qtpositioning/qml-georectangle.html
  6262. share/doc/qt5/qtpositioning/qml-geoshape.html
  6263. share/doc/qt5/qtpositioning/qml-qtpositioning-address-members.html
  6264. share/doc/qt5/qtpositioning/qml-qtpositioning-address.html
  6265. share/doc/qt5/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
  6266. share/doc/qt5/qtpositioning/qml-qtpositioning-coordinateanimation.html
  6267. share/doc/qt5/qtpositioning/qml-qtpositioning-location-members.html
  6268. share/doc/qt5/qtpositioning/qml-qtpositioning-location.html
  6269. share/doc/qt5/qtpositioning/qml-qtpositioning-position-members.html
  6270. share/doc/qt5/qtpositioning/qml-qtpositioning-position.html
  6271. share/doc/qt5/qtpositioning/qml-qtpositioning-positionsource-members.html
  6272. share/doc/qt5/qtpositioning/qml-qtpositioning-positionsource.html
  6273. share/doc/qt5/qtpositioning/qml-qtpositioning-qtpositioning-members.html
  6274. share/doc/qt5/qtpositioning/qml-qtpositioning-qtpositioning.html
  6275. share/doc/qt5/qtpositioning/qnmeapositioninfosource-members.html
  6276. share/doc/qt5/qtpositioning/qnmeapositioninfosource.html
  6277. share/doc/qt5/qtpositioning/qtpositioning-examples.html
  6278. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-example.html
  6279. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-90-qml.html
  6280. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-qml.html
  6281. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-qrc.html
  6282. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-progress-qml.html
  6283. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-restmodel-qml.html
  6284. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-scrollbar-qml.html
  6285. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-slider-qml.html
  6286. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-button-qml.html
  6287. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-geotab-qml.html
  6288. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-griddelegate-qml.html
  6289. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-imagedetails-qml.html
  6290. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-listdelegate-qml.html
  6291. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-titlebar-qml.html
  6292. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-toolbar-qml.html
  6293. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-geoflickr-pro.html
  6294. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-geoflickr-qmlproject.html
  6295. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-qmllocationflickr-cpp.html
  6296. share/doc/qt5/qtpositioning/qtpositioning-index.html
  6297. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-cpp.html
  6298. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-h.html
  6299. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-example.html
  6300. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfile-qrc.html
  6301. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-cpp.html
  6302. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-h.html
  6303. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-pro.html
  6304. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-main-cpp.html
  6305. share/doc/qt5/qtpositioning/qtpositioning-module.html
  6306. share/doc/qt5/qtpositioning/qtpositioning-plugins.html
  6307. share/doc/qt5/qtpositioning/qtpositioning-qmlmodule.html
  6308. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-example.html
  6309. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-main-cpp.html
  6310. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-pro.html
  6311. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qml.html
  6312. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qrc.html
  6313. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-cpp.html
  6314. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-h.html
  6315. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-appmodel-cpp.html
  6316. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-appmodel-h.html
  6317. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-bigforecasticon-qml.html
  6318. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-forecasticon-qml.html
  6319. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-weathericon-qml.html
  6320. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-example.html
  6321. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-main-cpp.html
  6322. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-pro.html
  6323. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qml.html
  6324. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qrc.html
  6325. share/doc/qt5/qtpositioning/qtpositioning.index
  6326. share/doc/qt5/qtpositioning/qtpositioning.qhp
  6327. share/doc/qt5/qtpositioning/qtpositioning.qhp.sha1
  6328. share/doc/qt5/qtpositioning/qtpositioning.tags
  6329. share/doc/qt5/qtpositioning/style/offline-simple.css
  6330. share/doc/qt5/qtpositioning/style/offline.css
  6331. share/doc/qt5/qtprintsupport.qch
  6332. share/doc/qt5/qtprintsupport/images/arrow_bc.png
  6333. share/doc/qt5/qtprintsupport/images/bgrContent.png
  6334. share/doc/qt5/qtprintsupport/images/btn_next.png
  6335. share/doc/qt5/qtprintsupport/images/btn_prev.png
  6336. share/doc/qt5/qtprintsupport/images/bullet_dn.png
  6337. share/doc/qt5/qtprintsupport/images/bullet_sq.png
  6338. share/doc/qt5/qtprintsupport/images/home.png
  6339. share/doc/qt5/qtprintsupport/images/ico_note.png
  6340. share/doc/qt5/qtprintsupport/images/ico_note_attention.png
  6341. share/doc/qt5/qtprintsupport/images/ico_out.png
  6342. share/doc/qt5/qtprintsupport/images/logo.png
  6343. share/doc/qt5/qtprintsupport/images/plastique-printdialog-properties.png
  6344. share/doc/qt5/qtprintsupport/images/plastique-printdialog.png
  6345. share/doc/qt5/qtprintsupport/images/printer-rects.png
  6346. share/doc/qt5/qtprintsupport/pdf-licensing.html
  6347. share/doc/qt5/qtprintsupport/printing.html
  6348. share/doc/qt5/qtprintsupport/qabstractprintdialog-members.html
  6349. share/doc/qt5/qtprintsupport/qabstractprintdialog-obsolete.html
  6350. share/doc/qt5/qtprintsupport/qabstractprintdialog.html
  6351. share/doc/qt5/qtprintsupport/qpagesetupdialog-members.html
  6352. share/doc/qt5/qtprintsupport/qpagesetupdialog.html
  6353. share/doc/qt5/qtprintsupport/qprintdialog-members.html
  6354. share/doc/qt5/qtprintsupport/qprintdialog.html
  6355. share/doc/qt5/qtprintsupport/qprintengine-members.html
  6356. share/doc/qt5/qtprintsupport/qprintengine.html
  6357. share/doc/qt5/qtprintsupport/qprinter-members.html
  6358. share/doc/qt5/qtprintsupport/qprinter-obsolete.html
  6359. share/doc/qt5/qtprintsupport/qprinter.html
  6360. share/doc/qt5/qtprintsupport/qprinterinfo-members.html
  6361. share/doc/qt5/qtprintsupport/qprinterinfo-obsolete.html
  6362. share/doc/qt5/qtprintsupport/qprinterinfo.html
  6363. share/doc/qt5/qtprintsupport/qprintpreviewdialog-members.html
  6364. share/doc/qt5/qtprintsupport/qprintpreviewdialog.html
  6365. share/doc/qt5/qtprintsupport/qprintpreviewwidget-members.html
  6366. share/doc/qt5/qtprintsupport/qprintpreviewwidget.html
  6367. share/doc/qt5/qtprintsupport/qtprintsupport-index.html
  6368. share/doc/qt5/qtprintsupport/qtprintsupport-module.html
  6369. share/doc/qt5/qtprintsupport/qtprintsupport.index
  6370. share/doc/qt5/qtprintsupport/qtprintsupport.qhp
  6371. share/doc/qt5/qtprintsupport/qtprintsupport.qhp.sha1
  6372. share/doc/qt5/qtprintsupport/qtprintsupport.tags
  6373. share/doc/qt5/qtprintsupport/style/offline-simple.css
  6374. share/doc/qt5/qtprintsupport/style/offline.css
  6375. share/doc/qt5/qtqml.qch
  6376. share/doc/qt5/qtqml/examples-manifest.xml
  6377. share/doc/qt5/qtqml/images/arrow_bc.png
  6378. share/doc/qt5/qtqml/images/bgrContent.png
  6379. share/doc/qt5/qtqml/images/btn_next.png
  6380. share/doc/qt5/qtqml/images/btn_prev.png
  6381. share/doc/qt5/qtqml/images/bullet_dn.png
  6382. share/doc/qt5/qtqml/images/bullet_sq.png
  6383. share/doc/qt5/qtqml/images/button-types.png
  6384. share/doc/qt5/qtqml/images/cppintegration-ex.png
  6385. share/doc/qt5/qtqml/images/declarative-rect_tint.png
  6386. share/doc/qt5/qtqml/images/documents-definetypes-attributes.png
  6387. share/doc/qt5/qtqml/images/documents-definetypes-simple.png
  6388. share/doc/qt5/qtqml/images/extending-tutorial-chapter1.png
  6389. share/doc/qt5/qtqml/images/extending-tutorial-chapter2.png
  6390. share/doc/qt5/qtqml/images/extending-tutorial-chapter3.png
  6391. share/doc/qt5/qtqml/images/extending-tutorial-chapter5.png
  6392. share/doc/qt5/qtqml/images/home.png
  6393. share/doc/qt5/qtqml/images/ico_note.png
  6394. share/doc/qt5/qtqml/images/ico_note_attention.png
  6395. share/doc/qt5/qtqml/images/ico_out.png
  6396. share/doc/qt5/qtqml/images/listmodel-nested.png
  6397. share/doc/qt5/qtqml/images/listmodel.png
  6398. share/doc/qt5/qtqml/images/logo.png
  6399. share/doc/qt5/qtqml/images/qml-dynamicscene-example.png
  6400. share/doc/qt5/qtqml/images/qml-i18n-example.png
  6401. share/doc/qt5/qtqml/images/qml-plugins-example.png
  6402. share/doc/qt5/qtqml/images/qml-xmlhttprequest-example.png
  6403. share/doc/qt5/qtqml/images/qtqml-syntax-basics-object-declaration.png
  6404. share/doc/qt5/qtqml/images/statemachine-button-history.png
  6405. share/doc/qt5/qtqml/images/statemachine-button-nested.png
  6406. share/doc/qt5/qtqml/images/statemachine-button.png
  6407. share/doc/qt5/qtqml/images/statemachine-finished.png
  6408. share/doc/qt5/qtqml/images/statemachine-nonparallel.png
  6409. share/doc/qt5/qtqml/images/statemachine-parallel.png
  6410. share/doc/qt5/qtqml/images/visualitemmodel.png
  6411. share/doc/qt5/qtqml/qjsengine-members.html
  6412. share/doc/qt5/qtqml/qjsengine-obsolete.html
  6413. share/doc/qt5/qtqml/qjsengine.html
  6414. share/doc/qt5/qtqml/qjsvalue-members.html
  6415. share/doc/qt5/qtqml/qjsvalue-obsolete.html
  6416. share/doc/qt5/qtqml/qjsvalue.html
  6417. share/doc/qt5/qtqml/qjsvalueiterator-members.html
  6418. share/doc/qt5/qtqml/qjsvalueiterator.html
  6419. share/doc/qt5/qtqml/qml-bool.html
  6420. share/doc/qt5/qtqml/qml-date.html
  6421. share/doc/qt5/qtqml/qml-double.html
  6422. share/doc/qt5/qtqml/qml-enumeration.html
  6423. share/doc/qt5/qtqml/qml-int.html
  6424. share/doc/qt5/qtqml/qml-list.html
  6425. share/doc/qt5/qtqml/qml-package-members.html
  6426. share/doc/qt5/qtqml/qml-package.html
  6427. share/doc/qt5/qtqml/qml-point.html
  6428. share/doc/qt5/qtqml/qml-qtqml-binding-members.html
  6429. share/doc/qt5/qtqml/qml-qtqml-binding.html
  6430. share/doc/qt5/qtqml/qml-qtqml-component-members.html
  6431. share/doc/qt5/qtqml/qml-qtqml-component.html
  6432. share/doc/qt5/qtqml/qml-qtqml-connections-members.html
  6433. share/doc/qt5/qtqml/qml-qtqml-connections.html
  6434. share/doc/qt5/qtqml/qml-qtqml-date-members.html
  6435. share/doc/qt5/qtqml/qml-qtqml-date.html
  6436. share/doc/qt5/qtqml/qml-qtqml-instantiator-members.html
  6437. share/doc/qt5/qtqml/qml-qtqml-instantiator.html
  6438. share/doc/qt5/qtqml/qml-qtqml-locale-members.html
  6439. share/doc/qt5/qtqml/qml-qtqml-locale.html
  6440. share/doc/qt5/qtqml/qml-qtqml-loggingcategory-members.html
  6441. share/doc/qt5/qtqml/qml-qtqml-loggingcategory.html
  6442. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodel-members.html
  6443. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodel.html
  6444. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodelgroup-members.html
  6445. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodelgroup.html
  6446. share/doc/qt5/qtqml/qml-qtqml-models-itemselectionmodel-members.html
  6447. share/doc/qt5/qtqml/qml-qtqml-models-itemselectionmodel.html
  6448. share/doc/qt5/qtqml/qml-qtqml-models-listelement-members.html
  6449. share/doc/qt5/qtqml/qml-qtqml-models-listelement.html
  6450. share/doc/qt5/qtqml/qml-qtqml-models-listmodel-members.html
  6451. share/doc/qt5/qtqml/qml-qtqml-models-listmodel.html
  6452. share/doc/qt5/qtqml/qml-qtqml-models-objectmodel-members.html
  6453. share/doc/qt5/qtqml/qml-qtqml-models-objectmodel.html
  6454. share/doc/qt5/qtqml/qml-qtqml-number-members.html
  6455. share/doc/qt5/qtqml/qml-qtqml-number.html
  6456. share/doc/qt5/qtqml/qml-qtqml-qt-members.html
  6457. share/doc/qt5/qtqml/qml-qtqml-qt.html
  6458. share/doc/qt5/qtqml/qml-qtqml-qtobject-members.html
  6459. share/doc/qt5/qtqml/qml-qtqml-qtobject.html
  6460. share/doc/qt5/qtqml/qml-qtqml-statemachine-finalstate-members.html
  6461. share/doc/qt5/qtqml/qml-qtqml-statemachine-finalstate.html
  6462. share/doc/qt5/qtqml/qml-qtqml-statemachine-historystate-members.html
  6463. share/doc/qt5/qtqml/qml-qtqml-statemachine-historystate.html
  6464. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstractstate-members.html
  6465. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstractstate.html
  6466. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstracttransition-members.html
  6467. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstracttransition.html
  6468. share/doc/qt5/qtqml/qml-qtqml-statemachine-qsignaltransition-members.html
  6469. share/doc/qt5/qtqml/qml-qtqml-statemachine-qsignaltransition.html
  6470. share/doc/qt5/qtqml/qml-qtqml-statemachine-signaltransition-members.html
  6471. share/doc/qt5/qtqml/qml-qtqml-statemachine-signaltransition.html
  6472. share/doc/qt5/qtqml/qml-qtqml-statemachine-state-members.html
  6473. share/doc/qt5/qtqml/qml-qtqml-statemachine-state.html
  6474. share/doc/qt5/qtqml/qml-qtqml-statemachine-statemachine-members.html
  6475. share/doc/qt5/qtqml/qml-qtqml-statemachine-statemachine.html
  6476. share/doc/qt5/qtqml/qml-qtqml-statemachine-timeouttransition-members.html
  6477. share/doc/qt5/qtqml/qml-qtqml-statemachine-timeouttransition.html
  6478. share/doc/qt5/qtqml/qml-qtqml-string-members.html
  6479. share/doc/qt5/qtqml/qml-qtqml-string.html
  6480. share/doc/qt5/qtqml/qml-qtqml-timer-members.html
  6481. share/doc/qt5/qtqml/qml-qtqml-timer.html
  6482. share/doc/qt5/qtqml/qml-real.html
  6483. share/doc/qt5/qtqml/qml-rect.html
  6484. share/doc/qt5/qtqml/qml-size.html
  6485. share/doc/qt5/qtqml/qml-string.html
  6486. share/doc/qt5/qtqml/qml-url.html
  6487. share/doc/qt5/qtqml/qml-var.html
  6488. share/doc/qt5/qtqml/qml-variant.html
  6489. share/doc/qt5/qtqml/qml-visualdatagroup-members.html
  6490. share/doc/qt5/qtqml/qml-visualdatagroup.html
  6491. share/doc/qt5/qtqml/qml-visualdatamodel-members.html
  6492. share/doc/qt5/qtqml/qml-visualdatamodel.html
  6493. share/doc/qt5/qtqml/qml-visualitemmodel-members.html
  6494. share/doc/qt5/qtqml/qml-visualitemmodel.html
  6495. share/doc/qt5/qtqml/qml-workerscript-members.html
  6496. share/doc/qt5/qtqml/qml-workerscript.html
  6497. share/doc/qt5/qtqml/qmlextendingexamples.html
  6498. share/doc/qt5/qtqml/qmlreference.html
  6499. share/doc/qt5/qtqml/qmlstatemachine.html
  6500. share/doc/qt5/qtqml/qmodelindex-and-related-classes-in-qml.html
  6501. share/doc/qt5/qtqml/qqmlabstracturlinterceptor-members.html
  6502. share/doc/qt5/qtqml/qqmlabstracturlinterceptor.html
  6503. share/doc/qt5/qtqml/qqmlapplicationengine-members.html
  6504. share/doc/qt5/qtqml/qqmlapplicationengine.html
  6505. share/doc/qt5/qtqml/qqmlcomponent-members.html
  6506. share/doc/qt5/qtqml/qqmlcomponent.html
  6507. share/doc/qt5/qtqml/qqmlcontext-members.html
  6508. share/doc/qt5/qtqml/qqmlcontext.html
  6509. share/doc/qt5/qtqml/qqmlengine-members.html
  6510. share/doc/qt5/qtqml/qqmlengine.html
  6511. share/doc/qt5/qtqml/qqmlerror-members.html
  6512. share/doc/qt5/qtqml/qqmlerror.html
  6513. share/doc/qt5/qtqml/qqmlexpression-members.html
  6514. share/doc/qt5/qtqml/qqmlexpression.html
  6515. share/doc/qt5/qtqml/qqmlextensionplugin-members.html
  6516. share/doc/qt5/qtqml/qqmlextensionplugin.html
  6517. share/doc/qt5/qtqml/qqmlfileselector-members.html
  6518. share/doc/qt5/qtqml/qqmlfileselector.html
  6519. share/doc/qt5/qtqml/qqmlimageproviderbase-members.html
  6520. share/doc/qt5/qtqml/qqmlimageproviderbase.html
  6521. share/doc/qt5/qtqml/qqmlincubationcontroller-members.html
  6522. share/doc/qt5/qtqml/qqmlincubationcontroller.html
  6523. share/doc/qt5/qtqml/qqmlincubator-members.html
  6524. share/doc/qt5/qtqml/qqmlincubator.html
  6525. share/doc/qt5/qtqml/qqmllistproperty-members.html
  6526. share/doc/qt5/qtqml/qqmllistproperty.html
  6527. share/doc/qt5/qtqml/qqmllistreference-members.html
  6528. share/doc/qt5/qtqml/qqmllistreference.html
  6529. share/doc/qt5/qtqml/qqmlnetworkaccessmanagerfactory-members.html
  6530. share/doc/qt5/qtqml/qqmlnetworkaccessmanagerfactory.html
  6531. share/doc/qt5/qtqml/qqmlparserstatus-members.html
  6532. share/doc/qt5/qtqml/qqmlparserstatus.html
  6533. share/doc/qt5/qtqml/qqmlproperty-members.html
  6534. share/doc/qt5/qtqml/qqmlproperty.html
  6535. share/doc/qt5/qtqml/qqmlpropertymap-members.html
  6536. share/doc/qt5/qtqml/qqmlpropertymap.html
  6537. share/doc/qt5/qtqml/qqmlpropertyvaluesource-members.html
  6538. share/doc/qt5/qtqml/qqmlpropertyvaluesource.html
  6539. share/doc/qt5/qtqml/qqmlscriptstring-members.html
  6540. share/doc/qt5/qtqml/qqmlscriptstring.html
  6541. share/doc/qt5/qtqml/qtjavascript.html
  6542. share/doc/qt5/qtqml/qtqml-attribution-masm.html
  6543. share/doc/qt5/qtqml/qtqml-cppclasses-topic.html
  6544. share/doc/qt5/qtqml/qtqml-cppintegration-contextproperties.html
  6545. share/doc/qt5/qtqml/qtqml-cppintegration-data.html
  6546. share/doc/qt5/qtqml/qtqml-cppintegration-definetypes.html
  6547. share/doc/qt5/qtqml/qtqml-cppintegration-exposecppattributes.html
  6548. share/doc/qt5/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
  6549. share/doc/qt5/qtqml/qtqml-cppintegration-overview.html
  6550. share/doc/qt5/qtqml/qtqml-cppintegration-topic.html
  6551. share/doc/qt5/qtqml/qtqml-documents-definetypes.html
  6552. share/doc/qt5/qtqml/qtqml-documents-networktransparency.html
  6553. share/doc/qt5/qtqml/qtqml-documents-scope.html
  6554. share/doc/qt5/qtqml/qtqml-documents-structure.html
  6555. share/doc/qt5/qtqml/qtqml-documents-topic.html
  6556. share/doc/qt5/qtqml/qtqml-dynamicscene-content-button-qml.html
  6557. share/doc/qt5/qtqml/qtqml-dynamicscene-content-genericsceneitem-qml.html
  6558. share/doc/qt5/qtqml/qtqml-dynamicscene-content-itemcreation-js.html
  6559. share/doc/qt5/qtqml/qtqml-dynamicscene-content-paletteitem-qml.html
  6560. share/doc/qt5/qtqml/qtqml-dynamicscene-content-perspectiveitem-qml.html
  6561. share/doc/qt5/qtqml/qtqml-dynamicscene-content-sun-qml.html
  6562. share/doc/qt5/qtqml/qtqml-dynamicscene-dynamicscene-qml.html
  6563. share/doc/qt5/qtqml/qtqml-dynamicscene-dynamicscene-qmlproject.html
  6564. share/doc/qt5/qtqml/qtqml-dynamicscene-example.html
  6565. share/doc/qt5/qtqml/qtqml-index.html
  6566. share/doc/qt5/qtqml/qtqml-javascript-dynamicobjectcreation.html
  6567. share/doc/qt5/qtqml/qtqml-javascript-expressions.html
  6568. share/doc/qt5/qtqml/qtqml-javascript-functionlist.html
  6569. share/doc/qt5/qtqml/qtqml-javascript-hostenvironment.html
  6570. share/doc/qt5/qtqml/qtqml-javascript-imports.html
  6571. share/doc/qt5/qtqml/qtqml-javascript-qmlglobalobject.html
  6572. share/doc/qt5/qtqml/qtqml-javascript-resources.html
  6573. share/doc/qt5/qtqml/qtqml-javascript-topic.html
  6574. share/doc/qt5/qtqml/qtqml-models-qmlmodule.html
  6575. share/doc/qt5/qtqml/qtqml-module.html
  6576. share/doc/qt5/qtqml/qtqml-modules-cppplugins.html
  6577. share/doc/qt5/qtqml/qtqml-modules-identifiedmodules.html
  6578. share/doc/qt5/qtqml/qtqml-modules-legacymodules.html
  6579. share/doc/qt5/qtqml/qtqml-modules-qmldir.html
  6580. share/doc/qt5/qtqml/qtqml-modules-topic.html
  6581. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-example.html
  6582. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-main-cpp.html
  6583. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-pro.html
  6584. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qmlproject.html
  6585. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qrc.html
  6586. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-view-qml.html
  6587. share/doc/qt5/qtqml/qtqml-qml-i18n-example.html
  6588. share/doc/qt5/qtqml/qtqml-qml-i18n-qml-i18n-qml.html
  6589. share/doc/qt5/qtqml/qtqml-qml-i18n-qml-i18n-qmlproject.html
  6590. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-example.html
  6591. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-imports-timeexample-clock-qml.html
  6592. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-imports-timeexample-qmldir.html
  6593. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugin-cpp.html
  6594. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugins-qml.html
  6595. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugins-qmlproject.html
  6596. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-qmlextensionplugins-pro.html
  6597. share/doc/qt5/qtqml/qtqml-qmlmodule.html
  6598. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-adding-pro.html
  6599. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-adding-qrc.html
  6600. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-example-qml.html
  6601. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-example.html
  6602. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-main-cpp.html
  6603. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-person-cpp.html
  6604. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-person-h.html
  6605. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-attached-pro.html
  6606. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-attached-qrc.html
  6607. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-birthdayparty-cpp.html
  6608. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-birthdayparty-h.html
  6609. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-example-qml.html
  6610. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-example.html
  6611. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-main-cpp.html
  6612. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-person-cpp.html
  6613. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-person-h.html
  6614. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-binding-pro.html
  6615. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-binding-qrc.html
  6616. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-birthdayparty-cpp.html
  6617. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-birthdayparty-h.html
  6618. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-example-qml.html
  6619. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-example.html
  6620. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-cpp.html
  6621. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-h.html
  6622. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-main-cpp.html
  6623. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-person-cpp.html
  6624. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-person-h.html
  6625. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-birthdayparty-cpp.html
  6626. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-birthdayparty-h.html
  6627. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-coercion-pro.html
  6628. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-coercion-qrc.html
  6629. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-example-qml.html
  6630. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-example.html
  6631. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-main-cpp.html
  6632. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-person-cpp.html
  6633. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-person-h.html
  6634. share/doc/qt5/qtqml/qtqml-referenceexamples-default-birthdayparty-cpp.html
  6635. share/doc/qt5/qtqml/qtqml-referenceexamples-default-birthdayparty-h.html
  6636. share/doc/qt5/qtqml/qtqml-referenceexamples-default-default-pro.html
  6637. share/doc/qt5/qtqml/qtqml-referenceexamples-default-default-qrc.html
  6638. share/doc/qt5/qtqml/qtqml-referenceexamples-default-example-qml.html
  6639. share/doc/qt5/qtqml/qtqml-referenceexamples-default-example.html
  6640. share/doc/qt5/qtqml/qtqml-referenceexamples-default-main-cpp.html
  6641. share/doc/qt5/qtqml/qtqml-referenceexamples-default-person-cpp.html
  6642. share/doc/qt5/qtqml/qtqml-referenceexamples-default-person-h.html
  6643. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-example-qml.html
  6644. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-example.html
  6645. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-extended-pro.html
  6646. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-extended-qrc.html
  6647. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-lineedit-cpp.html
  6648. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-lineedit-h.html
  6649. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-main-cpp.html
  6650. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-birthdayparty-cpp.html
  6651. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-birthdayparty-h.html
  6652. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-example-qml.html
  6653. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-example.html
  6654. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-grouped-pro.html
  6655. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-grouped-qrc.html
  6656. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-main-cpp.html
  6657. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-person-cpp.html
  6658. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-person-h.html
  6659. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-birthdayparty-cpp.html
  6660. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-birthdayparty-h.html
  6661. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-example-qml.html
  6662. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-example.html
  6663. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-main-cpp.html
  6664. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-methods-pro.html
  6665. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-methods-qrc.html
  6666. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-person-cpp.html
  6667. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-person-h.html
  6668. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-birthdayparty-cpp.html
  6669. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-birthdayparty-h.html
  6670. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-example-qml.html
  6671. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-example.html
  6672. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-main-cpp.html
  6673. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-person-cpp.html
  6674. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-person-h.html
  6675. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-properties-pro.html
  6676. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-properties-qrc.html
  6677. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-birthdayparty-cpp.html
  6678. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-birthdayparty-h.html
  6679. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-example-qml.html
  6680. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-example.html
  6681. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-main-cpp.html
  6682. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-person-cpp.html
  6683. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-person-h.html
  6684. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-signal-pro.html
  6685. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-signal-qrc.html
  6686. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-cpp.html
  6687. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-h.html
  6688. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-example-qml.html
  6689. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-example.html
  6690. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-cpp.html
  6691. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-h.html
  6692. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-main-cpp.html
  6693. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-person-cpp.html
  6694. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-person-h.html
  6695. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-valuesource-pro.html
  6696. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-valuesource-qrc.html
  6697. share/doc/qt5/qtqml/qtqml-statemachine-qmlmodule.html
  6698. share/doc/qt5/qtqml/qtqml-syntax-basics.html
  6699. share/doc/qt5/qtqml/qtqml-syntax-directoryimports.html
  6700. share/doc/qt5/qtqml/qtqml-syntax-imports.html
  6701. share/doc/qt5/qtqml/qtqml-syntax-objectattributes.html
  6702. share/doc/qt5/qtqml/qtqml-syntax-propertybinding.html
  6703. share/doc/qt5/qtqml/qtqml-syntax-signals.html
  6704. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-app-qml.html
  6705. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-pro.html
  6706. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-qrc.html
  6707. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-main-cpp.html
  6708. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-cpp.html
  6709. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-h.html
  6710. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-app-qml.html
  6711. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-pro.html
  6712. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-qrc.html
  6713. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-cpp.html
  6714. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-h.html
  6715. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-app-qml.html
  6716. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-pro.html
  6717. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-qrc.html
  6718. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-cpp.html
  6719. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-h.html
  6720. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-app-qml.html
  6721. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-pro.html
  6722. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-qrc.html
  6723. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-cpp.html
  6724. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-h.html
  6725. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-cpp.html
  6726. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-h.html
  6727. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-app-qml.html
  6728. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-pro.html
  6729. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-qrc.html
  6730. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-cpp.html
  6731. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-h.html
  6732. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-cpp.html
  6733. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-h.html
  6734. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-pro.html
  6735. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qml.html
  6736. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qrc.html
  6737. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-chapter6-plugins-pro.html
  6738. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-cpp.html
  6739. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-h.html
  6740. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-import-pro.html
  6741. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-cpp.html
  6742. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-h.html
  6743. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-cpp.html
  6744. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-h.html
  6745. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-qmldir.html
  6746. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-example.html
  6747. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-extending-qml-pro.html
  6748. share/doc/qt5/qtqml/qtqml-typesystem-basictypes.html
  6749. share/doc/qt5/qtqml/qtqml-typesystem-objecttypes.html
  6750. share/doc/qt5/qtqml/qtqml-typesystem-topic.html
  6751. share/doc/qt5/qtqml/qtqml-xmlhttprequest-data-xml.html
  6752. share/doc/qt5/qtqml/qtqml-xmlhttprequest-example.html
  6753. share/doc/qt5/qtqml/qtqml-xmlhttprequest-get-qml.html
  6754. share/doc/qt5/qtqml/qtqml-xmlhttprequest-getform-ui-qml.html
  6755. share/doc/qt5/qtqml/qtqml-xmlhttprequest-main-cpp.html
  6756. share/doc/qt5/qtqml/qtqml-xmlhttprequest-methods-js.html
  6757. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-pro.html
  6758. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qml.html
  6759. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qmlproject.html
  6760. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qrc.html
  6761. share/doc/qt5/qtqml/qtqml.index
  6762. share/doc/qt5/qtqml/qtqml.qhp
  6763. share/doc/qt5/qtqml/qtqml.qhp.sha1
  6764. share/doc/qt5/qtqml/qtqml.tags
  6765. share/doc/qt5/qtqml/style/offline-simple.css
  6766. share/doc/qt5/qtqml/style/offline.css
  6767. share/doc/qt5/qtquick.qch
  6768. share/doc/qt5/qtquick/demos-manifest.xml
  6769. share/doc/qt5/qtquick/examples-manifest.xml
  6770. share/doc/qt5/qtquick/images/3d-rotation-axis.png
  6771. share/doc/qt5/qtquick/images/ListViewHorizontal.png
  6772. share/doc/qt5/qtquick/images/anchor_ordering.png
  6773. share/doc/qt5/qtquick/images/anchor_ordering_bad.png
  6774. share/doc/qt5/qtquick/images/anchorchanges.png
  6775. share/doc/qt5/qtquick/images/animatedimageitem.gif
  6776. share/doc/qt5/qtquick/images/arrow_bc.png
  6777. share/doc/qt5/qtquick/images/axisrotation.png
  6778. share/doc/qt5/qtquick/images/bgrContent.png
  6779. share/doc/qt5/qtquick/images/btn_next.png
  6780. share/doc/qt5/qtquick/images/btn_prev.png
  6781. share/doc/qt5/qtquick/images/bullet_dn.png
  6782. share/doc/qt5/qtquick/images/bullet_sq.png
  6783. share/doc/qt5/qtquick/images/columnlayout.png
  6784. share/doc/qt5/qtquick/images/custom-geometry-example.png
  6785. share/doc/qt5/qtquick/images/declarative-adv-tutorial1.png
  6786. share/doc/qt5/qtquick/images/declarative-adv-tutorial2.png
  6787. share/doc/qt5/qtquick/images/declarative-adv-tutorial3.png
  6788. share/doc/qt5/qtquick/images/declarative-adv-tutorial4.gif
  6789. share/doc/qt5/qtquick/images/declarative-anchors_example.png
  6790. share/doc/qt5/qtquick/images/declarative-anchors_example2.png
  6791. share/doc/qt5/qtquick/images/declarative-arcdirection.png
  6792. share/doc/qt5/qtquick/images/declarative-arcradius.png
  6793. share/doc/qt5/qtquick/images/declarative-colors.png
  6794. share/doc/qt5/qtquick/images/declarative-gridmesh.png
  6795. share/doc/qt5/qtquick/images/declarative-item_opacity1.png
  6796. share/doc/qt5/qtquick/images/declarative-item_opacity2.png
  6797. share/doc/qt5/qtquick/images/declarative-item_stacking1.png
  6798. share/doc/qt5/qtquick/images/declarative-item_stacking2.png
  6799. share/doc/qt5/qtquick/images/declarative-item_stacking3.png
  6800. share/doc/qt5/qtquick/images/declarative-item_stacking4.png
  6801. share/doc/qt5/qtquick/images/declarative-largearc.png
  6802. share/doc/qt5/qtquick/images/declarative-nopercent.png
  6803. share/doc/qt5/qtquick/images/declarative-patharc.png
  6804. share/doc/qt5/qtquick/images/declarative-pathattribute.png
  6805. share/doc/qt5/qtquick/images/declarative-pathcubic.png
  6806. share/doc/qt5/qtquick/images/declarative-pathcurve.png
  6807. share/doc/qt5/qtquick/images/declarative-pathquad.png
  6808. share/doc/qt5/qtquick/images/declarative-pathsvg.png
  6809. share/doc/qt5/qtquick/images/declarative-percent.png
  6810. share/doc/qt5/qtquick/images/declarative-qmlfocus1.png
  6811. share/doc/qt5/qtquick/images/declarative-qmlfocus2.png
  6812. share/doc/qt5/qtquick/images/declarative-qmlfocus3.png
  6813. share/doc/qt5/qtquick/images/declarative-qmlfocus4.png
  6814. share/doc/qt5/qtquick/images/declarative-qmlfocus5.png
  6815. share/doc/qt5/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
  6816. share/doc/qt5/qtquick/images/declarative-qtlogo-preserveaspectfit.png
  6817. share/doc/qt5/qtquick/images/declarative-qtlogo-stretch.png
  6818. share/doc/qt5/qtquick/images/declarative-qtlogo-tile.png
  6819. share/doc/qt5/qtquick/images/declarative-qtlogo-tilehorizontally.png
  6820. share/doc/qt5/qtquick/images/declarative-qtlogo-tilevertically.png
  6821. share/doc/qt5/qtquick/images/declarative-qtlogo.png
  6822. share/doc/qt5/qtquick/images/declarative-rect.png
  6823. share/doc/qt5/qtquick/images/declarative-rect_gradient.png
  6824. share/doc/qt5/qtquick/images/declarative-rotation.png
  6825. share/doc/qt5/qtquick/images/declarative-samegame.png
  6826. share/doc/qt5/qtquick/images/declarative-scale.png
  6827. share/doc/qt5/qtquick/images/declarative-scalegrid.png
  6828. share/doc/qt5/qtquick/images/declarative-shadereffectitem.png
  6829. share/doc/qt5/qtquick/images/declarative-shadereffectsource.png
  6830. share/doc/qt5/qtquick/images/declarative-text.png
  6831. share/doc/qt5/qtquick/images/declarative-textballoons_example.png
  6832. share/doc/qt5/qtquick/images/declarative-textedit.gif
  6833. share/doc/qt5/qtquick/images/declarative-textformat.png
  6834. share/doc/qt5/qtquick/images/declarative-textstyle.png
  6835. share/doc/qt5/qtquick/images/declarative-transformorigin.png
  6836. share/doc/qt5/qtquick/images/declarative-tutorial1.png
  6837. share/doc/qt5/qtquick/images/declarative-tutorial2.png
  6838. share/doc/qt5/qtquick/images/declarative-tutorial3_animation.gif
  6839. share/doc/qt5/qtquick/images/edge1.png
  6840. share/doc/qt5/qtquick/images/edge2.png
  6841. share/doc/qt5/qtquick/images/edge3.png
  6842. share/doc/qt5/qtquick/images/edge4.png
  6843. share/doc/qt5/qtquick/images/edges_qml.png
  6844. share/doc/qt5/qtquick/images/flickable-rebound.gif
  6845. share/doc/qt5/qtquick/images/flickable.gif
  6846. share/doc/qt5/qtquick/images/flipable.gif
  6847. share/doc/qt5/qtquick/images/fuzzydot.png
  6848. share/doc/qt5/qtquick/images/glowdot.png
  6849. share/doc/qt5/qtquick/images/graph-example.jpg
  6850. share/doc/qt5/qtquick/images/gridLayout_aligncenter.png
  6851. share/doc/qt5/qtquick/images/gridLayout_aligntop.png
  6852. share/doc/qt5/qtquick/images/gridLayout_aligntopleft.png
  6853. share/doc/qt5/qtquick/images/gridLayout_example.png
  6854. share/doc/qt5/qtquick/images/gridlayout.png
  6855. share/doc/qt5/qtquick/images/gridview-highlight.png
  6856. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
  6857. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
  6858. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
  6859. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
  6860. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
  6861. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
  6862. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
  6863. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
  6864. share/doc/qt5/qtquick/images/gridview-simple.png
  6865. share/doc/qt5/qtquick/images/home.png
  6866. share/doc/qt5/qtquick/images/horizontalpositioner_example.png
  6867. share/doc/qt5/qtquick/images/ico_note.png
  6868. share/doc/qt5/qtquick/images/ico_note_attention.png
  6869. share/doc/qt5/qtquick/images/ico_out.png
  6870. share/doc/qt5/qtquick/images/imageprovider.png
  6871. share/doc/qt5/qtquick/images/layoutmirroring.png
  6872. share/doc/qt5/qtquick/images/listview-decorations.png
  6873. share/doc/qt5/qtquick/images/listview-highlight.png
  6874. share/doc/qt5/qtquick/images/listview-layout-bottomtotop.png
  6875. share/doc/qt5/qtquick/images/listview-layout-lefttoright.png
  6876. share/doc/qt5/qtquick/images/listview-layout-righttoleft.png
  6877. share/doc/qt5/qtquick/images/listview-layout-toptobottom.png
  6878. share/doc/qt5/qtquick/images/listview-section.png
  6879. share/doc/qt5/qtquick/images/listview-setup.png
  6880. share/doc/qt5/qtquick/images/listview-simple.png
  6881. share/doc/qt5/qtquick/images/logo.png
  6882. share/doc/qt5/qtquick/images/manual-layout.png
  6883. share/doc/qt5/qtquick/images/margins_qml.png
  6884. share/doc/qt5/qtquick/images/mob-idle.png
  6885. share/doc/qt5/qtquick/images/modelview-overview.png
  6886. share/doc/qt5/qtquick/images/openglunderqml-example.jpg
  6887. share/doc/qt5/qtquick/images/parentchange.png
  6888. share/doc/qt5/qtquick/images/pathview.gif
  6889. share/doc/qt5/qtquick/images/positioner-example.png
  6890. share/doc/qt5/qtquick/images/qeasingcurve-inback.png
  6891. share/doc/qt5/qtquick/images/qeasingcurve-inbounce.png
  6892. share/doc/qt5/qtquick/images/qeasingcurve-incirc.png
  6893. share/doc/qt5/qtquick/images/qeasingcurve-incubic.png
  6894. share/doc/qt5/qtquick/images/qeasingcurve-inelastic.png
  6895. share/doc/qt5/qtquick/images/qeasingcurve-inexpo.png
  6896. share/doc/qt5/qtquick/images/qeasingcurve-inoutback.png
  6897. share/doc/qt5/qtquick/images/qeasingcurve-inoutbounce.png
  6898. share/doc/qt5/qtquick/images/qeasingcurve-inoutcirc.png
  6899. share/doc/qt5/qtquick/images/qeasingcurve-inoutcubic.png
  6900. share/doc/qt5/qtquick/images/qeasingcurve-inoutelastic.png
  6901. share/doc/qt5/qtquick/images/qeasingcurve-inoutexpo.png
  6902. share/doc/qt5/qtquick/images/qeasingcurve-inoutquad.png
  6903. share/doc/qt5/qtquick/images/qeasingcurve-inoutquart.png
  6904. share/doc/qt5/qtquick/images/qeasingcurve-inoutquint.png
  6905. share/doc/qt5/qtquick/images/qeasingcurve-inoutsine.png
  6906. share/doc/qt5/qtquick/images/qeasingcurve-inquad.png
  6907. share/doc/qt5/qtquick/images/qeasingcurve-inquart.png
  6908. share/doc/qt5/qtquick/images/qeasingcurve-inquint.png
  6909. share/doc/qt5/qtquick/images/qeasingcurve-insine.png
  6910. share/doc/qt5/qtquick/images/qeasingcurve-linear.png
  6911. share/doc/qt5/qtquick/images/qeasingcurve-outback.png
  6912. share/doc/qt5/qtquick/images/qeasingcurve-outbounce.png
  6913. share/doc/qt5/qtquick/images/qeasingcurve-outcirc.png
  6914. share/doc/qt5/qtquick/images/qeasingcurve-outcubic.png
  6915. share/doc/qt5/qtquick/images/qeasingcurve-outelastic.png
  6916. share/doc/qt5/qtquick/images/qeasingcurve-outexpo.png
  6917. share/doc/qt5/qtquick/images/qeasingcurve-outinback.png
  6918. share/doc/qt5/qtquick/images/qeasingcurve-outinbounce.png
  6919. share/doc/qt5/qtquick/images/qeasingcurve-outincirc.png
  6920. share/doc/qt5/qtquick/images/qeasingcurve-outincubic.png
  6921. share/doc/qt5/qtquick/images/qeasingcurve-outinelastic.png
  6922. share/doc/qt5/qtquick/images/qeasingcurve-outinexpo.png
  6923. share/doc/qt5/qtquick/images/qeasingcurve-outinquad.png
  6924. share/doc/qt5/qtquick/images/qeasingcurve-outinquart.png
  6925. share/doc/qt5/qtquick/images/qeasingcurve-outinquint.png
  6926. share/doc/qt5/qtquick/images/qeasingcurve-outinsine.png
  6927. share/doc/qt5/qtquick/images/qeasingcurve-outquad.png
  6928. share/doc/qt5/qtquick/images/qeasingcurve-outquart.png
  6929. share/doc/qt5/qtquick/images/qeasingcurve-outquint.png
  6930. share/doc/qt5/qtquick/images/qeasingcurve-outsine.png
  6931. share/doc/qt5/qtquick/images/qml-abstractitemmodel-example.png
  6932. share/doc/qt5/qtquick/images/qml-affectors-example.png
  6933. share/doc/qt5/qtquick/images/qml-animations-example.png
  6934. share/doc/qt5/qtquick/images/qml-blending-layered.png
  6935. share/doc/qt5/qtquick/images/qml-blending-nonlayered.png
  6936. share/doc/qt5/qtquick/images/qml-borderimage-normal-image.png
  6937. share/doc/qt5/qtquick/images/qml-borderimage-scaled.png
  6938. share/doc/qt5/qtquick/images/qml-borderimage-tiled.png
  6939. share/doc/qt5/qtquick/images/qml-canvas-example.png
  6940. share/doc/qt5/qtquick/images/qml-column.png
  6941. share/doc/qt5/qtquick/images/qml-customparticle-example.png
  6942. share/doc/qt5/qtquick/images/qml-dialcontrol-example.png
  6943. share/doc/qt5/qtquick/images/qml-dnd2-example.png
  6944. share/doc/qt5/qtquick/images/qml-draganddrop-example.png
  6945. share/doc/qt5/qtquick/images/qml-emitters-example.png
  6946. share/doc/qt5/qtquick/images/qml-flipable-example.png
  6947. share/doc/qt5/qtquick/images/qml-flow-snippet.png
  6948. share/doc/qt5/qtquick/images/qml-flow-text1.png
  6949. share/doc/qt5/qtquick/images/qml-flow-text2.png
  6950. share/doc/qt5/qtquick/images/qml-gradient.png
  6951. share/doc/qt5/qtquick/images/qml-grid-no-spacing.png
  6952. share/doc/qt5/qtquick/images/qml-grid-spacing.png
  6953. share/doc/qt5/qtquick/images/qml-imageelements-example.png
  6954. share/doc/qt5/qtquick/images/qml-imageparticle-example.png
  6955. share/doc/qt5/qtquick/images/qml-imageprovider-example.png
  6956. share/doc/qt5/qtquick/images/qml-item-canvas-arc.png
  6957. share/doc/qt5/qtquick/images/qml-item-canvas-arcTo.png
  6958. share/doc/qt5/qtquick/images/qml-item-canvas-bezierCurveTo.png
  6959. share/doc/qt5/qtquick/images/qml-item-canvas-clip-complex.png
  6960. share/doc/qt5/qtquick/images/qml-item-canvas-context.gif
  6961. share/doc/qt5/qtquick/images/qml-item-canvas-math-rotate.png
  6962. share/doc/qt5/qtquick/images/qml-item-canvas-math.png
  6963. share/doc/qt5/qtquick/images/qml-item-canvas-rotate.png
  6964. share/doc/qt5/qtquick/images/qml-item-canvas-scale.png
  6965. share/doc/qt5/qtquick/images/qml-item-canvas-scalex.png
  6966. share/doc/qt5/qtquick/images/qml-item-canvas-scaley.png
  6967. share/doc/qt5/qtquick/images/qml-item-canvas-skewx.png
  6968. share/doc/qt5/qtquick/images/qml-item-canvas-skewy.png
  6969. share/doc/qt5/qtquick/images/qml-item-canvas-startAngle.png
  6970. share/doc/qt5/qtquick/images/qml-item-canvas-translate.png
  6971. share/doc/qt5/qtquick/images/qml-item-canvas-translatey.png
  6972. share/doc/qt5/qtquick/images/qml-keyinteraction-example.png
  6973. share/doc/qt5/qtquick/images/qml-listview-sections-example.png
  6974. share/doc/qt5/qtquick/images/qml-localstorage-example.png
  6975. share/doc/qt5/qtquick/images/qml-modelviews-example.png
  6976. share/doc/qt5/qtquick/images/qml-mousearea-example.png
  6977. share/doc/qt5/qtquick/images/qml-mousearea-snippet.png
  6978. share/doc/qt5/qtquick/images/qml-objectlistmodel-example.png
  6979. share/doc/qt5/qtquick/images/qml-positioners-example.png
  6980. share/doc/qt5/qtquick/images/qml-righttoleft-example.png
  6981. share/doc/qt5/qtquick/images/qml-row.png
  6982. share/doc/qt5/qtquick/images/qml-scrollbar-example.png
  6983. share/doc/qt5/qtquick/images/qml-shadereffect-layereffect.png
  6984. share/doc/qt5/qtquick/images/qml-shadereffect-nolayereffect.png
  6985. share/doc/qt5/qtquick/images/qml-shadereffect-opacitymask.png
  6986. share/doc/qt5/qtquick/images/qml-shadereffects-example.png
  6987. share/doc/qt5/qtquick/images/qml-stringlistmodel-example.png
  6988. share/doc/qt5/qtquick/images/qml-system-example.png
  6989. share/doc/qt5/qtquick/images/qml-tabwidget-example.png
  6990. share/doc/qt5/qtquick/images/qml-text-example.png
  6991. share/doc/qt5/qtquick/images/qml-threading-example.png
  6992. share/doc/qt5/qtquick/images/qml-touchinteraction-example.png
  6993. share/doc/qt5/qtquick/images/qml-window-example.png
  6994. share/doc/qt5/qtquick/images/qml-xmllistmodel-example.png
  6995. share/doc/qt5/qtquick/images/qtquick-demo-calqlatr.png
  6996. share/doc/qt5/qtquick/images/qtquick-demo-clocks-small.png
  6997. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-1.png
  6998. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-2.png
  6999. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-3.jpg
  7000. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-4.jpg
  7001. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-5.jpg
  7002. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-6.jpg
  7003. share/doc/qt5/qtquick/images/qtquick-demo-photosurface-small.png
  7004. share/doc/qt5/qtquick/images/qtquick-demo-photoviewer-small.png
  7005. share/doc/qt5/qtquick/images/qtquick-demo-rssnews-small.png
  7006. share/doc/qt5/qtquick/images/qtquick-demo-samegame-med-1.png
  7007. share/doc/qt5/qtquick/images/qtquick-demo-samegame-med-2.png
  7008. share/doc/qt5/qtquick/images/qtquick-demo-stocqt.png
  7009. share/doc/qt5/qtquick/images/qtquick-demo-tweetsearch-med-1.png
  7010. share/doc/qt5/qtquick/images/qtquick-demo-tweetsearch-med-2.png
  7011. share/doc/qt5/qtquick/images/qtquicklayouts-example-layouts.png
  7012. share/doc/qt5/qtquick/images/qtquickwidgets-example.png
  7013. share/doc/qt5/qtquick/images/rect-color.png
  7014. share/doc/qt5/qtquick/images/rendercontrol-example.jpg
  7015. share/doc/qt5/qtquick/images/repeater-index.png
  7016. share/doc/qt5/qtquick/images/repeater-modeldata.png
  7017. share/doc/qt5/qtquick/images/repeater-simple.png
  7018. share/doc/qt5/qtquick/images/repeater.png
  7019. share/doc/qt5/qtquick/images/rowlayout-minimum.png
  7020. share/doc/qt5/qtquick/images/rowlayout.png
  7021. share/doc/qt5/qtquick/images/screen-and-window-dimensions.jpg
  7022. share/doc/qt5/qtquick/images/sg-renderloop-singlethreaded.jpg
  7023. share/doc/qt5/qtquick/images/sg-renderloop-threaded.jpg
  7024. share/doc/qt5/qtquick/images/simplematerial-example.jpg
  7025. share/doc/qt5/qtquick/images/spritecutting.png
  7026. share/doc/qt5/qtquick/images/spriteenginegraph.png
  7027. share/doc/qt5/qtquick/images/star.png
  7028. share/doc/qt5/qtquick/images/textureinsgnode-example.jpg
  7029. share/doc/qt5/qtquick/images/textureinthread-example.jpg
  7030. share/doc/qt5/qtquick/images/touchpoint-metrics.png
  7031. share/doc/qt5/qtquick/images/translate.png
  7032. share/doc/qt5/qtquick/images/twotextureproviders-example.jpg
  7033. share/doc/qt5/qtquick/images/verticalpositioner_example.png
  7034. share/doc/qt5/qtquick/images/verticalpositioner_transition.gif
  7035. share/doc/qt5/qtquick/images/viewtransitions-basic.gif
  7036. share/doc/qt5/qtquick/images/viewtransitions-delayedbyindex.gif
  7037. share/doc/qt5/qtquick/images/viewtransitions-intermediatemove.gif
  7038. share/doc/qt5/qtquick/images/viewtransitions-interruptedbad.gif
  7039. share/doc/qt5/qtquick/images/viewtransitions-interruptedgood.gif
  7040. share/doc/qt5/qtquick/images/viewtransitions-pathanim.gif
  7041. share/doc/qt5/qtquick/images/viewtransitions-scriptactionbad.gif
  7042. share/doc/qt5/qtquick/images/visual-coordinates-example.png
  7043. share/doc/qt5/qtquick/images/visual-parent-example.png
  7044. share/doc/qt5/qtquick/images/visual-parent-example2.png
  7045. share/doc/qt5/qtquick/images/visualcanvas_list.png
  7046. share/doc/qt5/qtquick/images/visualcanvas_overlap.png
  7047. share/doc/qt5/qtquick/images/visualize-batches.png
  7048. share/doc/qt5/qtquick/images/visualize-clip.png
  7049. share/doc/qt5/qtquick/images/visualize-original.png
  7050. share/doc/qt5/qtquick/images/visualize-overdraw-1.png
  7051. share/doc/qt5/qtquick/images/visualize-overdraw-2.png
  7052. share/doc/qt5/qtquick/qml-advtutorial.html
  7053. share/doc/qt5/qtquick/qml-color.html
  7054. share/doc/qt5/qtquick/qml-dynamicview-tutorial.html
  7055. share/doc/qt5/qtquick/qml-font.html
  7056. share/doc/qt5/qtquick/qml-matrix4x4.html
  7057. share/doc/qt5/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
  7058. share/doc/qt5/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
  7059. share/doc/qt5/qtquick/qml-qt-labs-settings-settings-members.html
  7060. share/doc/qt5/qtquick/qml-qt-labs-settings-settings.html
  7061. share/doc/qt5/qtquick/qml-qtquick-accessible-members.html
  7062. share/doc/qt5/qtquick/qml-qtquick-accessible.html
  7063. share/doc/qt5/qtquick/qml-qtquick-anchoranimation-members.html
  7064. share/doc/qt5/qtquick/qml-qtquick-anchoranimation.html
  7065. share/doc/qt5/qtquick/qml-qtquick-anchorchanges-members.html
  7066. share/doc/qt5/qtquick/qml-qtquick-anchorchanges.html
  7067. share/doc/qt5/qtquick/qml-qtquick-animatedimage-members.html
  7068. share/doc/qt5/qtquick/qml-qtquick-animatedimage.html
  7069. share/doc/qt5/qtquick/qml-qtquick-animatedsprite-members.html
  7070. share/doc/qt5/qtquick/qml-qtquick-animatedsprite.html
  7071. share/doc/qt5/qtquick/qml-qtquick-animation-members.html
  7072. share/doc/qt5/qtquick/qml-qtquick-animation.html
  7073. share/doc/qt5/qtquick/qml-qtquick-animationcontroller-members.html
  7074. share/doc/qt5/qtquick/qml-qtquick-animationcontroller.html
  7075. share/doc/qt5/qtquick/qml-qtquick-animator-members.html
  7076. share/doc/qt5/qtquick/qml-qtquick-animator.html
  7077. share/doc/qt5/qtquick/qml-qtquick-behavior-members.html
  7078. share/doc/qt5/qtquick/qml-qtquick-behavior.html
  7079. share/doc/qt5/qtquick/qml-qtquick-borderimage-members.html
  7080. share/doc/qt5/qtquick/qml-qtquick-borderimage.html
  7081. share/doc/qt5/qtquick/qml-qtquick-borderimagemesh-members.html
  7082. share/doc/qt5/qtquick/qml-qtquick-borderimagemesh.html
  7083. share/doc/qt5/qtquick/qml-qtquick-canvas-members.html
  7084. share/doc/qt5/qtquick/qml-qtquick-canvas-obsolete.html
  7085. share/doc/qt5/qtquick/qml-qtquick-canvas.html
  7086. share/doc/qt5/qtquick/qml-qtquick-canvasgradient-members.html
  7087. share/doc/qt5/qtquick/qml-qtquick-canvasgradient.html
  7088. share/doc/qt5/qtquick/qml-qtquick-canvasimagedata-members.html
  7089. share/doc/qt5/qtquick/qml-qtquick-canvasimagedata.html
  7090. share/doc/qt5/qtquick/qml-qtquick-canvaspixelarray-members.html
  7091. share/doc/qt5/qtquick/qml-qtquick-canvaspixelarray.html
  7092. share/doc/qt5/qtquick/qml-qtquick-coloranimation-members.html
  7093. share/doc/qt5/qtquick/qml-qtquick-coloranimation.html
  7094. share/doc/qt5/qtquick/qml-qtquick-column-members.html
  7095. share/doc/qt5/qtquick/qml-qtquick-column.html
  7096. share/doc/qt5/qtquick/qml-qtquick-context2d-members.html
  7097. share/doc/qt5/qtquick/qml-qtquick-context2d.html
  7098. share/doc/qt5/qtquick/qml-qtquick-doublevalidator-members.html
  7099. share/doc/qt5/qtquick/qml-qtquick-doublevalidator.html
  7100. share/doc/qt5/qtquick/qml-qtquick-drag-members.html
  7101. share/doc/qt5/qtquick/qml-qtquick-drag.html
  7102. share/doc/qt5/qtquick/qml-qtquick-dragevent-members.html
  7103. share/doc/qt5/qtquick/qml-qtquick-dragevent.html
  7104. share/doc/qt5/qtquick/qml-qtquick-droparea-members.html
  7105. share/doc/qt5/qtquick/qml-qtquick-droparea.html
  7106. share/doc/qt5/qtquick/qml-qtquick-enterkey-members.html
  7107. share/doc/qt5/qtquick/qml-qtquick-enterkey.html
  7108. share/doc/qt5/qtquick/qml-qtquick-flickable-members.html
  7109. share/doc/qt5/qtquick/qml-qtquick-flickable.html
  7110. share/doc/qt5/qtquick/qml-qtquick-flipable-members.html
  7111. share/doc/qt5/qtquick/qml-qtquick-flipable.html
  7112. share/doc/qt5/qtquick/qml-qtquick-flow-members.html
  7113. share/doc/qt5/qtquick/qml-qtquick-flow.html
  7114. share/doc/qt5/qtquick/qml-qtquick-focusscope-members.html
  7115. share/doc/qt5/qtquick/qml-qtquick-focusscope.html
  7116. share/doc/qt5/qtquick/qml-qtquick-fontloader-members.html
  7117. share/doc/qt5/qtquick/qml-qtquick-fontloader.html
  7118. share/doc/qt5/qtquick/qml-qtquick-fontmetrics-members.html
  7119. share/doc/qt5/qtquick/qml-qtquick-fontmetrics.html
  7120. share/doc/qt5/qtquick/qml-qtquick-gestureevent-members.html
  7121. share/doc/qt5/qtquick/qml-qtquick-gestureevent.html
  7122. share/doc/qt5/qtquick/qml-qtquick-gradient-members.html
  7123. share/doc/qt5/qtquick/qml-qtquick-gradient.html
  7124. share/doc/qt5/qtquick/qml-qtquick-gradientstop-members.html
  7125. share/doc/qt5/qtquick/qml-qtquick-gradientstop.html
  7126. share/doc/qt5/qtquick/qml-qtquick-graphicsinfo-members.html
  7127. share/doc/qt5/qtquick/qml-qtquick-graphicsinfo.html
  7128. share/doc/qt5/qtquick/qml-qtquick-grid-members.html
  7129. share/doc/qt5/qtquick/qml-qtquick-grid.html
  7130. share/doc/qt5/qtquick/qml-qtquick-gridmesh-members.html
  7131. share/doc/qt5/qtquick/qml-qtquick-gridmesh.html
  7132. share/doc/qt5/qtquick/qml-qtquick-gridview-members.html
  7133. share/doc/qt5/qtquick/qml-qtquick-gridview.html
  7134. share/doc/qt5/qtquick/qml-qtquick-image-members.html
  7135. share/doc/qt5/qtquick/qml-qtquick-image.html
  7136. share/doc/qt5/qtquick/qml-qtquick-intvalidator-members.html
  7137. share/doc/qt5/qtquick/qml-qtquick-intvalidator.html
  7138. share/doc/qt5/qtquick/qml-qtquick-item-members.html
  7139. share/doc/qt5/qtquick/qml-qtquick-item.html
  7140. share/doc/qt5/qtquick/qml-qtquick-itemgrabresult-members.html
  7141. share/doc/qt5/qtquick/qml-qtquick-itemgrabresult.html
  7142. share/doc/qt5/qtquick/qml-qtquick-keyevent-members.html
  7143. share/doc/qt5/qtquick/qml-qtquick-keyevent.html
  7144. share/doc/qt5/qtquick/qml-qtquick-keynavigation-members.html
  7145. share/doc/qt5/qtquick/qml-qtquick-keynavigation.html
  7146. share/doc/qt5/qtquick/qml-qtquick-keys-members.html
  7147. share/doc/qt5/qtquick/qml-qtquick-keys.html
  7148. share/doc/qt5/qtquick/qml-qtquick-layoutmirroring-members.html
  7149. share/doc/qt5/qtquick/qml-qtquick-layoutmirroring.html
  7150. share/doc/qt5/qtquick/qml-qtquick-layouts-columnlayout-members.html
  7151. share/doc/qt5/qtquick/qml-qtquick-layouts-columnlayout.html
  7152. share/doc/qt5/qtquick/qml-qtquick-layouts-gridlayout-members.html
  7153. share/doc/qt5/qtquick/qml-qtquick-layouts-gridlayout.html
  7154. share/doc/qt5/qtquick/qml-qtquick-layouts-layout-members.html
  7155. share/doc/qt5/qtquick/qml-qtquick-layouts-layout.html
  7156. share/doc/qt5/qtquick/qml-qtquick-layouts-rowlayout-members.html
  7157. share/doc/qt5/qtquick/qml-qtquick-layouts-rowlayout.html
  7158. share/doc/qt5/qtquick/qml-qtquick-layouts-stacklayout-members.html
  7159. share/doc/qt5/qtquick/qml-qtquick-layouts-stacklayout.html
  7160. share/doc/qt5/qtquick/qml-qtquick-listview-members.html
  7161. share/doc/qt5/qtquick/qml-qtquick-listview.html
  7162. share/doc/qt5/qtquick/qml-qtquick-loader-members.html
  7163. share/doc/qt5/qtquick/qml-qtquick-loader.html
  7164. share/doc/qt5/qtquick/qml-qtquick-matrix4x4-members.html
  7165. share/doc/qt5/qtquick/qml-qtquick-matrix4x4.html
  7166. share/doc/qt5/qtquick/qml-qtquick-mousearea-members.html
  7167. share/doc/qt5/qtquick/qml-qtquick-mousearea.html
  7168. share/doc/qt5/qtquick/qml-qtquick-mouseevent-members.html
  7169. share/doc/qt5/qtquick/qml-qtquick-mouseevent.html
  7170. share/doc/qt5/qtquick/qml-qtquick-multipointtoucharea-members.html
  7171. share/doc/qt5/qtquick/qml-qtquick-multipointtoucharea.html
  7172. share/doc/qt5/qtquick/qml-qtquick-numberanimation-members.html
  7173. share/doc/qt5/qtquick/qml-qtquick-numberanimation.html
  7174. share/doc/qt5/qtquick/qml-qtquick-opacityanimator-members.html
  7175. share/doc/qt5/qtquick/qml-qtquick-opacityanimator.html
  7176. share/doc/qt5/qtquick/qml-qtquick-openglinfo-members.html
  7177. share/doc/qt5/qtquick/qml-qtquick-openglinfo.html
  7178. share/doc/qt5/qtquick/qml-qtquick-parallelanimation-members.html
  7179. share/doc/qt5/qtquick/qml-qtquick-parallelanimation.html
  7180. share/doc/qt5/qtquick/qml-qtquick-parentanimation-members.html
  7181. share/doc/qt5/qtquick/qml-qtquick-parentanimation.html
  7182. share/doc/qt5/qtquick/qml-qtquick-parentchange-members.html
  7183. share/doc/qt5/qtquick/qml-qtquick-parentchange.html
  7184. share/doc/qt5/qtquick/qml-qtquick-particles-affector-members.html
  7185. share/doc/qt5/qtquick/qml-qtquick-particles-affector.html
  7186. share/doc/qt5/qtquick/qml-qtquick-particles-age-members.html
  7187. share/doc/qt5/qtquick/qml-qtquick-particles-age.html
  7188. share/doc/qt5/qtquick/qml-qtquick-particles-angledirection-members.html
  7189. share/doc/qt5/qtquick/qml-qtquick-particles-angledirection.html
  7190. share/doc/qt5/qtquick/qml-qtquick-particles-attractor-members.html
  7191. share/doc/qt5/qtquick/qml-qtquick-particles-attractor.html
  7192. share/doc/qt5/qtquick/qml-qtquick-particles-cumulativedirection-members.html
  7193. share/doc/qt5/qtquick/qml-qtquick-particles-cumulativedirection.html
  7194. share/doc/qt5/qtquick/qml-qtquick-particles-customparticle-members.html
  7195. share/doc/qt5/qtquick/qml-qtquick-particles-customparticle.html
  7196. share/doc/qt5/qtquick/qml-qtquick-particles-direction-members.html
  7197. share/doc/qt5/qtquick/qml-qtquick-particles-direction.html
  7198. share/doc/qt5/qtquick/qml-qtquick-particles-ellipseshape-members.html
  7199. share/doc/qt5/qtquick/qml-qtquick-particles-ellipseshape.html
  7200. share/doc/qt5/qtquick/qml-qtquick-particles-emitter-members.html
  7201. share/doc/qt5/qtquick/qml-qtquick-particles-emitter.html
  7202. share/doc/qt5/qtquick/qml-qtquick-particles-friction-members.html
  7203. share/doc/qt5/qtquick/qml-qtquick-particles-friction.html
  7204. share/doc/qt5/qtquick/qml-qtquick-particles-gravity-members.html
  7205. share/doc/qt5/qtquick/qml-qtquick-particles-gravity-obsolete.html
  7206. share/doc/qt5/qtquick/qml-qtquick-particles-gravity.html
  7207. share/doc/qt5/qtquick/qml-qtquick-particles-groupgoal-members.html
  7208. share/doc/qt5/qtquick/qml-qtquick-particles-groupgoal.html
  7209. share/doc/qt5/qtquick/qml-qtquick-particles-imageparticle-members.html
  7210. share/doc/qt5/qtquick/qml-qtquick-particles-imageparticle.html
  7211. share/doc/qt5/qtquick/qml-qtquick-particles-itemparticle-members.html
  7212. share/doc/qt5/qtquick/qml-qtquick-particles-itemparticle.html
  7213. share/doc/qt5/qtquick/qml-qtquick-particles-lineshape-members.html
  7214. share/doc/qt5/qtquick/qml-qtquick-particles-lineshape.html
  7215. share/doc/qt5/qtquick/qml-qtquick-particles-maskshape-members.html
  7216. share/doc/qt5/qtquick/qml-qtquick-particles-maskshape.html
  7217. share/doc/qt5/qtquick/qml-qtquick-particles-particle-members.html
  7218. share/doc/qt5/qtquick/qml-qtquick-particles-particle.html
  7219. share/doc/qt5/qtquick/qml-qtquick-particles-particlegroup-members.html
  7220. share/doc/qt5/qtquick/qml-qtquick-particles-particlegroup.html
  7221. share/doc/qt5/qtquick/qml-qtquick-particles-particlepainter-members.html
  7222. share/doc/qt5/qtquick/qml-qtquick-particles-particlepainter.html
  7223. share/doc/qt5/qtquick/qml-qtquick-particles-particlesystem-members.html
  7224. share/doc/qt5/qtquick/qml-qtquick-particles-particlesystem.html
  7225. share/doc/qt5/qtquick/qml-qtquick-particles-pointdirection-members.html
  7226. share/doc/qt5/qtquick/qml-qtquick-particles-pointdirection.html
  7227. share/doc/qt5/qtquick/qml-qtquick-particles-rectangleshape-members.html
  7228. share/doc/qt5/qtquick/qml-qtquick-particles-rectangleshape.html
  7229. share/doc/qt5/qtquick/qml-qtquick-particles-shape-members.html
  7230. share/doc/qt5/qtquick/qml-qtquick-particles-shape.html
  7231. share/doc/qt5/qtquick/qml-qtquick-particles-spritegoal-members.html
  7232. share/doc/qt5/qtquick/qml-qtquick-particles-spritegoal.html
  7233. share/doc/qt5/qtquick/qml-qtquick-particles-targetdirection-members.html
  7234. share/doc/qt5/qtquick/qml-qtquick-particles-targetdirection.html
  7235. share/doc/qt5/qtquick/qml-qtquick-particles-trailemitter-members.html
  7236. share/doc/qt5/qtquick/qml-qtquick-particles-trailemitter.html
  7237. share/doc/qt5/qtquick/qml-qtquick-particles-turbulence-members.html
  7238. share/doc/qt5/qtquick/qml-qtquick-particles-turbulence.html
  7239. share/doc/qt5/qtquick/qml-qtquick-particles-wander-members.html
  7240. share/doc/qt5/qtquick/qml-qtquick-particles-wander.html
  7241. share/doc/qt5/qtquick/qml-qtquick-path-members.html
  7242. share/doc/qt5/qtquick/qml-qtquick-path.html
  7243. share/doc/qt5/qtquick/qml-qtquick-pathanimation-members.html
  7244. share/doc/qt5/qtquick/qml-qtquick-pathanimation.html
  7245. share/doc/qt5/qtquick/qml-qtquick-patharc-members.html
  7246. share/doc/qt5/qtquick/qml-qtquick-patharc.html
  7247. share/doc/qt5/qtquick/qml-qtquick-pathattribute-members.html
  7248. share/doc/qt5/qtquick/qml-qtquick-pathattribute.html
  7249. share/doc/qt5/qtquick/qml-qtquick-pathcubic-members.html
  7250. share/doc/qt5/qtquick/qml-qtquick-pathcubic.html
  7251. share/doc/qt5/qtquick/qml-qtquick-pathcurve-members.html
  7252. share/doc/qt5/qtquick/qml-qtquick-pathcurve.html
  7253. share/doc/qt5/qtquick/qml-qtquick-pathelement-members.html
  7254. share/doc/qt5/qtquick/qml-qtquick-pathelement.html
  7255. share/doc/qt5/qtquick/qml-qtquick-pathinterpolator-members.html
  7256. share/doc/qt5/qtquick/qml-qtquick-pathinterpolator.html
  7257. share/doc/qt5/qtquick/qml-qtquick-pathline-members.html
  7258. share/doc/qt5/qtquick/qml-qtquick-pathline.html
  7259. share/doc/qt5/qtquick/qml-qtquick-pathpercent-members.html
  7260. share/doc/qt5/qtquick/qml-qtquick-pathpercent.html
  7261. share/doc/qt5/qtquick/qml-qtquick-pathquad-members.html
  7262. share/doc/qt5/qtquick/qml-qtquick-pathquad.html
  7263. share/doc/qt5/qtquick/qml-qtquick-pathsvg-members.html
  7264. share/doc/qt5/qtquick/qml-qtquick-pathsvg.html
  7265. share/doc/qt5/qtquick/qml-qtquick-pathview-members.html
  7266. share/doc/qt5/qtquick/qml-qtquick-pathview.html
  7267. share/doc/qt5/qtquick/qml-qtquick-pauseanimation-members.html
  7268. share/doc/qt5/qtquick/qml-qtquick-pauseanimation.html
  7269. share/doc/qt5/qtquick/qml-qtquick-pincharea-members.html
  7270. share/doc/qt5/qtquick/qml-qtquick-pincharea.html
  7271. share/doc/qt5/qtquick/qml-qtquick-pinchevent-members.html
  7272. share/doc/qt5/qtquick/qml-qtquick-pinchevent.html
  7273. share/doc/qt5/qtquick/qml-qtquick-positioner-members.html
  7274. share/doc/qt5/qtquick/qml-qtquick-positioner.html
  7275. share/doc/qt5/qtquick/qml-qtquick-propertyaction-members.html
  7276. share/doc/qt5/qtquick/qml-qtquick-propertyaction.html
  7277. share/doc/qt5/qtquick/qml-qtquick-propertyanimation-members.html
  7278. share/doc/qt5/qtquick/qml-qtquick-propertyanimation.html
  7279. share/doc/qt5/qtquick/qml-qtquick-propertychanges-members.html
  7280. share/doc/qt5/qtquick/qml-qtquick-propertychanges.html
  7281. share/doc/qt5/qtquick/qml-qtquick-rectangle-members.html
  7282. share/doc/qt5/qtquick/qml-qtquick-rectangle.html
  7283. share/doc/qt5/qtquick/qml-qtquick-regexpvalidator-members.html
  7284. share/doc/qt5/qtquick/qml-qtquick-regexpvalidator.html
  7285. share/doc/qt5/qtquick/qml-qtquick-repeater-members.html
  7286. share/doc/qt5/qtquick/qml-qtquick-repeater.html
  7287. share/doc/qt5/qtquick/qml-qtquick-rotation-members.html
  7288. share/doc/qt5/qtquick/qml-qtquick-rotation.html
  7289. share/doc/qt5/qtquick/qml-qtquick-rotationanimation-members.html
  7290. share/doc/qt5/qtquick/qml-qtquick-rotationanimation.html
  7291. share/doc/qt5/qtquick/qml-qtquick-rotationanimator-members.html
  7292. share/doc/qt5/qtquick/qml-qtquick-rotationanimator.html
  7293. share/doc/qt5/qtquick/qml-qtquick-row-members.html
  7294. share/doc/qt5/qtquick/qml-qtquick-row.html
  7295. share/doc/qt5/qtquick/qml-qtquick-scale-members.html
  7296. share/doc/qt5/qtquick/qml-qtquick-scale.html
  7297. share/doc/qt5/qtquick/qml-qtquick-scaleanimator-members.html
  7298. share/doc/qt5/qtquick/qml-qtquick-scaleanimator.html
  7299. share/doc/qt5/qtquick/qml-qtquick-scriptaction-members.html
  7300. share/doc/qt5/qtquick/qml-qtquick-scriptaction.html
  7301. share/doc/qt5/qtquick/qml-qtquick-sequentialanimation-members.html
  7302. share/doc/qt5/qtquick/qml-qtquick-sequentialanimation.html
  7303. share/doc/qt5/qtquick/qml-qtquick-shadereffect-members.html
  7304. share/doc/qt5/qtquick/qml-qtquick-shadereffect.html
  7305. share/doc/qt5/qtquick/qml-qtquick-shadereffectsource-members.html
  7306. share/doc/qt5/qtquick/qml-qtquick-shadereffectsource.html
  7307. share/doc/qt5/qtquick/qml-qtquick-shortcut-members.html
  7308. share/doc/qt5/qtquick/qml-qtquick-shortcut.html
  7309. share/doc/qt5/qtquick/qml-qtquick-smoothedanimation-members.html
  7310. share/doc/qt5/qtquick/qml-qtquick-smoothedanimation.html
  7311. share/doc/qt5/qtquick/qml-qtquick-springanimation-members.html
  7312. share/doc/qt5/qtquick/qml-qtquick-springanimation.html
  7313. share/doc/qt5/qtquick/qml-qtquick-sprite-members.html
  7314. share/doc/qt5/qtquick/qml-qtquick-sprite.html
  7315. share/doc/qt5/qtquick/qml-qtquick-spritesequence-members.html
  7316. share/doc/qt5/qtquick/qml-qtquick-spritesequence.html
  7317. share/doc/qt5/qtquick/qml-qtquick-state-members.html
  7318. share/doc/qt5/qtquick/qml-qtquick-state.html
  7319. share/doc/qt5/qtquick/qml-qtquick-statechangescript-members.html
  7320. share/doc/qt5/qtquick/qml-qtquick-statechangescript.html
  7321. share/doc/qt5/qtquick/qml-qtquick-stategroup-members.html
  7322. share/doc/qt5/qtquick/qml-qtquick-stategroup.html
  7323. share/doc/qt5/qtquick/qml-qtquick-systempalette-members.html
  7324. share/doc/qt5/qtquick/qml-qtquick-systempalette.html
  7325. share/doc/qt5/qtquick/qml-qtquick-text-members.html
  7326. share/doc/qt5/qtquick/qml-qtquick-text-obsolete.html
  7327. share/doc/qt5/qtquick/qml-qtquick-text.html
  7328. share/doc/qt5/qtquick/qml-qtquick-textedit-members.html
  7329. share/doc/qt5/qtquick/qml-qtquick-textedit.html
  7330. share/doc/qt5/qtquick/qml-qtquick-textinput-members.html
  7331. share/doc/qt5/qtquick/qml-qtquick-textinput.html
  7332. share/doc/qt5/qtquick/qml-qtquick-textmetrics-members.html
  7333. share/doc/qt5/qtquick/qml-qtquick-textmetrics.html
  7334. share/doc/qt5/qtquick/qml-qtquick-touchpoint-members.html
  7335. share/doc/qt5/qtquick/qml-qtquick-touchpoint-obsolete.html
  7336. share/doc/qt5/qtquick/qml-qtquick-touchpoint.html
  7337. share/doc/qt5/qtquick/qml-qtquick-transform-members.html
  7338. share/doc/qt5/qtquick/qml-qtquick-transform.html
  7339. share/doc/qt5/qtquick/qml-qtquick-transition-members.html
  7340. share/doc/qt5/qtquick/qml-qtquick-transition.html
  7341. share/doc/qt5/qtquick/qml-qtquick-translate-members.html
  7342. share/doc/qt5/qtquick/qml-qtquick-translate.html
  7343. share/doc/qt5/qtquick/qml-qtquick-uniformanimator-members.html
  7344. share/doc/qt5/qtquick/qml-qtquick-uniformanimator.html
  7345. share/doc/qt5/qtquick/qml-qtquick-vector3danimation-members.html
  7346. share/doc/qt5/qtquick/qml-qtquick-vector3danimation.html
  7347. share/doc/qt5/qtquick/qml-qtquick-viewtransition-members.html
  7348. share/doc/qt5/qtquick/qml-qtquick-viewtransition.html
  7349. share/doc/qt5/qtquick/qml-qtquick-wheelevent-members.html
  7350. share/doc/qt5/qtquick/qml-qtquick-wheelevent.html
  7351. share/doc/qt5/qtquick/qml-qtquick-window-closeevent-members.html
  7352. share/doc/qt5/qtquick/qml-qtquick-window-closeevent.html
  7353. share/doc/qt5/qtquick/qml-qtquick-window-screen-members.html
  7354. share/doc/qt5/qtquick/qml-qtquick-window-screen-obsolete.html
  7355. share/doc/qt5/qtquick/qml-qtquick-window-screen.html
  7356. share/doc/qt5/qtquick/qml-qtquick-window-window-members.html
  7357. share/doc/qt5/qtquick/qml-qtquick-window-window.html
  7358. share/doc/qt5/qtquick/qml-qtquick-xanimator-members.html
  7359. share/doc/qt5/qtquick/qml-qtquick-xanimator.html
  7360. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmllistmodel-members.html
  7361. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmllistmodel.html
  7362. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmlrole-members.html
  7363. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmlrole.html
  7364. share/doc/qt5/qtquick/qml-qtquick-yanimator-members.html
  7365. share/doc/qt5/qtquick/qml-qtquick-yanimator.html
  7366. share/doc/qt5/qtquick/qml-qttest-signalspy-members.html
  7367. share/doc/qt5/qtquick/qml-qttest-signalspy.html
  7368. share/doc/qt5/qtquick/qml-qttest-testcase-members.html
  7369. share/doc/qt5/qtquick/qml-qttest-testcase.html
  7370. share/doc/qt5/qtquick/qml-qttest-toucheventsequence-members.html
  7371. share/doc/qt5/qtquick/qml-qttest-toucheventsequence.html
  7372. share/doc/qt5/qtquick/qml-quaternion.html
  7373. share/doc/qt5/qtquick/qml-tutorial.html
  7374. share/doc/qt5/qtquick/qml-tutorial1.html
  7375. share/doc/qt5/qtquick/qml-tutorial2.html
  7376. share/doc/qt5/qtquick/qml-tutorial3.html
  7377. share/doc/qt5/qtquick/qml-vector2d.html
  7378. share/doc/qt5/qtquick/qml-vector3d.html
  7379. share/doc/qt5/qtquick/qml-vector4d.html
  7380. share/doc/qt5/qtquick/qmlexampletoggleswitch.html
  7381. share/doc/qt5/qtquick/qquickasyncimageprovider-members.html
  7382. share/doc/qt5/qtquick/qquickasyncimageprovider.html
  7383. share/doc/qt5/qtquick/qquickframebufferobject-members.html
  7384. share/doc/qt5/qtquick/qquickframebufferobject-renderer-members.html
  7385. share/doc/qt5/qtquick/qquickframebufferobject-renderer.html
  7386. share/doc/qt5/qtquick/qquickframebufferobject.html
  7387. share/doc/qt5/qtquick/qquickimageprovider-members.html
  7388. share/doc/qt5/qtquick/qquickimageprovider.html
  7389. share/doc/qt5/qtquick/qquickimageresponse-members.html
  7390. share/doc/qt5/qtquick/qquickimageresponse.html
  7391. share/doc/qt5/qtquick/qquickitem-itemchangedata-members.html
  7392. share/doc/qt5/qtquick/qquickitem-itemchangedata.html
  7393. share/doc/qt5/qtquick/qquickitem-members.html
  7394. share/doc/qt5/qtquick/qquickitem-updatepaintnodedata-members.html
  7395. share/doc/qt5/qtquick/qquickitem-updatepaintnodedata.html
  7396. share/doc/qt5/qtquick/qquickitem.html
  7397. share/doc/qt5/qtquick/qquickitemgrabresult-members.html
  7398. share/doc/qt5/qtquick/qquickitemgrabresult.html
  7399. share/doc/qt5/qtquick/qquickpainteditem-members.html
  7400. share/doc/qt5/qtquick/qquickpainteditem-obsolete.html
  7401. share/doc/qt5/qtquick/qquickpainteditem.html
  7402. share/doc/qt5/qtquick/qquickrendercontrol-members.html
  7403. share/doc/qt5/qtquick/qquickrendercontrol.html
  7404. share/doc/qt5/qtquick/qquicktextdocument-members.html
  7405. share/doc/qt5/qtquick/qquicktextdocument.html
  7406. share/doc/qt5/qtquick/qquicktexturefactory-members.html
  7407. share/doc/qt5/qtquick/qquicktexturefactory.html
  7408. share/doc/qt5/qtquick/qquickview-members.html
  7409. share/doc/qt5/qtquick/qquickview.html
  7410. share/doc/qt5/qtquick/qquickwidget-members.html
  7411. share/doc/qt5/qtquick/qquickwidget.html
  7412. share/doc/qt5/qtquick/qquickwindow-members.html
  7413. share/doc/qt5/qtquick/qquickwindow-obsolete.html
  7414. share/doc/qt5/qtquick/qquickwindow.html
  7415. share/doc/qt5/qtquick/qsgabstractrenderer-members.html
  7416. share/doc/qt5/qtquick/qsgabstractrenderer.html
  7417. share/doc/qt5/qtquick/qsgbasicgeometrynode-members.html
  7418. share/doc/qt5/qtquick/qsgbasicgeometrynode.html
  7419. share/doc/qt5/qtquick/qsgclipnode-members.html
  7420. share/doc/qt5/qtquick/qsgclipnode.html
  7421. share/doc/qt5/qtquick/qsgdynamictexture-members.html
  7422. share/doc/qt5/qtquick/qsgdynamictexture.html
  7423. share/doc/qt5/qtquick/qsgengine-members.html
  7424. share/doc/qt5/qtquick/qsgengine.html
  7425. share/doc/qt5/qtquick/qsgflatcolormaterial-members.html
  7426. share/doc/qt5/qtquick/qsgflatcolormaterial.html
  7427. share/doc/qt5/qtquick/qsggeometry-attribute-members.html
  7428. share/doc/qt5/qtquick/qsggeometry-attribute.html
  7429. share/doc/qt5/qtquick/qsggeometry-attributeset-members.html
  7430. share/doc/qt5/qtquick/qsggeometry-attributeset.html
  7431. share/doc/qt5/qtquick/qsggeometry-coloredpoint2d-members.html
  7432. share/doc/qt5/qtquick/qsggeometry-coloredpoint2d.html
  7433. share/doc/qt5/qtquick/qsggeometry-members.html
  7434. share/doc/qt5/qtquick/qsggeometry-point2d-members.html
  7435. share/doc/qt5/qtquick/qsggeometry-point2d.html
  7436. share/doc/qt5/qtquick/qsggeometry-texturedpoint2d-members.html
  7437. share/doc/qt5/qtquick/qsggeometry-texturedpoint2d.html
  7438. share/doc/qt5/qtquick/qsggeometry.html
  7439. share/doc/qt5/qtquick/qsggeometrynode-members.html
  7440. share/doc/qt5/qtquick/qsggeometrynode.html
  7441. share/doc/qt5/qtquick/qsgimagenode-members.html
  7442. share/doc/qt5/qtquick/qsgimagenode.html
  7443. share/doc/qt5/qtquick/qsgmaterial-members.html
  7444. share/doc/qt5/qtquick/qsgmaterial.html
  7445. share/doc/qt5/qtquick/qsgmaterialshader-members.html
  7446. share/doc/qt5/qtquick/qsgmaterialshader-renderstate-members.html
  7447. share/doc/qt5/qtquick/qsgmaterialshader-renderstate.html
  7448. share/doc/qt5/qtquick/qsgmaterialshader.html
  7449. share/doc/qt5/qtquick/qsgmaterialtype.html
  7450. share/doc/qt5/qtquick/qsgnode-members.html
  7451. share/doc/qt5/qtquick/qsgnode.html
  7452. share/doc/qt5/qtquick/qsgopacitynode-members.html
  7453. share/doc/qt5/qtquick/qsgopacitynode.html
  7454. share/doc/qt5/qtquick/qsgopaquetexturematerial-members.html
  7455. share/doc/qt5/qtquick/qsgopaquetexturematerial.html
  7456. share/doc/qt5/qtquick/qsgrectanglenode-members.html
  7457. share/doc/qt5/qtquick/qsgrectanglenode.html
  7458. share/doc/qt5/qtquick/qsgrendererinterface-members.html
  7459. share/doc/qt5/qtquick/qsgrendererinterface.html
  7460. share/doc/qt5/qtquick/qsgrendernode-members.html
  7461. share/doc/qt5/qtquick/qsgrendernode-renderstate-members.html
  7462. share/doc/qt5/qtquick/qsgrendernode-renderstate.html
  7463. share/doc/qt5/qtquick/qsgrendernode.html
  7464. share/doc/qt5/qtquick/qsgsimplematerial-members.html
  7465. share/doc/qt5/qtquick/qsgsimplematerial.html
  7466. share/doc/qt5/qtquick/qsgsimplematerialshader-members.html
  7467. share/doc/qt5/qtquick/qsgsimplematerialshader.html
  7468. share/doc/qt5/qtquick/qsgsimplerectnode-members.html
  7469. share/doc/qt5/qtquick/qsgsimplerectnode.html
  7470. share/doc/qt5/qtquick/qsgsimpletexturenode-members.html
  7471. share/doc/qt5/qtquick/qsgsimpletexturenode.html
  7472. share/doc/qt5/qtquick/qsgtexture-members.html
  7473. share/doc/qt5/qtquick/qsgtexture.html
  7474. share/doc/qt5/qtquick/qsgtexturematerial-members.html
  7475. share/doc/qt5/qtquick/qsgtexturematerial.html
  7476. share/doc/qt5/qtquick/qsgtextureprovider-members.html
  7477. share/doc/qt5/qtquick/qsgtextureprovider.html
  7478. share/doc/qt5/qtquick/qsgtransformnode-members.html
  7479. share/doc/qt5/qtquick/qsgtransformnode.html
  7480. share/doc/qt5/qtquick/qsgvertexcolormaterial-members.html
  7481. share/doc/qt5/qtquick/qsgvertexcolormaterial.html
  7482. share/doc/qt5/qtquick/qt-labs-folderlistmodel-qmlmodule.html
  7483. share/doc/qt5/qtquick/qt-labs-settings-qmlmodule.html
  7484. share/doc/qt5/qtquick/qt-labs-sharedimage-qmlmodule.html
  7485. share/doc/qt5/qtquick/qtquick-animation-animation-pro.html
  7486. share/doc/qt5/qtquick/qtquick-animation-animation-qml.html
  7487. share/doc/qt5/qtquick/qtquick-animation-animation-qmlproject.html
  7488. share/doc/qt5/qtquick/qtquick-animation-animation-qrc.html
  7489. share/doc/qt5/qtquick/qtquick-animation-basics-animators-qml.html
  7490. share/doc/qt5/qtquick/qtquick-animation-basics-color-animation-qml.html
  7491. share/doc/qt5/qtquick/qtquick-animation-basics-property-animation-qml.html
  7492. share/doc/qt5/qtquick/qtquick-animation-behaviors-behavior-example-qml.html
  7493. share/doc/qt5/qtquick/qtquick-animation-behaviors-siderect-qml.html
  7494. share/doc/qt5/qtquick/qtquick-animation-behaviors-tvtennis-qml.html
  7495. share/doc/qt5/qtquick/qtquick-animation-behaviors-wigglytext-qml.html
  7496. share/doc/qt5/qtquick/qtquick-animation-easing-easing-qml.html
  7497. share/doc/qt5/qtquick/qtquick-animation-example.html
  7498. share/doc/qt5/qtquick/qtquick-animation-main-cpp.html
  7499. share/doc/qt5/qtquick/qtquick-animation-pathanimation-pathanimation-qml.html
  7500. share/doc/qt5/qtquick/qtquick-animation-pathinterpolator-pathinterpolator-qml.html
  7501. share/doc/qt5/qtquick/qtquick-animation-states-states-qml.html
  7502. share/doc/qt5/qtquick/qtquick-animation-states-transitions-qml.html
  7503. share/doc/qt5/qtquick/qtquick-canvas-beziercurve-beziercurve-qml.html
  7504. share/doc/qt5/qtquick/qtquick-canvas-canvas-pro.html
  7505. share/doc/qt5/qtquick/qtquick-canvas-canvas-qml.html
  7506. share/doc/qt5/qtquick/qtquick-canvas-canvas-qrc.html
  7507. share/doc/qt5/qtquick/qtquick-canvas-clip-clip-qml.html
  7508. share/doc/qt5/qtquick/qtquick-canvas-example.html
  7509. share/doc/qt5/qtquick/qtquick-canvas-main-cpp.html
  7510. share/doc/qt5/qtquick/qtquick-canvas-quadraticcurveto-quadraticcurveto-qml.html
  7511. share/doc/qt5/qtquick/qtquick-canvas-roundedrect-roundedrect-qml.html
  7512. share/doc/qt5/qtquick/qtquick-canvas-smile-smile-qml.html
  7513. share/doc/qt5/qtquick/qtquick-canvas-squircle-squircle-qml.html
  7514. share/doc/qt5/qtquick/qtquick-canvas-tiger-tiger-js.html
  7515. share/doc/qt5/qtquick/qtquick-canvas-tiger-tiger-qml.html
  7516. share/doc/qt5/qtquick/qtquick-codesamples.html
  7517. share/doc/qt5/qtquick/qtquick-convenience-topic.html
  7518. share/doc/qt5/qtquick/qtquick-cppextensionpoints.html
  7519. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-content-dial-qml.html
  7520. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-content-quitbutton-qml.html
  7521. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-pro.html
  7522. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qml.html
  7523. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qmlproject.html
  7524. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qrc.html
  7525. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-example.html
  7526. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-main-cpp.html
  7527. share/doc/qt5/qtquick/qtquick-customitems-flipable-content-card-qml.html
  7528. share/doc/qt5/qtquick/qtquick-customitems-flipable-example.html
  7529. share/doc/qt5/qtquick/qtquick-customitems-flipable-flipable-qml.html
  7530. share/doc/qt5/qtquick/qtquick-customitems-flipable-flipable-qmlproject.html
  7531. share/doc/qt5/qtquick/qtquick-customitems-painteditem-example.html
  7532. share/doc/qt5/qtquick/qtquick-customitems-painteditem-painteditem-pro.html
  7533. share/doc/qt5/qtquick/qtquick-customitems-painteditem-painteditem-qrc.html
  7534. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoon-cpp.html
  7535. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoon-h.html
  7536. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoonplugin-plugin-h.html
  7537. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoonplugin-qmldir.html
  7538. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoons-qml.html
  7539. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-example.html
  7540. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-main-qml.html
  7541. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-scrollbar-qml.html
  7542. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-scrollbar-qmlproject.html
  7543. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-example.html
  7544. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-main-qml.html
  7545. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-tabwidget-qml.html
  7546. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-tabwidget-qmlproject.html
  7547. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-pro.html
  7548. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-qml.html
  7549. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-qmlproject.html
  7550. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-qrc.html
  7551. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-button-qml.html
  7552. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-calculator-js.html
  7553. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-display-qml.html
  7554. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-numberpad-qml.html
  7555. share/doc/qt5/qtquick/qtquick-demos-calqlatr-example.html
  7556. share/doc/qt5/qtquick/qtquick-demos-calqlatr-main-cpp.html
  7557. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-pro.html
  7558. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-qml.html
  7559. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-qmlproject.html
  7560. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-qrc.html
  7561. share/doc/qt5/qtquick/qtquick-demos-clocks-content-clock-qml.html
  7562. share/doc/qt5/qtquick/qtquick-demos-clocks-example.html
  7563. share/doc/qt5/qtquick/qtquick-demos-clocks-main-cpp.html
  7564. share/doc/qt5/qtquick/qtquick-demos-maroon-content-buildbutton-qml.html
  7565. share/doc/qt5/qtquick/qtquick-demos-maroon-content-gamecanvas-qml.html
  7566. share/doc/qt5/qtquick/qtquick-demos-maroon-content-gameoverscreen-qml.html
  7567. share/doc/qt5/qtquick/qtquick-demos-maroon-content-infobar-qml.html
  7568. share/doc/qt5/qtquick/qtquick-demos-maroon-content-logic-js.html
  7569. share/doc/qt5/qtquick/qtquick-demos-maroon-content-mobs-mobbase-qml.html
  7570. share/doc/qt5/qtquick/qtquick-demos-maroon-content-newgamescreen-qml.html
  7571. share/doc/qt5/qtquick/qtquick-demos-maroon-content-soundeffect-qml.html
  7572. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-bomb-qml.html
  7573. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-factory-qml.html
  7574. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-melee-qml.html
  7575. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-ranged-qml.html
  7576. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-towerbase-qml.html
  7577. share/doc/qt5/qtquick/qtquick-demos-maroon-example.html
  7578. share/doc/qt5/qtquick/qtquick-demos-maroon-main-cpp.html
  7579. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-pro.html
  7580. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-qml.html
  7581. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-qmlproject.html
  7582. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-qrc.html
  7583. share/doc/qt5/qtquick/qtquick-demos-photosurface-example.html
  7584. share/doc/qt5/qtquick/qtquick-demos-photosurface-main-cpp.html
  7585. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-pro.html
  7586. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-qml.html
  7587. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-qmlproject.html
  7588. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-qrc.html
  7589. share/doc/qt5/qtquick/qtquick-demos-photoviewer-example.html
  7590. share/doc/qt5/qtquick/qtquick-demos-photoviewer-i18n-qml-de-qm.html
  7591. share/doc/qt5/qtquick/qtquick-demos-photoviewer-i18n-qml-fr-qm.html
  7592. share/doc/qt5/qtquick/qtquick-demos-photoviewer-main-cpp.html
  7593. share/doc/qt5/qtquick/qtquick-demos-photoviewer-main-qml.html
  7594. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewer-pro.html
  7595. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-albumdelegate-qml.html
  7596. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-busyindicator-qml.html
  7597. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-button-qml.html
  7598. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-editablebutton-qml.html
  7599. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-photodelegate-qml.html
  7600. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-progressbar-qml.html
  7601. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-rssmodel-qml.html
  7602. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-script-script-js.html
  7603. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-tag-qml.html
  7604. share/doc/qt5/qtquick/qtquick-demos-photoviewer-qml-qrc.html
  7605. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-busyindicator-qml.html
  7606. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-categorydelegate-qml.html
  7607. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-newsdelegate-qml.html
  7608. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-rssfeeds-qml.html
  7609. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-scrollbar-qml.html
  7610. share/doc/qt5/qtquick/qtquick-demos-rssnews-example.html
  7611. share/doc/qt5/qtquick/qtquick-demos-rssnews-main-cpp.html
  7612. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-pro.html
  7613. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-qml.html
  7614. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-qmlproject.html
  7615. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-qrc.html
  7616. share/doc/qt5/qtquick/qtquick-demos-samegame-content-block-qml.html
  7617. share/doc/qt5/qtquick/qtquick-demos-samegame-content-blockemitter-qml.html
  7618. share/doc/qt5/qtquick/qtquick-demos-samegame-content-button-qml.html
  7619. share/doc/qt5/qtquick/qtquick-demos-samegame-content-gamearea-qml.html
  7620. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level0-qml.html
  7621. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level1-qml.html
  7622. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level2-qml.html
  7623. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level3-qml.html
  7624. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level4-qml.html
  7625. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level5-qml.html
  7626. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level6-qml.html
  7627. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level7-qml.html
  7628. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level8-qml.html
  7629. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level9-qml.html
  7630. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-templatebase-qml.html
  7631. share/doc/qt5/qtquick/qtquick-demos-samegame-content-logoanimation-qml.html
  7632. share/doc/qt5/qtquick/qtquick-demos-samegame-content-menuemitter-qml.html
  7633. share/doc/qt5/qtquick/qtquick-demos-samegame-content-paintemitter-qml.html
  7634. share/doc/qt5/qtquick/qtquick-demos-samegame-content-primarypack-qml.html
  7635. share/doc/qt5/qtquick/qtquick-demos-samegame-content-puzzleblock-qml.html
  7636. share/doc/qt5/qtquick/qtquick-demos-samegame-content-qmldir.html
  7637. share/doc/qt5/qtquick/qtquick-demos-samegame-content-samegame-js.html
  7638. share/doc/qt5/qtquick/qtquick-demos-samegame-content-samegametext-qml.html
  7639. share/doc/qt5/qtquick/qtquick-demos-samegame-content-settings-qml.html
  7640. share/doc/qt5/qtquick/qtquick-demos-samegame-content-simpleblock-qml.html
  7641. share/doc/qt5/qtquick/qtquick-demos-samegame-content-smoketext-qml.html
  7642. share/doc/qt5/qtquick/qtquick-demos-samegame-example.html
  7643. share/doc/qt5/qtquick/qtquick-demos-samegame-main-cpp.html
  7644. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-pro.html
  7645. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-qml.html
  7646. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-qmlproject.html
  7647. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-qrc.html
  7648. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-banner-qml.html
  7649. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-button-qml.html
  7650. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-checkbox-qml.html
  7651. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-qmldir.html
  7652. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-settings-qml.html
  7653. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockchart-qml.html
  7654. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockinfo-qml.html
  7655. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocklistdelegate-qml.html
  7656. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocklistmodel-qml.html
  7657. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocklistview-qml.html
  7658. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockmodel-qml.html
  7659. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocksettingspanel-qml.html
  7660. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockview-qml.html
  7661. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-windows-settings-qml.html
  7662. share/doc/qt5/qtquick/qtquick-demos-stocqt-example.html
  7663. share/doc/qt5/qtquick/qtquick-demos-stocqt-main-cpp.html
  7664. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-pro.html
  7665. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-qml.html
  7666. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-qmlproject.html
  7667. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-qrc.html
  7668. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-flipbar-qml.html
  7669. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-lineinput-qml.html
  7670. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-listfooter-qml.html
  7671. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-listheader-qml.html
  7672. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-searchdelegate-qml.html
  7673. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-tweetdelegate-qml.html
  7674. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-tweetsearch-js.html
  7675. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-tweetsmodel-qml.html
  7676. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-example.html
  7677. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-main-cpp.html
  7678. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-pro.html
  7679. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-qml.html
  7680. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-qmlproject.html
  7681. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-qrc.html
  7682. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-pro.html
  7683. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qml.html
  7684. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qmlproject.html
  7685. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qrc.html
  7686. share/doc/qt5/qtquick/qtquick-draganddrop-example.html
  7687. share/doc/qt5/qtquick/qtquick-draganddrop-main-cpp.html
  7688. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-dragtile-qml.html
  7689. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-droptile-qml.html
  7690. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-tiles-qml.html
  7691. share/doc/qt5/qtquick/qtquick-draganddrop-views-gridview-qml.html
  7692. share/doc/qt5/qtquick/qtquick-effects-particles.html
  7693. share/doc/qt5/qtquick/qtquick-effects-sprites.html
  7694. share/doc/qt5/qtquick/qtquick-effects-topic.html
  7695. share/doc/qt5/qtquick/qtquick-effects-transformations.html
  7696. share/doc/qt5/qtquick/qtquick-externaldraganddrop-draganddroptextitem-qml.html
  7697. share/doc/qt5/qtquick/qtquick-externaldraganddrop-example.html
  7698. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-pro.html
  7699. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qml.html
  7700. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qmlproject.html
  7701. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qrc.html
  7702. share/doc/qt5/qtquick/qtquick-externaldraganddrop-main-cpp.html
  7703. share/doc/qt5/qtquick/qtquick-imageelements-animatedsprite-qml.html
  7704. share/doc/qt5/qtquick/qtquick-imageelements-borderimage-qml.html
  7705. share/doc/qt5/qtquick/qtquick-imageelements-content-borderimageselector-qml.html
  7706. share/doc/qt5/qtquick/qtquick-imageelements-content-imagecell-qml.html
  7707. share/doc/qt5/qtquick/qtquick-imageelements-content-myborderimage-qml.html
  7708. share/doc/qt5/qtquick/qtquick-imageelements-content-shadowrectangle-qml.html
  7709. share/doc/qt5/qtquick/qtquick-imageelements-example.html
  7710. share/doc/qt5/qtquick/qtquick-imageelements-image-qml.html
  7711. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-pro.html
  7712. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qml.html
  7713. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qmlproject.html
  7714. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qrc.html
  7715. share/doc/qt5/qtquick/qtquick-imageelements-main-cpp.html
  7716. share/doc/qt5/qtquick/qtquick-imageelements-shadows-qml.html
  7717. share/doc/qt5/qtquick/qtquick-imageelements-spritesequence-qml.html
  7718. share/doc/qt5/qtquick/qtquick-imageprovider-example.html
  7719. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-cpp.html
  7720. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-example-qml.html
  7721. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-pro.html
  7722. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-qmlproject.html
  7723. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovidercore-qmldir.html
  7724. share/doc/qt5/qtquick/qtquick-imageresponseprovider-example.html
  7725. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-cpp.html
  7726. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-example-qml.html
  7727. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-pro.html
  7728. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-qmlproject.html
  7729. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovidercore-qmldir.html
  7730. share/doc/qt5/qtquick/qtquick-index.html
  7731. share/doc/qt5/qtquick/qtquick-input-focus.html
  7732. share/doc/qt5/qtquick/qtquick-input-mouseevents.html
  7733. share/doc/qt5/qtquick/qtquick-input-textinput.html
  7734. share/doc/qt5/qtquick/qtquick-input-topic.html
  7735. share/doc/qt5/qtquick/qtquick-keyinteraction-example.html
  7736. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-contextmenu-qml.html
  7737. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-gridmenu-qml.html
  7738. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-listmenu-qml.html
  7739. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-listviewdelegate-qml.html
  7740. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-tabmenu-qml.html
  7741. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-focus-qml.html
  7742. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-pro.html
  7743. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qml.html
  7744. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qmlproject.html
  7745. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qrc.html
  7746. share/doc/qt5/qtquick/qtquick-keyinteraction-main-cpp.html
  7747. share/doc/qt5/qtquick/qtquick-layouts-example.html
  7748. share/doc/qt5/qtquick/qtquick-layouts-layouts-pro.html
  7749. share/doc/qt5/qtquick/qtquick-layouts-layouts-qml.html
  7750. share/doc/qt5/qtquick/qtquick-layouts-layouts-qmlproject.html
  7751. share/doc/qt5/qtquick/qtquick-layouts-layouts-qrc.html
  7752. share/doc/qt5/qtquick/qtquick-layouts-main-cpp.html
  7753. share/doc/qt5/qtquick/qtquick-layouts-qmlmodule.html
  7754. share/doc/qt5/qtquick/qtquick-localstorage-example.html
  7755. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-database-js.html
  7756. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-header-qml.html
  7757. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-pro.html
  7758. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-qml.html
  7759. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-qrc.html
  7760. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-main-cpp.html
  7761. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mybutton-qml.html
  7762. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mydelegate-qml.html
  7763. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mymodel-qml.html
  7764. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-pro.html
  7765. share/doc/qt5/qtquick/qtquick-localstorage-qmlmodule.html
  7766. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-pro.html
  7767. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-qrc.html
  7768. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-example.html
  7769. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-main-cpp.html
  7770. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-model-cpp.html
  7771. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-model-h.html
  7772. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-view-qml.html
  7773. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-dataobject-cpp.html
  7774. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-dataobject-h.html
  7775. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-example.html
  7776. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-main-cpp.html
  7777. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-objectlistmodel-pro.html
  7778. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-objectlistmodel-qrc.html
  7779. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-view-qml.html
  7780. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-example.html
  7781. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-main-cpp.html
  7782. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-stringlistmodel-pro.html
  7783. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-stringlistmodel-qrc.html
  7784. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-view-qml.html
  7785. share/doc/qt5/qtquick/qtquick-modelviewsdata-cppmodels.html
  7786. share/doc/qt5/qtquick/qtquick-modelviewsdata-modelview.html
  7787. share/doc/qt5/qtquick/qtquick-modelviewsdata-topic.html
  7788. share/doc/qt5/qtquick/qtquick-module.html
  7789. share/doc/qt5/qtquick/qtquick-mousearea-example.html
  7790. share/doc/qt5/qtquick/qtquick-mousearea-main-cpp.html
  7791. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-pro.html
  7792. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qml.html
  7793. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qmlproject.html
  7794. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qrc.html
  7795. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-wheel-example-qml.html
  7796. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-pro.html
  7797. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qml.html
  7798. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qmlproject.html
  7799. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qrc.html
  7800. share/doc/qt5/qtquick/qtquick-particles-affectors-content-age-qml.html
  7801. share/doc/qt5/qtquick/qtquick-particles-affectors-content-attractor-qml.html
  7802. share/doc/qt5/qtquick/qtquick-particles-affectors-content-customaffector-qml.html
  7803. share/doc/qt5/qtquick/qtquick-particles-affectors-content-friction-qml.html
  7804. share/doc/qt5/qtquick/qtquick-particles-affectors-content-gravity-qml.html
  7805. share/doc/qt5/qtquick/qtquick-particles-affectors-content-greybutton-qml.html
  7806. share/doc/qt5/qtquick/qtquick-particles-affectors-content-groupgoal-qml.html
  7807. share/doc/qt5/qtquick/qtquick-particles-affectors-content-move-qml.html
  7808. share/doc/qt5/qtquick/qtquick-particles-affectors-content-spritegoal-qml.html
  7809. share/doc/qt5/qtquick/qtquick-particles-affectors-content-turbulence-qml.html
  7810. share/doc/qt5/qtquick/qtquick-particles-affectors-content-wander-qml.html
  7811. share/doc/qt5/qtquick/qtquick-particles-affectors-example.html
  7812. share/doc/qt5/qtquick/qtquick-particles-affectors-main-cpp.html
  7813. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-blurparticles-qml.html
  7814. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-fragmentshader-qml.html
  7815. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-imagecolors-qml.html
  7816. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-pro.html
  7817. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qml.html
  7818. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qmlproject.html
  7819. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qrc.html
  7820. share/doc/qt5/qtquick/qtquick-particles-customparticle-example.html
  7821. share/doc/qt5/qtquick/qtquick-particles-customparticle-main-cpp.html
  7822. share/doc/qt5/qtquick/qtquick-particles-emitters-content-burstandpulse-qml.html
  7823. share/doc/qt5/qtquick/qtquick-particles-emitters-content-customemitter-qml.html
  7824. share/doc/qt5/qtquick/qtquick-particles-emitters-content-emitmask-qml.html
  7825. share/doc/qt5/qtquick/qtquick-particles-emitters-content-maximumemitted-qml.html
  7826. share/doc/qt5/qtquick/qtquick-particles-emitters-content-shapeanddirection-qml.html
  7827. share/doc/qt5/qtquick/qtquick-particles-emitters-content-trailemitter-qml.html
  7828. share/doc/qt5/qtquick/qtquick-particles-emitters-content-velocityfrommotion-qml.html
  7829. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-pro.html
  7830. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qml.html
  7831. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qmlproject.html
  7832. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qrc.html
  7833. share/doc/qt5/qtquick/qtquick-particles-emitters-example.html
  7834. share/doc/qt5/qtquick/qtquick-particles-emitters-main-cpp.html
  7835. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-allatonce-qml.html
  7836. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-colored-qml.html
  7837. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-colortable-qml.html
  7838. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-deformation-qml.html
  7839. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-rotation-qml.html
  7840. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-sharing-qml.html
  7841. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-sprites-qml.html
  7842. share/doc/qt5/qtquick/qtquick-particles-imageparticle-example.html
  7843. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-pro.html
  7844. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qml.html
  7845. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qmlproject.html
  7846. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qrc.html
  7847. share/doc/qt5/qtquick/qtquick-particles-imageparticle-main-cpp.html
  7848. share/doc/qt5/qtquick/qtquick-particles-performance.html
  7849. share/doc/qt5/qtquick/qtquick-particles-qmlmodule.html
  7850. share/doc/qt5/qtquick/qtquick-particles-system-content-dynamiccomparison-qml.html
  7851. share/doc/qt5/qtquick/qtquick-particles-system-content-dynamicemitters-qml.html
  7852. share/doc/qt5/qtquick/qtquick-particles-system-content-multiplepainters-qml.html
  7853. share/doc/qt5/qtquick/qtquick-particles-system-content-startstop-qml.html
  7854. share/doc/qt5/qtquick/qtquick-particles-system-content-timedgroupchanges-qml.html
  7855. share/doc/qt5/qtquick/qtquick-particles-system-example.html
  7856. share/doc/qt5/qtquick/qtquick-particles-system-main-cpp.html
  7857. share/doc/qt5/qtquick/qtquick-particles-system-system-pro.html
  7858. share/doc/qt5/qtquick/qtquick-particles-system-system-qml.html
  7859. share/doc/qt5/qtquick/qtquick-particles-system-system-qmlproject.html
  7860. share/doc/qt5/qtquick/qtquick-particles-system-system-qrc.html
  7861. share/doc/qt5/qtquick/qtquick-positioners-example.html
  7862. share/doc/qt5/qtquick/qtquick-positioners-main-cpp.html
  7863. share/doc/qt5/qtquick/qtquick-positioners-positioners-attachedproperties-qml.html
  7864. share/doc/qt5/qtquick/qtquick-positioners-positioners-pro.html
  7865. share/doc/qt5/qtquick/qtquick-positioners-positioners-qml.html
  7866. share/doc/qt5/qtquick/qtquick-positioners-positioners-qmlproject.html
  7867. share/doc/qt5/qtquick/qtquick-positioners-positioners-qrc.html
  7868. share/doc/qt5/qtquick/qtquick-positioners-positioners-transitions-qml.html
  7869. share/doc/qt5/qtquick/qtquick-positioning-anchors.html
  7870. share/doc/qt5/qtquick/qtquick-positioning-layouts.html
  7871. share/doc/qt5/qtquick/qtquick-positioning-righttoleft.html
  7872. share/doc/qt5/qtquick/qtquick-positioning-topic.html
  7873. share/doc/qt5/qtquick/qtquick-qmlmodule.html
  7874. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qml.html
  7875. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qmlproject.html
  7876. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qrc.html
  7877. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-button-qml.html
  7878. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-checkbox-qml.html
  7879. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-slider-qml.html
  7880. share/doc/qt5/qtquick/qtquick-quick-accessibility-example.html
  7881. share/doc/qt5/qtquick/qtquick-quick-accessibility-main-cpp.html
  7882. share/doc/qt5/qtquick/qtquick-quick-accessibility-quick-accessibility-pro.html
  7883. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-customgl-qml.html
  7884. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-example.html
  7885. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-fbitem-cpp.html
  7886. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-fbitem-h.html
  7887. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-main-cpp.html
  7888. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-pro.html
  7889. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-qrc.html
  7890. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquare-qml.html
  7891. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquaretab-qml.html
  7892. share/doc/qt5/qtquick/qtquick-rendercontrol-cuberenderer-cpp.html
  7893. share/doc/qt5/qtquick/qtquick-rendercontrol-cuberenderer-h.html
  7894. share/doc/qt5/qtquick/qtquick-rendercontrol-demo-qml.html
  7895. share/doc/qt5/qtquick/qtquick-rendercontrol-example.html
  7896. share/doc/qt5/qtquick/qtquick-rendercontrol-main-cpp.html
  7897. share/doc/qt5/qtquick/qtquick-rendercontrol-rendercontrol-pro.html
  7898. share/doc/qt5/qtquick/qtquick-rendercontrol-rendercontrol-qrc.html
  7899. share/doc/qt5/qtquick/qtquick-rendercontrol-window-multithreaded-cpp.html
  7900. share/doc/qt5/qtquick/qtquick-rendercontrol-window-multithreaded-h.html
  7901. share/doc/qt5/qtquick/qtquick-rendercontrol-window-singlethreaded-cpp.html
  7902. share/doc/qt5/qtquick/qtquick-rendercontrol-window-singlethreaded-h.html
  7903. share/doc/qt5/qtquick/qtquick-righttoleft-example.html
  7904. share/doc/qt5/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qml.html
  7905. share/doc/qt5/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qmlproject.html
  7906. share/doc/qt5/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qml.html
  7907. share/doc/qt5/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qmlproject.html
  7908. share/doc/qt5/qtquick/qtquick-righttoleft-main-cpp.html
  7909. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-pro.html
  7910. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qml.html
  7911. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qmlproject.html
  7912. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qrc.html
  7913. share/doc/qt5/qtquick/qtquick-righttoleft-textalignment-textalignment-qml.html
  7914. share/doc/qt5/qtquick/qtquick-righttoleft-textalignment-textalignment-qmlproject.html
  7915. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-beziercurve-cpp.html
  7916. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-beziercurve-h.html
  7917. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-customgeometry-pro.html
  7918. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-customgeometry-qrc.html
  7919. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-example.html
  7920. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-main-cpp.html
  7921. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-main-qml.html
  7922. share/doc/qt5/qtquick/qtquick-scenegraph-graph-example.html
  7923. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-cpp.html
  7924. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-h.html
  7925. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-pro.html
  7926. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-qrc.html
  7927. share/doc/qt5/qtquick/qtquick-scenegraph-graph-gridnode-cpp.html
  7928. share/doc/qt5/qtquick/qtquick-scenegraph-graph-gridnode-h.html
  7929. share/doc/qt5/qtquick/qtquick-scenegraph-graph-linenode-cpp.html
  7930. share/doc/qt5/qtquick/qtquick-scenegraph-graph-linenode-h.html
  7931. share/doc/qt5/qtquick/qtquick-scenegraph-graph-main-cpp.html
  7932. share/doc/qt5/qtquick/qtquick-scenegraph-graph-main-qml.html
  7933. share/doc/qt5/qtquick/qtquick-scenegraph-graph-noisynode-cpp.html
  7934. share/doc/qt5/qtquick/qtquick-scenegraph-graph-noisynode-h.html
  7935. share/doc/qt5/qtquick/qtquick-scenegraph-materials.html
  7936. share/doc/qt5/qtquick/qtquick-scenegraph-nodes.html
  7937. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-example.html
  7938. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-main-cpp.html
  7939. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-main-qml.html
  7940. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-pro.html
  7941. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-qrc.html
  7942. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-squircle-cpp.html
  7943. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-squircle-h.html
  7944. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-example.html
  7945. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-main-qml.html
  7946. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-cpp.html
  7947. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-pro.html
  7948. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-qrc.html
  7949. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-example.html
  7950. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-cpp.html
  7951. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-h.html
  7952. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-main-cpp.html
  7953. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-main-qml.html
  7954. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-pro.html
  7955. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-qrc.html
  7956. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-error-qml.html
  7957. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-example.html
  7958. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-main-cpp.html
  7959. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-main-qml.html
  7960. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-textureinthread-pro.html
  7961. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-textureinthread-qrc.html
  7962. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-cpp.html
  7963. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-h.html
  7964. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-example.html
  7965. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-main-cpp.html
  7966. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-main-qml.html
  7967. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-pro.html
  7968. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-qrc.html
  7969. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-cpp.html
  7970. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-h.html
  7971. share/doc/qt5/qtquick/qtquick-shadereffects-content-slider-qml.html
  7972. share/doc/qt5/qtquick/qtquick-shadereffects-example.html
  7973. share/doc/qt5/qtquick/qtquick-shadereffects-main-cpp.html
  7974. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-pro.html
  7975. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qml.html
  7976. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qmlproject.html
  7977. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qrc.html
  7978. share/doc/qt5/qtquick/qtquick-statesanimations-animations.html
  7979. share/doc/qt5/qtquick/qtquick-statesanimations-behaviors.html
  7980. share/doc/qt5/qtquick/qtquick-statesanimations-states.html
  7981. share/doc/qt5/qtquick/qtquick-statesanimations-topic.html
  7982. share/doc/qt5/qtquick/qtquick-text-example.html
  7983. share/doc/qt5/qtquick/qtquick-text-fonts-availablefonts-qml.html
  7984. share/doc/qt5/qtquick/qtquick-text-fonts-banner-qml.html
  7985. share/doc/qt5/qtquick/qtquick-text-fonts-fonts-qml.html
  7986. share/doc/qt5/qtquick/qtquick-text-fonts-hello-qml.html
  7987. share/doc/qt5/qtquick/qtquick-text-imgtag-imgtag-qml.html
  7988. share/doc/qt5/qtquick/qtquick-text-imgtag-textwithimage-qml.html
  7989. share/doc/qt5/qtquick/qtquick-text-main-cpp.html
  7990. share/doc/qt5/qtquick/qtquick-text-styledtext-layout-qml.html
  7991. share/doc/qt5/qtquick/qtquick-text-text-pro.html
  7992. share/doc/qt5/qtquick/qtquick-text-text-qml.html
  7993. share/doc/qt5/qtquick/qtquick-text-text-qmlproject.html
  7994. share/doc/qt5/qtquick/qtquick-text-text-qrc.html
  7995. share/doc/qt5/qtquick/qtquick-text-textselection-textselection-qml.html
  7996. share/doc/qt5/qtquick/qtquick-text-validator.html
  7997. share/doc/qt5/qtquick/qtquick-threading-example.html
  7998. share/doc/qt5/qtquick/qtquick-threading-main-cpp.html
  7999. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-dataloader-js.html
  8000. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-example.html
  8001. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-threadedlistmodel-qmlproject.html
  8002. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-timedisplay-qml.html
  8003. share/doc/qt5/qtquick/qtquick-threading-threading-pro.html
  8004. share/doc/qt5/qtquick/qtquick-threading-threading-qml.html
  8005. share/doc/qt5/qtquick/qtquick-threading-threading-qmlproject.html
  8006. share/doc/qt5/qtquick/qtquick-threading-threading-qrc.html
  8007. share/doc/qt5/qtquick/qtquick-threading-workerscript-spinner-qml.html
  8008. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-js.html
  8009. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-qml.html
  8010. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-qmlproject.html
  8011. share/doc/qt5/qtquick/qtquick-touchinteraction-example.html
  8012. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-basic-flickable-qml.html
  8013. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-content-panel-qml.html
  8014. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-corkboards-qml.html
  8015. share/doc/qt5/qtquick/qtquick-touchinteraction-main-cpp.html
  8016. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-bearwhack-qml.html
  8017. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-augmentedtouchpoint-qml.html
  8018. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-bearwhackparticlesystem-qml.html
  8019. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-particleflame-qml.html
  8020. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-multiflame-qml.html
  8021. share/doc/qt5/qtquick/qtquick-touchinteraction-pincharea-flickresize-qml.html
  8022. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-pro.html
  8023. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qml.html
  8024. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qmlproject.html
  8025. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qrc.html
  8026. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview-qml.html
  8027. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview1-qmlproject.html
  8028. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
  8029. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-petsmodel-qml.html
  8030. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview-qml.html
  8031. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview2-qmlproject.html
  8032. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
  8033. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-petsmodel-qml.html
  8034. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview-qml.html
  8035. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview3-qmlproject.html
  8036. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
  8037. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-petsmodel-qml.html
  8038. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview-qml.html
  8039. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview4-qmlproject.html
  8040. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
  8041. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-listselector-qml.html
  8042. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-petsmodel-qml.html
  8043. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-block-qml.html
  8044. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-button-qml.html
  8045. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-example.html
  8046. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-samegame-qml.html
  8047. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-samegame1-qmlproject.html
  8048. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-block-qml.html
  8049. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-button-qml.html
  8050. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-example.html
  8051. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame-js.html
  8052. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame-qml.html
  8053. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame2-qmlproject.html
  8054. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-block-qml.html
  8055. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-button-qml.html
  8056. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-dialog-qml.html
  8057. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-example.html
  8058. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame-js.html
  8059. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame-qml.html
  8060. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame3-qmlproject.html
  8061. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-boomblock-qml.html
  8062. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-button-qml.html
  8063. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-dialog-qml.html
  8064. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-samegame-js.html
  8065. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-example.html
  8066. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-highscores-score-data-xml.html
  8067. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-samegame-qml.html
  8068. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-samegame4-qmlproject.html
  8069. share/doc/qt5/qtquick/qtquick-views-example.html
  8070. share/doc/qt5/qtquick/qtquick-views-gridview-gridview-example-qml.html
  8071. share/doc/qt5/qtquick/qtquick-views-listview-content-petsmodel-qml.html
  8072. share/doc/qt5/qtquick/qtquick-views-listview-content-pressandholdbutton-qml.html
  8073. share/doc/qt5/qtquick/qtquick-views-listview-content-recipesmodel-qml.html
  8074. share/doc/qt5/qtquick/qtquick-views-listview-content-smalltext-qml.html
  8075. share/doc/qt5/qtquick/qtquick-views-listview-content-textbutton-qml.html
  8076. share/doc/qt5/qtquick/qtquick-views-listview-content-togglebutton-qml.html
  8077. share/doc/qt5/qtquick/qtquick-views-listview-displaymargin-qml.html
  8078. share/doc/qt5/qtquick/qtquick-views-listview-dynamiclist-qml.html
  8079. share/doc/qt5/qtquick/qtquick-views-listview-expandingdelegates-qml.html
  8080. share/doc/qt5/qtquick/qtquick-views-listview-highlight-qml.html
  8081. share/doc/qt5/qtquick/qtquick-views-listview-highlightranges-qml.html
  8082. share/doc/qt5/qtquick/qtquick-views-listview-sections-qml.html
  8083. share/doc/qt5/qtquick/qtquick-views-main-cpp.html
  8084. share/doc/qt5/qtquick/qtquick-views-objectmodel-objectmodel-qml.html
  8085. share/doc/qt5/qtquick/qtquick-views-package-delegate-qml.html
  8086. share/doc/qt5/qtquick/qtquick-views-package-view-qml.html
  8087. share/doc/qt5/qtquick/qtquick-views-parallax-content-clock-qml.html
  8088. share/doc/qt5/qtquick/qtquick-views-parallax-content-parallaxview-qml.html
  8089. share/doc/qt5/qtquick/qtquick-views-parallax-content-pics-home-page-svg.html
  8090. share/doc/qt5/qtquick/qtquick-views-parallax-content-quitbutton-qml.html
  8091. share/doc/qt5/qtquick/qtquick-views-parallax-content-smiley-qml.html
  8092. share/doc/qt5/qtquick/qtquick-views-parallax-parallax-qml.html
  8093. share/doc/qt5/qtquick/qtquick-views-pathview-pathview-example-qml.html
  8094. share/doc/qt5/qtquick/qtquick-views-views-pro.html
  8095. share/doc/qt5/qtquick/qtquick-views-views-qml.html
  8096. share/doc/qt5/qtquick/qtquick-views-views-qmlproject.html
  8097. share/doc/qt5/qtquick/qtquick-views-views-qrc.html
  8098. share/doc/qt5/qtquick/qtquick-views-visualdatamodel-dragselection-qml.html
  8099. share/doc/qt5/qtquick/qtquick-views-visualdatamodel-slideshow-qml.html
  8100. share/doc/qt5/qtquick/qtquick-views-visualdatamodel-visualdatamodel-qmlproject.html
  8101. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-d3d12.html
  8102. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-openvg.html
  8103. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-software.html
  8104. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations.html
  8105. share/doc/qt5/qtquick/qtquick-visualcanvas-coordinates.html
  8106. share/doc/qt5/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
  8107. share/doc/qt5/qtquick/qtquick-visualcanvas-scenegraph.html
  8108. share/doc/qt5/qtquick/qtquick-visualcanvas-topic.html
  8109. share/doc/qt5/qtquick/qtquick-visualcanvas-visualparent.html
  8110. share/doc/qt5/qtquick/qtquick-visualtypes-topic.html
  8111. share/doc/qt5/qtquick/qtquick-window-allscreens-qml.html
  8112. share/doc/qt5/qtquick/qtquick-window-currentscreen-qml.html
  8113. share/doc/qt5/qtquick/qtquick-window-example.html
  8114. share/doc/qt5/qtquick/qtquick-window-main-cpp.html
  8115. share/doc/qt5/qtquick/qtquick-window-qmlmodule.html
  8116. share/doc/qt5/qtquick/qtquick-window-resources-icon-svg.html
  8117. share/doc/qt5/qtquick/qtquick-window-splash-qml.html
  8118. share/doc/qt5/qtquick/qtquick-window-window-pro.html
  8119. share/doc/qt5/qtquick/qtquick-window-window-qml.html
  8120. share/doc/qt5/qtquick/qtquick-window-window-qrc.html
  8121. share/doc/qt5/qtquick/qtquick-xmllistmodel-qmlmodule.html
  8122. share/doc/qt5/qtquick/qtquick.index
  8123. share/doc/qt5/qtquick/qtquick.qhp
  8124. share/doc/qt5/qtquick/qtquick.qhp.sha1
  8125. share/doc/qt5/qtquick/qtquick.tags
  8126. share/doc/qt5/qtquick/qtquicklayouts-index.html
  8127. share/doc/qt5/qtquick/qtquicklayouts-overview.html
  8128. share/doc/qt5/qtquick/qtquickwidgets-module.html
  8129. share/doc/qt5/qtquick/qttest-qmlmodule.html
  8130. share/doc/qt5/qtquick/style/offline-simple.css
  8131. share/doc/qt5/qtquick/style/offline.css
  8132. share/doc/qt5/qtquickcontrols.qch
  8133. share/doc/qt5/qtquickcontrols/applicationwindow.html
  8134. share/doc/qt5/qtquickcontrols/controls.html
  8135. share/doc/qt5/qtquickcontrols/controlsstyling.html
  8136. share/doc/qt5/qtquickcontrols/examples-manifest.xml
  8137. share/doc/qt5/qtquickcontrols/images/applicationwindow.png
  8138. share/doc/qt5/qtquickcontrols/images/arrow_bc.png
  8139. share/doc/qt5/qtquickcontrols/images/bgrContent.png
  8140. share/doc/qt5/qtquickcontrols/images/btn_next.png
  8141. share/doc/qt5/qtquickcontrols/images/btn_prev.png
  8142. share/doc/qt5/qtquickcontrols/images/bullet_dn.png
  8143. share/doc/qt5/qtquickcontrols/images/bullet_sq.png
  8144. share/doc/qt5/qtquickcontrols/images/busyindicator.png
  8145. share/doc/qt5/qtquickcontrols/images/button.png
  8146. share/doc/qt5/qtquickcontrols/images/calendar.png
  8147. share/doc/qt5/qtquickcontrols/images/calendarstyle-components-week-numbers.png
  8148. share/doc/qt5/qtquickcontrols/images/checkbox.png
  8149. share/doc/qt5/qtquickcontrols/images/circulargauge-angles.png
  8150. share/doc/qt5/qtquickcontrols/images/circulargauge-needle-example-2.png
  8151. share/doc/qt5/qtquickcontrols/images/circulargauge-needle.png
  8152. share/doc/qt5/qtquickcontrols/images/circulargauge-reversed.png
  8153. share/doc/qt5/qtquickcontrols/images/circulargauge-tickmark-indices-values.png
  8154. share/doc/qt5/qtquickcontrols/images/combobox.png
  8155. share/doc/qt5/qtquickcontrols/images/gauge-minorTickmark-example.png
  8156. share/doc/qt5/qtquickcontrols/images/gauge-temperature.png
  8157. share/doc/qt5/qtquickcontrols/images/gauge-tickmark-example.png
  8158. share/doc/qt5/qtquickcontrols/images/groupbox.png
  8159. share/doc/qt5/qtquickcontrols/images/home.png
  8160. share/doc/qt5/qtquickcontrols/images/ico_note.png
  8161. share/doc/qt5/qtquickcontrols/images/ico_note_attention.png
  8162. share/doc/qt5/qtquickcontrols/images/ico_out.png
  8163. share/doc/qt5/qtquickcontrols/images/label.png
  8164. share/doc/qt5/qtquickcontrols/images/logo.png
  8165. share/doc/qt5/qtquickcontrols/images/menu.png
  8166. share/doc/qt5/qtquickcontrols/images/menubar-action.png
  8167. share/doc/qt5/qtquickcontrols/images/menubar.png
  8168. share/doc/qt5/qtquickcontrols/images/piemenu-menuitem-example.png
  8169. share/doc/qt5/qtquickcontrols/images/progressbar.png
  8170. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-calendar.png
  8171. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-filesystembrowser.png
  8172. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-gallery-android-dark.png
  8173. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-gallery-android.png
  8174. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-gallery-osx.png
  8175. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-styles.png
  8176. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-tableview.png
  8177. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-text.png
  8178. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-touch.png
  8179. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-uiforms.png
  8180. share/doc/qt5/qtquickcontrols/images/radiobutton.png
  8181. share/doc/qt5/qtquickcontrols/images/scrollview.png
  8182. share/doc/qt5/qtquickcontrols/images/slider.png
  8183. share/doc/qt5/qtquickcontrols/images/spinbox.png
  8184. share/doc/qt5/qtquickcontrols/images/splitview.png
  8185. share/doc/qt5/qtquickcontrols/images/square-blue.png
  8186. share/doc/qt5/qtquickcontrols/images/square-green.png
  8187. share/doc/qt5/qtquickcontrols/images/square-red.png
  8188. share/doc/qt5/qtquickcontrols/images/square-white.png
  8189. share/doc/qt5/qtquickcontrols/images/square-yellow.png
  8190. share/doc/qt5/qtquickcontrols/images/stackview.png
  8191. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-background-example.png
  8192. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-knob-example.png
  8193. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-minorTickmark-example.png
  8194. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-needle-example.png
  8195. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-tickmark-example.png
  8196. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-tickmarkLabel-example.png
  8197. share/doc/qt5/qtquickcontrols/images/styling-gauge-font-size.png
  8198. share/doc/qt5/qtquickcontrols/images/styling-gauge-foreground.png
  8199. share/doc/qt5/qtquickcontrols/images/styling-gauge-minorTickmark.png
  8200. share/doc/qt5/qtquickcontrols/images/styling-gauge-tickmark.png
  8201. share/doc/qt5/qtquickcontrols/images/styling-gauge-valueBar.png
  8202. share/doc/qt5/qtquickcontrols/images/switch.png
  8203. share/doc/qt5/qtquickcontrols/images/tableview.png
  8204. share/doc/qt5/qtquickcontrols/images/tabview.png
  8205. share/doc/qt5/qtquickcontrols/images/textarea.png
  8206. share/doc/qt5/qtquickcontrols/images/textfield.png
  8207. share/doc/qt5/qtquickcontrols/images/toolbar.png
  8208. share/doc/qt5/qtquickcontrols/images/treeview.png
  8209. share/doc/qt5/qtquickcontrols/images/tumbler-flat-style.png
  8210. share/doc/qt5/qtquickcontrols/images/tumbler.png
  8211. share/doc/qt5/qtquickcontrols/images/used-in-examples/calendar/images/eventindicator.png
  8212. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/bubble.png
  8213. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/button-pressed.png
  8214. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/button.png
  8215. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/progress-background.png
  8216. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/progress-fill.png
  8217. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/slider-handle.png
  8218. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/tab.png
  8219. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/tab_selected.png
  8220. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/textfield.png
  8221. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/button_default.png
  8222. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/button_pressed.png
  8223. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/navigation_next_item.png
  8224. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/navigation_previous_item.png
  8225. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/tab_selected.png
  8226. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/tabs_standard.png
  8227. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/textinput.png
  8228. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/toolbar.png
  8229. share/doc/qt5/qtquickcontrols/menus.html
  8230. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-action-members.html
  8231. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-action.html
  8232. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-applicationwindow-members.html
  8233. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-applicationwindow.html
  8234. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-busyindicator-members.html
  8235. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-busyindicator.html
  8236. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-button-members.html
  8237. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-button.html
  8238. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-calendar-members.html
  8239. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-calendar.html
  8240. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-checkbox-members.html
  8241. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-checkbox.html
  8242. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-combobox-members.html
  8243. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-combobox.html
  8244. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-exclusivegroup-members.html
  8245. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-exclusivegroup.html
  8246. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-groupbox-members.html
  8247. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-groupbox.html
  8248. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-label-members.html
  8249. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-label.html
  8250. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menu-members.html
  8251. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menu.html
  8252. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menubar-members.html
  8253. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menubar.html
  8254. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuitem-members.html
  8255. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuitem.html
  8256. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuseparator-members.html
  8257. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuseparator.html
  8258. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-progressbar-members.html
  8259. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-progressbar.html
  8260. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-radiobutton-members.html
  8261. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-radiobutton.html
  8262. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-scrollview-members.html
  8263. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-scrollview.html
  8264. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-slider-members.html
  8265. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-slider.html
  8266. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-spinbox-members.html
  8267. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-spinbox.html
  8268. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-splitview-members.html
  8269. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-splitview.html
  8270. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stack-members.html
  8271. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stack.html
  8272. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackview-members.html
  8273. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackview.html
  8274. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackviewdelegate-members.html
  8275. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackviewdelegate.html
  8276. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-statusbar-members.html
  8277. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-statusbar.html
  8278. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-applicationwindowstyle-members.html
  8279. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-applicationwindowstyle.html
  8280. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-busyindicatorstyle-members.html
  8281. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-busyindicatorstyle.html
  8282. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-buttonstyle-members.html
  8283. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-buttonstyle.html
  8284. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-calendarstyle-members.html
  8285. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-calendarstyle.html
  8286. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-checkboxstyle-members.html
  8287. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-checkboxstyle.html
  8288. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-circulargaugestyle-members.html
  8289. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-circulargaugestyle.html
  8290. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-comboboxstyle-members.html
  8291. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-comboboxstyle.html
  8292. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-delaybuttonstyle-members.html
  8293. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-delaybuttonstyle.html
  8294. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-dialstyle-members.html
  8295. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-dialstyle.html
  8296. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-gaugestyle-members.html
  8297. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-gaugestyle.html
  8298. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menubarstyle-members.html
  8299. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menubarstyle.html
  8300. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menustyle-members.html
  8301. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menustyle.html
  8302. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-piemenustyle-members.html
  8303. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-piemenustyle.html
  8304. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-progressbarstyle-members.html
  8305. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-progressbarstyle.html
  8306. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-radiobuttonstyle-members.html
  8307. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-radiobuttonstyle.html
  8308. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-scrollviewstyle-members.html
  8309. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-scrollviewstyle.html
  8310. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-sliderstyle-members.html
  8311. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-sliderstyle.html
  8312. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-spinboxstyle-members.html
  8313. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-spinboxstyle.html
  8314. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusbarstyle-members.html
  8315. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusbarstyle.html
  8316. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusindicatorstyle-members.html
  8317. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusindicatorstyle.html
  8318. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-switchstyle-members.html
  8319. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-switchstyle.html
  8320. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tableviewstyle-members.html
  8321. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tableviewstyle.html
  8322. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tabviewstyle-members.html
  8323. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tabviewstyle.html
  8324. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textareastyle-members.html
  8325. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textareastyle.html
  8326. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textfieldstyle-members.html
  8327. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textfieldstyle.html
  8328. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-togglebuttonstyle-members.html
  8329. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-togglebuttonstyle.html
  8330. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-toolbarstyle-members.html
  8331. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-toolbarstyle.html
  8332. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-treeviewstyle-members.html
  8333. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-treeviewstyle.html
  8334. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle-members.html
  8335. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle-obsolete.html
  8336. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle.html
  8337. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-switch-members.html
  8338. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-switch.html
  8339. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tab-members.html
  8340. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tab.html
  8341. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableview-members.html
  8342. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableview.html
  8343. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableviewcolumn-members.html
  8344. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableviewcolumn.html
  8345. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tabview-members.html
  8346. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tabview.html
  8347. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textarea-members.html
  8348. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textarea.html
  8349. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textfield-members.html
  8350. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textfield.html
  8351. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbar-members.html
  8352. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbar.html
  8353. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbutton-members.html
  8354. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbutton.html
  8355. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-treeview-members.html
  8356. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-treeview.html
  8357. share/doc/qt5/qtquickcontrols/qtquick-controls-qmlmodule.html
  8358. share/doc/qt5/qtquickcontrols/qtquick-controls-styles-qmlmodule.html
  8359. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-calendar-pro.html
  8360. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-example.html
  8361. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-qml-main-qml.html
  8362. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-resources-qrc.html
  8363. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-event-cpp.html
  8364. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-event-h.html
  8365. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-main-cpp.html
  8366. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-sqleventmodel-cpp.html
  8367. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-sqleventmodel-h.html
  8368. share/doc/qt5/qtquickcontrols/qtquickcontrols-examples.html
  8369. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-example.html
  8370. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-filesystembrowser-pro.html
  8371. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-main-cpp.html
  8372. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-main-qml.html
  8373. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-qml-qrc.html
  8374. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-example.html
  8375. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-pro.html
  8376. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-qrc.html
  8377. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-main-cpp.html
  8378. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-main-qml.html
  8379. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-android-ui-js.html
  8380. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-buttonpage-qml.html
  8381. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-inputpage-qml.html
  8382. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-ios-ui-js.html
  8383. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-osx-ui-js.html
  8384. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-progresspage-qml.html
  8385. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-ui-js.html
  8386. share/doc/qt5/qtquickcontrols/qtquickcontrols-index.html
  8387. share/doc/qt5/qtquickcontrols/qtquickcontrols-overview.html
  8388. share/doc/qt5/qtquickcontrols/qtquickcontrols-platformnotes.html
  8389. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-example.html
  8390. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-main-cpp.html
  8391. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-main-qml.html
  8392. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-styles-pro.html
  8393. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-styles-qrc.html
  8394. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-example.html
  8395. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-main-qml.html
  8396. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-src-main-cpp.html
  8397. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-src-sortfilterproxymodel-cpp.html
  8398. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-src-sortfilterproxymodel-h.html
  8399. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-tableview-pro.html
  8400. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-tableview-qrc.html
  8401. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-example.html
  8402. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qml-main-qml.html
  8403. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qml-toolbarseparator-qml.html
  8404. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-resources-qrc.html
  8405. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-src-documenthandler-cpp.html
  8406. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-src-documenthandler-h.html
  8407. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-src-main-cpp.html
  8408. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-texteditor-pro.html
  8409. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-androiddelegate-qml.html
  8410. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-buttonpage-qml.html
  8411. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-listpage-qml.html
  8412. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-progressbarpage-qml.html
  8413. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-sliderpage-qml.html
  8414. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-tabbarpage-qml.html
  8415. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-textinputpage-qml.html
  8416. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-example.html
  8417. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-main-qml.html
  8418. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-resources-qrc.html
  8419. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-src-main-cpp.html
  8420. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-touch-pro.html
  8421. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-touch-qmlproject.html
  8422. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-example.html
  8423. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-main-cpp.html
  8424. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-main-qml.html
  8425. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-mainform-ui-qml.html
  8426. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-customermodel-qml.html
  8427. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-history-qml.html
  8428. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-historyform-ui-qml.html
  8429. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-notes-qml.html
  8430. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-notesform-ui-qml.html
  8431. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-settings-qml.html
  8432. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-settingsform-ui-qml.html
  8433. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-uiforms-pro.html
  8434. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-uiforms-qrc.html
  8435. share/doc/qt5/qtquickcontrols/qtquickcontrols.index
  8436. share/doc/qt5/qtquickcontrols/qtquickcontrols.qhp
  8437. share/doc/qt5/qtquickcontrols/qtquickcontrols.qhp.sha1
  8438. share/doc/qt5/qtquickcontrols/qtquickcontrols.tags
  8439. share/doc/qt5/qtquickcontrols/qtquickcontrolsstyles-index.html
  8440. share/doc/qt5/qtquickcontrols/style/offline-simple.css
  8441. share/doc/qt5/qtquickcontrols/style/offline.css
  8442. share/doc/qt5/qtquickcontrols/styling-circulargauge.html
  8443. share/doc/qt5/qtquickcontrols/styling-gauge.html
  8444. share/doc/qt5/qtquickcontrols/stylingtutorials.html
  8445. share/doc/qt5/qtquickcontrols/views.html
  8446. share/doc/qt5/qtquickcontrols/viewsstyling.html
  8447. share/doc/qt5/qtquickcontrols2.qch
  8448. share/doc/qt5/qtquickcontrols2/examples-manifest.xml
  8449. share/doc/qt5/qtquickcontrols2/images/arrow_bc.png
  8450. share/doc/qt5/qtquickcontrols2/images/bgrContent.png
  8451. share/doc/qt5/qtquickcontrols2/images/btn_next.png
  8452. share/doc/qt5/qtquickcontrols2/images/btn_prev.png
  8453. share/doc/qt5/qtquickcontrols2/images/bullet_dn.png
  8454. share/doc/qt5/qtquickcontrols2/images/bullet_sq.png
  8455. share/doc/qt5/qtquickcontrols2/images/home.png
  8456. share/doc/qt5/qtquickcontrols2/images/ico_note.png
  8457. share/doc/qt5/qtquickcontrols2/images/ico_note_attention.png
  8458. share/doc/qt5/qtquickcontrols2/images/ico_out.png
  8459. share/doc/qt5/qtquickcontrols2/images/logo.png
  8460. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-applicationwindow-wireframe.png
  8461. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-busyindicator-custom.png
  8462. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-busyindicator.gif
  8463. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-busyindicator.png
  8464. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-custom.png
  8465. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-flat.gif
  8466. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-highlighted.gif
  8467. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button.gif
  8468. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter1.png
  8469. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter2-listview-header.gif
  8470. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter2.png
  8471. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter3-listview-header.gif
  8472. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter3-view-margins.png
  8473. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter3.gif
  8474. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter4-long-message.png
  8475. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter4-message-timestamp.png
  8476. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter4.gif
  8477. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-dark.png
  8478. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-test.png
  8479. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-material.png
  8480. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal-dark.png
  8481. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal.png
  8482. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-dark.png
  8483. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-test.png
  8484. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-material.png
  8485. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal-dark.png
  8486. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal.png
  8487. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkbox-custom.png
  8488. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkbox-tristate.gif
  8489. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkbox.gif
  8490. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkdelegate-custom.png
  8491. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkdelegate-tristate.gif
  8492. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkdelegate.gif
  8493. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-combobox-custom.png
  8494. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-combobox.gif
  8495. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-contactlist.png
  8496. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-control.png
  8497. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-customize-buttons.png
  8498. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-default-thumbnail.png
  8499. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-default.png
  8500. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-delaybutton-custom.png
  8501. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-delaybutton.gif
  8502. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial-custom.png
  8503. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial-no-wrap.gif
  8504. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial-wrap.gif
  8505. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial.png
  8506. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dialogbuttonbox.png
  8507. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-drawer-expanded-wireframe.png
  8508. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-drawer.gif
  8509. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-flatstyle-creator.png
  8510. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-flatstyle.png
  8511. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-frame-custom.png
  8512. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-frame.png
  8513. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-gallery-drawer.png
  8514. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-gallery-menu.png
  8515. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-gallery-welcome.png
  8516. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-groupbox-checkable.png
  8517. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-groupbox-custom.png
  8518. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-groupbox.png
  8519. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-itemdelegate-custom.png
  8520. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-itemdelegate.gif
  8521. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-label-custom.png
  8522. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-label.png
  8523. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-accent.png
  8524. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-attributes.png
  8525. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-background.png
  8526. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-dark.png
  8527. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-elevation.png
  8528. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-foreground.png
  8529. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-light.png
  8530. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-purple.png
  8531. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-theme.png
  8532. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-thumbnail.png
  8533. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menu.png
  8534. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menuseparator-custom.png
  8535. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menuseparator.png
  8536. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-page-wireframe.png
  8537. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pageindicator-custom.png
  8538. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pageindicator.png
  8539. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pane-custom.png
  8540. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pane.png
  8541. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup-custom.png
  8542. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup-settings.png
  8543. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup-transformorigin.png
  8544. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup.png
  8545. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-progressbar-custom.png
  8546. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-progressbar-indeterminate.gif
  8547. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-progressbar.gif
  8548. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiobutton-custom.png
  8549. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiobutton.gif
  8550. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiodelegate-custom.png
  8551. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiodelegate.gif
  8552. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-rangeslider-custom.png
  8553. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-rangeslider.gif
  8554. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-roundbutton.png
  8555. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-custom.png
  8556. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-non-attached.png
  8557. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-nosnap.gif
  8558. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-snapalways.gif
  8559. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-snaponrelease.gif
  8560. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar.gif
  8561. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollindicator-custom.png
  8562. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollindicator-non-attached.png
  8563. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollindicator.gif
  8564. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollview-custom.png
  8565. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollview-wireframe.png
  8566. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollview.png
  8567. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-sidepanel-landscape.png
  8568. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-sidepanel-portrait.png
  8569. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-custom.png
  8570. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-nosnap.gif
  8571. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-snapalways.gif
  8572. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-snaponrelease.gif
  8573. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider.gif
  8574. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox-custom.png
  8575. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox-double.png
  8576. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox-textual.png
  8577. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox.png
  8578. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-pop.gif
  8579. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-push.gif
  8580. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-replace.gif
  8581. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-unwind.gif
  8582. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-visible.png
  8583. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-wireframe.png
  8584. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-styles.png
  8585. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-behind.gif
  8586. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-custom.png
  8587. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-leading-trailing.gif
  8588. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate.gif
  8589. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipetoremove.png
  8590. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipeview-wireframe.png
  8591. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipeview.gif
  8592. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switch-custom.png
  8593. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switch.gif
  8594. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switch.png
  8595. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switchdelegate-custom.png
  8596. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switchdelegate.gif
  8597. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-custom.png
  8598. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-explicit.png
  8599. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-flickable.png
  8600. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-wireframe.png
  8601. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbutton.png
  8602. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textarea-custom.png
  8603. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textarea-scrollable.png
  8604. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textarea.png
  8605. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-texteditor-desktop.jpg
  8606. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-texteditor-touch.jpg
  8607. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-custom.png
  8608. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-disabled.png
  8609. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-focused.png
  8610. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-normal.png
  8611. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield.png
  8612. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbar-custom.png
  8613. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbar.png
  8614. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbutton-custom.png
  8615. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbutton.png
  8616. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolseparator-custom.png
  8617. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolseparator.png
  8618. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tooltip-slider.png
  8619. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tooltip.png
  8620. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tumbler-custom.png
  8621. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tumbler-wrap.gif
  8622. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tumbler.png
  8623. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-accent.png
  8624. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-attributes.png
  8625. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-background.png
  8626. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-dark.png
  8627. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-foreground.png
  8628. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-light.png
  8629. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-theme.png
  8630. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-thumbnail.png
  8631. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-violet.png
  8632. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-wearable.png
  8633. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back.png
  8634. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back@2x.png
  8635. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back@3x.png
  8636. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back@4x.png
  8637. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer.png
  8638. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer@2x.png
  8639. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer@3x.png
  8640. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer@4x.png
  8641. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu.png
  8642. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu@2x.png
  8643. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu@3x.png
  8644. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu@4x.png
  8645. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow.png
  8646. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@2x.png
  8647. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@3x.png
  8648. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@4x.png
  8649. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows.png
  8650. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@2x.png
  8651. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@3x.png
  8652. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@4x.png
  8653. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/back.png
  8654. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/back@2x.png
  8655. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/back@3x.png
  8656. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/back@4x.png
  8657. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/drawer.png
  8658. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/drawer@2x.png
  8659. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/drawer@3x.png
  8660. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/drawer@4x.png
  8661. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/menu.png
  8662. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/menu@2x.png
  8663. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/menu@3x.png
  8664. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/menu@4x.png
  8665. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo.png
  8666. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@2x.png
  8667. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@3x.png
  8668. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@4x.png
  8669. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo.png
  8670. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo@2x.png
  8671. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo@3x.png
  8672. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo@4x.png
  8673. share/doc/qt5/qtquickcontrols2/images/used-in-examples/texteditor/images/qt-logo.png
  8674. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back.png
  8675. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back@2x.png
  8676. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back@3x.png
  8677. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back@4x.png
  8678. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/background.png
  8679. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home.png
  8680. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home@2x.png
  8681. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home@3x.png
  8682. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home@4x.png
  8683. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-abstractbutton-members.html
  8684. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-abstractbutton.html
  8685. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-applicationwindow-members.html
  8686. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-applicationwindow.html
  8687. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-busyindicator-members.html
  8688. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-busyindicator.html
  8689. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-button-members.html
  8690. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-button.html
  8691. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-buttongroup-members.html
  8692. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-buttongroup.html
  8693. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkbox-members.html
  8694. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkbox.html
  8695. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkdelegate-members.html
  8696. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkdelegate.html
  8697. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-combobox-members.html
  8698. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-combobox.html
  8699. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-container-members.html
  8700. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-container.html
  8701. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-control-members.html
  8702. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-control.html
  8703. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-delaybutton-members.html
  8704. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-delaybutton.html
  8705. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dial-members.html
  8706. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dial.html
  8707. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialog-members.html
  8708. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialog.html
  8709. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialogbuttonbox-members.html
  8710. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialogbuttonbox.html
  8711. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-drawer-members.html
  8712. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-drawer.html
  8713. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-frame-members.html
  8714. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-frame.html
  8715. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-groupbox-members.html
  8716. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-groupbox.html
  8717. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-itemdelegate-members.html
  8718. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-itemdelegate.html
  8719. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-label-members.html
  8720. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-label.html
  8721. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menu-members.html
  8722. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menu.html
  8723. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuitem-members.html
  8724. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuitem.html
  8725. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuseparator-members.html
  8726. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuseparator.html
  8727. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-page-members.html
  8728. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-page.html
  8729. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pageindicator-members.html
  8730. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pageindicator.html
  8731. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pane-members.html
  8732. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pane.html
  8733. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-popup-members.html
  8734. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-popup.html
  8735. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-progressbar-members.html
  8736. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-progressbar.html
  8737. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiobutton-members.html
  8738. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiobutton.html
  8739. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiodelegate-members.html
  8740. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiodelegate.html
  8741. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-rangeslider-members.html
  8742. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-rangeslider.html
  8743. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-roundbutton-members.html
  8744. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-roundbutton.html
  8745. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollbar-members.html
  8746. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollbar.html
  8747. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollindicator-members.html
  8748. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollindicator.html
  8749. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollview-members.html
  8750. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollview.html
  8751. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-slider-members.html
  8752. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-slider.html
  8753. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-spinbox-members.html
  8754. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-spinbox.html
  8755. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-stackview-members.html
  8756. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-stackview.html
  8757. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipedelegate-members.html
  8758. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipedelegate.html
  8759. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipeview-members.html
  8760. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipeview.html
  8761. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switch-members.html
  8762. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switch.html
  8763. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switchdelegate-members.html
  8764. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switchdelegate.html
  8765. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbar-members.html
  8766. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbar.html
  8767. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbutton-members.html
  8768. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbutton.html
  8769. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textarea-members.html
  8770. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textarea.html
  8771. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textfield-members.html
  8772. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textfield.html
  8773. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbar-members.html
  8774. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbar.html
  8775. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbutton-members.html
  8776. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbutton.html
  8777. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolseparator-members.html
  8778. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolseparator.html
  8779. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tooltip-members.html
  8780. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tooltip.html
  8781. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tumbler-members.html
  8782. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tumbler.html
  8783. share/doc/qt5/qtquickcontrols2/qquickstyle-members.html
  8784. share/doc/qt5/qtquickcontrols2/qquickstyle.html
  8785. share/doc/qt5/qtquickcontrols2/qtquick-controls2-qmlmodule.html
  8786. share/doc/qt5/qtquickcontrols2/qtquick-templates2-qmlmodule.html
  8787. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-buttons.html
  8788. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-chapter1-settingup-pro.html
  8789. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-main-cpp.html
  8790. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-main-qml.html
  8791. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-qml-qrc.html
  8792. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-chapter2-lists-pro.html
  8793. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-main-qml.html
  8794. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-qml-qrc.html
  8795. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-chapter3-navigation-pro.html
  8796. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-contactpage-qml.html
  8797. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-conversationpage-qml.html
  8798. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-main-qml.html
  8799. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-qml-qrc.html
  8800. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-chapter4-models-pro.html
  8801. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-contactpage-qml.html
  8802. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-conversationpage-qml.html
  8803. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-main-qml.html
  8804. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-qml-qrc.html
  8805. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-cpp.html
  8806. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-h.html
  8807. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-cpp.html
  8808. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-h.html
  8809. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-chapter5-styling-pro.html
  8810. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-chattoolbar-qml.html
  8811. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-contactpage-qml.html
  8812. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-conversationpage-qml.html
  8813. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-main-qml.html
  8814. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-material-chattoolbar-qml.html
  8815. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-qml-qrc.html
  8816. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-cpp.html
  8817. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-h.html
  8818. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-cpp.html
  8819. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-h.html
  8820. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chattutorial-pro.html
  8821. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-example.html
  8822. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-shared-shared-qrc.html
  8823. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-configuration.html
  8824. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactdelegate-ui-qml.html
  8825. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactdialog-qml.html
  8826. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactform-ui-qml.html
  8827. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactlist-pro.html
  8828. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactlist-qml.html
  8829. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactmodel-cpp.html
  8830. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactmodel-h.html
  8831. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactview-ui-qml.html
  8832. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-designer-backend-contactmodel-qml.html
  8833. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-designer-backend-qmldir.html
  8834. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-example.html
  8835. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-main-cpp.html
  8836. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-sectiondelegate-ui-qml.html
  8837. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-containers.html
  8838. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-customize.html
  8839. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-default.html
  8840. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-delegates.html
  8841. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-deployment.html
  8842. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-differences.html
  8843. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-environment.html
  8844. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-examples.html
  8845. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-fileselectors.html
  8846. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-example.html
  8847. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flat-button-qml.html
  8848. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flat-checkbox-qml.html
  8849. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flat-switch-qml.html
  8850. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flatstyle-pro.html
  8851. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flatstyle-qml.html
  8852. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-imports-theme-qmldir.html
  8853. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-imports-theme-theme-qml.html
  8854. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-main-cpp.html
  8855. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-mainform-ui-qml.html
  8856. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-example.html
  8857. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-gallery-cpp.html
  8858. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-gallery-pro.html
  8859. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-gallery-qml.html
  8860. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-busyindicatorpage-qml.html
  8861. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-buttonpage-qml.html
  8862. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-checkboxpage-qml.html
  8863. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-comboboxpage-qml.html
  8864. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-delaybuttonpage-qml.html
  8865. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-delegatepage-qml.html
  8866. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-dialogpage-qml.html
  8867. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-dialpage-qml.html
  8868. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-framepage-qml.html
  8869. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-groupboxpage-qml.html
  8870. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-pageindicatorpage-qml.html
  8871. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-progressbarpage-qml.html
  8872. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-radiobuttonpage-qml.html
  8873. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-rangesliderpage-qml.html
  8874. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollablepage-qml.html
  8875. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollbarpage-qml.html
  8876. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollindicatorpage-qml.html
  8877. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-sliderpage-qml.html
  8878. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-spinboxpage-qml.html
  8879. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-stackviewpage-qml.html
  8880. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-swipeviewpage-qml.html
  8881. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-switchpage-qml.html
  8882. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-tabbarpage-qml.html
  8883. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-textareapage-qml.html
  8884. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-textfieldpage-qml.html
  8885. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-tooltippage-qml.html
  8886. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-tumblerpage-qml.html
  8887. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gettingstarted.html
  8888. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-guidelines.html
  8889. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-highdpi.html
  8890. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-index.html
  8891. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-indicators.html
  8892. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-input.html
  8893. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-material.html
  8894. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-menus.html
  8895. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-module.html
  8896. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-navigation.html
  8897. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-popups.html
  8898. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-separators.html
  8899. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-example.html
  8900. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-sidepanel-cpp.html
  8901. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-sidepanel-pro.html
  8902. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-sidepanel-qml.html
  8903. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-styles.html
  8904. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-example.html
  8905. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-swipetoremove-cpp.html
  8906. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-swipetoremove-pro.html
  8907. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-swipetoremove-qml.html
  8908. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-documenthandler-cpp.html
  8909. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-documenthandler-h.html
  8910. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-example.html
  8911. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-qml-texteditor-qml.html
  8912. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-qml-touch-texteditor-qml.html
  8913. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-texteditor-cpp.html
  8914. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-texteditor-pro.html
  8915. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-texteditor-qrc.html
  8916. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-universal.html
  8917. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-example.html
  8918. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-alarms-alarmspage-qml.html
  8919. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-fitness-fitness-js.html
  8920. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-fitness-fitnesspage-qml.html
  8921. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-launcherpage-qml.html
  8922. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navibutton-qml.html
  8923. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navigation-navigation-js.html
  8924. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navigation-navigationpage-qml.html
  8925. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navigation-routeelement-qml.html
  8926. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-notifications-notifications-js.html
  8927. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-notifications-notificationspage-qml.html
  8928. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-settings-settingspage-qml.html
  8929. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-pageindicator-qml.html
  8930. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-qmldir.html
  8931. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-slider-qml.html
  8932. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-switch-qml.html
  8933. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-uistyle-qml.html
  8934. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-weather-weather-js.html
  8935. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-weather-weatherpage-qml.html
  8936. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-worldclock-clock-qml.html
  8937. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-worldclock-worldclockpage-qml.html
  8938. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-cpp.html
  8939. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-pro.html
  8940. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-qml.html
  8941. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-qrc.html
  8942. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.index
  8943. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.qhp
  8944. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.qhp.sha1
  8945. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.tags
  8946. share/doc/qt5/qtquickcontrols2/qtquicktemplates2-index.html
  8947. share/doc/qt5/qtquickcontrols2/style/offline-simple.css
  8948. share/doc/qt5/qtquickcontrols2/style/offline.css
  8949. share/doc/qt5/qtquickdialogs.qch
  8950. share/doc/qt5/qtquickdialogs/examples-manifest.xml
  8951. share/doc/qt5/qtquickdialogs/images/arrow_bc.png
  8952. share/doc/qt5/qtquickdialogs/images/bgrContent.png
  8953. share/doc/qt5/qtquickdialogs/images/btn_next.png
  8954. share/doc/qt5/qtquickdialogs/images/btn_prev.png
  8955. share/doc/qt5/qtquickdialogs/images/bullet_dn.png
  8956. share/doc/qt5/qtquickdialogs/images/bullet_sq.png
  8957. share/doc/qt5/qtquickdialogs/images/critical.png
  8958. share/doc/qt5/qtquickdialogs/images/home.png
  8959. share/doc/qt5/qtquickdialogs/images/ico_note.png
  8960. share/doc/qt5/qtquickdialogs/images/ico_note_attention.png
  8961. share/doc/qt5/qtquickdialogs/images/ico_out.png
  8962. share/doc/qt5/qtquickdialogs/images/information.png
  8963. share/doc/qt5/qtquickdialogs/images/logo.png
  8964. share/doc/qt5/qtquickdialogs/images/question.png
  8965. share/doc/qt5/qtquickdialogs/images/replacefile.png
  8966. share/doc/qt5/qtquickdialogs/images/systemdialogs-example.jpg
  8967. share/doc/qt5/qtquickdialogs/images/warning.png
  8968. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-colordialog-members.html
  8969. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-colordialog.html
  8970. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-dialog-members.html
  8971. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-dialog.html
  8972. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-filedialog-members.html
  8973. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-filedialog.html
  8974. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-fontdialog-members.html
  8975. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-fontdialog.html
  8976. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-messagedialog-members.html
  8977. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-messagedialog.html
  8978. share/doc/qt5/qtquickdialogs/qtquick-dialogs-qmlmodule.html
  8979. share/doc/qt5/qtquickdialogs/qtquickdialog-examples.html
  8980. share/doc/qt5/qtquickdialogs/qtquickdialogs-index.html
  8981. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-colordialogs-qml.html
  8982. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-customdialogs-qml.html
  8983. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-example.html
  8984. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-filedialogs-qml.html
  8985. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-fontdialogs-qml.html
  8986. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-main-cpp.html
  8987. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-messagedialogs-qml.html
  8988. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-pro.html
  8989. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qml.html
  8990. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qrc.html
  8991. share/doc/qt5/qtquickdialogs/qtquickdialogs.index
  8992. share/doc/qt5/qtquickdialogs/qtquickdialogs.qhp
  8993. share/doc/qt5/qtquickdialogs/qtquickdialogs.qhp.sha1
  8994. share/doc/qt5/qtquickdialogs/style/offline-simple.css
  8995. share/doc/qt5/qtquickdialogs/style/offline.css
  8996. share/doc/qt5/qtquickextras.qch
  8997. share/doc/qt5/qtquickextras/examples-manifest.xml
  8998. share/doc/qt5/qtquickextras/images/arrow_bc.png
  8999. share/doc/qt5/qtquickextras/images/bgrContent.png
  9000. share/doc/qt5/qtquickextras/images/btn_next.png
  9001. share/doc/qt5/qtquickextras/images/btn_prev.png
  9002. share/doc/qt5/qtquickextras/images/bullet_dn.png
  9003. share/doc/qt5/qtquickextras/images/bullet_sq.png
  9004. share/doc/qt5/qtquickextras/images/circulargauge.png
  9005. share/doc/qt5/qtquickextras/images/delaybutton-activated.png
  9006. share/doc/qt5/qtquickextras/images/delaybutton-progress.png
  9007. share/doc/qt5/qtquickextras/images/delaybutton.png
  9008. share/doc/qt5/qtquickextras/images/dial.png
  9009. share/doc/qt5/qtquickextras/images/gauge.png
  9010. share/doc/qt5/qtquickextras/images/home.png
  9011. share/doc/qt5/qtquickextras/images/ico_note.png
  9012. share/doc/qt5/qtquickextras/images/ico_note_attention.png
  9013. share/doc/qt5/qtquickextras/images/ico_out.png
  9014. share/doc/qt5/qtquickextras/images/logo.png
  9015. share/doc/qt5/qtquickextras/images/piemenu-boundingItem-example.png
  9016. share/doc/qt5/qtquickextras/images/piemenu-boundingItem-null-example.png
  9017. share/doc/qt5/qtquickextras/images/piemenu.png
  9018. share/doc/qt5/qtquickextras/images/qtquickextras-example-dashboard.png
  9019. share/doc/qt5/qtquickextras/images/qtquickextras-example-flat.png
  9020. share/doc/qt5/qtquickextras/images/qtquickextras-example-gallery.png
  9021. share/doc/qt5/qtquickextras/images/statusindicator-active.png
  9022. share/doc/qt5/qtquickextras/images/statusindicator-green.png
  9023. share/doc/qt5/qtquickextras/images/statusindicator-inactive.png
  9024. share/doc/qt5/qtquickextras/images/togglebutton-checked.png
  9025. share/doc/qt5/qtquickextras/images/togglebutton-unchecked.png
  9026. share/doc/qt5/qtquickextras/images/tumbler.png
  9027. share/doc/qt5/qtquickextras/images/used-in-examples/dashboard/images/fuel-icon.png
  9028. share/doc/qt5/qtquickextras/images/used-in-examples/dashboard/images/temperature-icon.png
  9029. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-normal.png
  9030. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-pressed.png
  9031. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-bw.jpg
  9032. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-rgb.jpg
  9033. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-sepia.jpg
  9034. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-normal.png
  9035. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-pressed.png
  9036. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-normal.png
  9037. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-pressed.png
  9038. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/background-light.png
  9039. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/background.png
  9040. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/center-light.png
  9041. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/center.png
  9042. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-back.png
  9043. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-go.png
  9044. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-settings.png
  9045. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/info.png
  9046. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/needle-light.png
  9047. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/needle.png
  9048. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/qt-logo.png
  9049. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/zoom_in.png
  9050. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/zoom_out.png
  9051. share/doc/qt5/qtquickextras/qml-qtquick-extras-circulargauge-members.html
  9052. share/doc/qt5/qtquickextras/qml-qtquick-extras-circulargauge.html
  9053. share/doc/qt5/qtquickextras/qml-qtquick-extras-delaybutton-members.html
  9054. share/doc/qt5/qtquickextras/qml-qtquick-extras-delaybutton.html
  9055. share/doc/qt5/qtquickextras/qml-qtquick-extras-dial-members.html
  9056. share/doc/qt5/qtquickextras/qml-qtquick-extras-dial.html
  9057. share/doc/qt5/qtquickextras/qml-qtquick-extras-gauge-members.html
  9058. share/doc/qt5/qtquickextras/qml-qtquick-extras-gauge.html
  9059. share/doc/qt5/qtquickextras/qml-qtquick-extras-picture-members.html
  9060. share/doc/qt5/qtquickextras/qml-qtquick-extras-picture.html
  9061. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu-members.html
  9062. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu-obsolete.html
  9063. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu.html
  9064. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator-members.html
  9065. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator-obsolete.html
  9066. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator.html
  9067. share/doc/qt5/qtquickextras/qml-qtquick-extras-togglebutton-members.html
  9068. share/doc/qt5/qtquickextras/qml-qtquick-extras-togglebutton.html
  9069. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumbler-members.html
  9070. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumbler.html
  9071. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumblercolumn-members.html
  9072. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumblercolumn.html
  9073. share/doc/qt5/qtquickextras/qtquick-extras-qmlmodule.html
  9074. share/doc/qt5/qtquickextras/qtquickextras-dashboard-dashboard-pro.html
  9075. share/doc/qt5/qtquickextras/qtquickextras-dashboard-dashboard-qrc.html
  9076. share/doc/qt5/qtquickextras/qtquickextras-dashboard-example.html
  9077. share/doc/qt5/qtquickextras/qtquickextras-dashboard-main-cpp.html
  9078. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-dashboard-qml.html
  9079. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-dashboardgaugestyle-qml.html
  9080. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-icongaugestyle-qml.html
  9081. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-tachometerstyle-qml.html
  9082. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-turnindicator-qml.html
  9083. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-valuesource-qml.html
  9084. share/doc/qt5/qtquickextras/qtquickextras-examples.html
  9085. share/doc/qt5/qtquickextras/qtquickextras-flat-content-qml.html
  9086. share/doc/qt5/qtquickextras/qtquickextras-flat-example.html
  9087. share/doc/qt5/qtquickextras/qtquickextras-flat-flat-pro.html
  9088. share/doc/qt5/qtquickextras/qtquickextras-flat-flat-qrc.html
  9089. share/doc/qt5/qtquickextras/qtquickextras-flat-main-cpp.html
  9090. share/doc/qt5/qtquickextras/qtquickextras-flat-main-qml.html
  9091. share/doc/qt5/qtquickextras/qtquickextras-flat-settingsicon-qml.html
  9092. share/doc/qt5/qtquickextras/qtquickextras-gallery-example.html
  9093. share/doc/qt5/qtquickextras/qtquickextras-gallery-gallery-pro.html
  9094. share/doc/qt5/qtquickextras/qtquickextras-gallery-gallery-qrc.html
  9095. share/doc/qt5/qtquickextras/qtquickextras-gallery-main-cpp.html
  9096. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-blackbuttonbackground-qml.html
  9097. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-blackbuttonstyle-qml.html
  9098. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugedarkstyle-qml.html
  9099. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugedefaultstyle-qml.html
  9100. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugelightstyle-qml.html
  9101. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugeview-qml.html
  9102. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controllabel-qml.html
  9103. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controlview-qml.html
  9104. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controlviewtoolbar-qml.html
  9105. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerlabel-qml.html
  9106. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerslider-qml.html
  9107. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerswitch-qml.html
  9108. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-flickablemoreindicator-qml.html
  9109. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-gallery-qml.html
  9110. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenucontrolview-qml.html
  9111. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenudarkstyle-qml.html
  9112. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenudefaultstyle-qml.html
  9113. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-stylepicker-qml.html
  9114. share/doc/qt5/qtquickextras/qtquickextras-index.html
  9115. share/doc/qt5/qtquickextras/qtquickextras-overview.html
  9116. share/doc/qt5/qtquickextras/qtquickextras.index
  9117. share/doc/qt5/qtquickextras/qtquickextras.qhp
  9118. share/doc/qt5/qtquickextras/qtquickextras.qhp.sha1
  9119. share/doc/qt5/qtquickextras/style/offline-simple.css
  9120. share/doc/qt5/qtquickextras/style/offline.css
  9121. share/doc/qt5/qtscxml.qch
  9122. share/doc/qt5/qtscxml/examples-manifest.xml
  9123. share/doc/qt5/qtscxml/examples-qtscxml.html
  9124. share/doc/qt5/qtscxml/images/arrow_bc.png
  9125. share/doc/qt5/qtscxml/images/bgrContent.png
  9126. share/doc/qt5/qtscxml/images/btn_next.png
  9127. share/doc/qt5/qtscxml/images/btn_prev.png
  9128. share/doc/qt5/qtscxml/images/bullet_dn.png
  9129. share/doc/qt5/qtscxml/images/bullet_sq.png
  9130. share/doc/qt5/qtscxml/images/calculator-qml.png
  9131. share/doc/qt5/qtscxml/images/calculator.png
  9132. share/doc/qt5/qtscxml/images/ftpclient-statechart.png
  9133. share/doc/qt5/qtscxml/images/home.png
  9134. share/doc/qt5/qtscxml/images/ico_note.png
  9135. share/doc/qt5/qtscxml/images/ico_note_attention.png
  9136. share/doc/qt5/qtscxml/images/ico_out.png
  9137. share/doc/qt5/qtscxml/images/invoke-dynamic.png
  9138. share/doc/qt5/qtscxml/images/invoke-static.png
  9139. share/doc/qt5/qtscxml/images/logo.png
  9140. share/doc/qt5/qtscxml/images/mediaplayer.png
  9141. share/doc/qt5/qtscxml/images/pinball-statechart-global.png
  9142. share/doc/qt5/qtscxml/images/pinball-statechart-guicontrol.png
  9143. share/doc/qt5/qtscxml/images/pinball-statechart-internalstate.png
  9144. share/doc/qt5/qtscxml/images/pinball-statechart-logicalstate.png
  9145. share/doc/qt5/qtscxml/images/pinball-statechart-modestate.png
  9146. share/doc/qt5/qtscxml/images/pinball-statechart-onstate.png
  9147. share/doc/qt5/qtscxml/images/pinball-statechart-workflow.png
  9148. share/doc/qt5/qtscxml/images/pinball.png
  9149. share/doc/qt5/qtscxml/images/sudoku.png
  9150. share/doc/qt5/qtscxml/images/trafficlight.png
  9151. share/doc/qt5/qtscxml/qml-mediaplayer-qml-dynamic-members.html
  9152. share/doc/qt5/qtscxml/qml-mediaplayer-qml-dynamic.html
  9153. share/doc/qt5/qtscxml/qml-qtscxml-eventconnection-members.html
  9154. share/doc/qt5/qtscxml/qml-qtscxml-eventconnection.html
  9155. share/doc/qt5/qtscxml/qml-qtscxml-invokedservices-members.html
  9156. share/doc/qt5/qtscxml/qml-qtscxml-invokedservices.html
  9157. share/doc/qt5/qtscxml/qml-qtscxml-scxmlstatemachine-members.html
  9158. share/doc/qt5/qtscxml/qml-qtscxml-scxmlstatemachine.html
  9159. share/doc/qt5/qtscxml/qml-qtscxml-statemachineloader-members.html
  9160. share/doc/qt5/qtscxml/qml-qtscxml-statemachineloader.html
  9161. share/doc/qt5/qtscxml/qscxmlc.html
  9162. share/doc/qt5/qtscxml/qscxmlcompiler-loader-members.html
  9163. share/doc/qt5/qtscxml/qscxmlcompiler-loader.html
  9164. share/doc/qt5/qtscxml/qscxmlcompiler-members.html
  9165. share/doc/qt5/qtscxml/qscxmlcompiler.html
  9166. share/doc/qt5/qtscxml/qscxmlcppdatamodel-members.html
  9167. share/doc/qt5/qtscxml/qscxmlcppdatamodel.html
  9168. share/doc/qt5/qtscxml/qscxmldatamodel-foreachloopbody-members.html
  9169. share/doc/qt5/qtscxml/qscxmldatamodel-foreachloopbody.html
  9170. share/doc/qt5/qtscxml/qscxmldatamodel-members.html
  9171. share/doc/qt5/qtscxml/qscxmldatamodel.html
  9172. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory-members.html
  9173. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory.html
  9174. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel-members.html
  9175. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel.html
  9176. share/doc/qt5/qtscxml/qscxmlerror-members.html
  9177. share/doc/qt5/qtscxml/qscxmlerror.html
  9178. share/doc/qt5/qtscxml/qscxmlevent-members.html
  9179. share/doc/qt5/qtscxml/qscxmlevent.html
  9180. share/doc/qt5/qtscxml/qscxmlexecutablecontent-assignmentinfo-members.html
  9181. share/doc/qt5/qtscxml/qscxmlexecutablecontent-assignmentinfo.html
  9182. share/doc/qt5/qtscxml/qscxmlexecutablecontent-evaluatorinfo-members.html
  9183. share/doc/qt5/qtscxml/qscxmlexecutablecontent-evaluatorinfo.html
  9184. share/doc/qt5/qtscxml/qscxmlexecutablecontent-foreachinfo-members.html
  9185. share/doc/qt5/qtscxml/qscxmlexecutablecontent-foreachinfo.html
  9186. share/doc/qt5/qtscxml/qscxmlexecutablecontent-invokeinfo-members.html
  9187. share/doc/qt5/qtscxml/qscxmlexecutablecontent-invokeinfo.html
  9188. share/doc/qt5/qtscxml/qscxmlexecutablecontent-parameterinfo-members.html
  9189. share/doc/qt5/qtscxml/qscxmlexecutablecontent-parameterinfo.html
  9190. share/doc/qt5/qtscxml/qscxmlexecutablecontent.html
  9191. share/doc/qt5/qtscxml/qscxmlinvokableservice-members.html
  9192. share/doc/qt5/qtscxml/qscxmlinvokableservice.html
  9193. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory-members.html
  9194. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory.html
  9195. share/doc/qt5/qtscxml/qscxmlnulldatamodel-members.html
  9196. share/doc/qt5/qtscxml/qscxmlnulldatamodel.html
  9197. share/doc/qt5/qtscxml/qscxmlstatemachine-members.html
  9198. share/doc/qt5/qtscxml/qscxmlstatemachine.html
  9199. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory-members.html
  9200. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory.html
  9201. share/doc/qt5/qtscxml/qscxmltabledata-members.html
  9202. share/doc/qt5/qtscxml/qscxmltabledata.html
  9203. share/doc/qt5/qtscxml/qtscxml-calculator-qml-button-qml.html
  9204. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-cpp.html
  9205. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-pro.html
  9206. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-qml.html
  9207. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-qrc.html
  9208. share/doc/qt5/qtscxml/qtscxml-calculator-qml-example.html
  9209. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-calculator-widgets-cpp.html
  9210. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-calculator-widgets-pro.html
  9211. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-example.html
  9212. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-cpp.html
  9213. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-h.html
  9214. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-ui.html
  9215. share/doc/qt5/qtscxml/qtscxml-ftpclient-example.html
  9216. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpclient-pro.html
  9217. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpcontrolchannel-cpp.html
  9218. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpcontrolchannel-h.html
  9219. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpdatachannel-cpp.html
  9220. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpdatachannel-h.html
  9221. share/doc/qt5/qtscxml/qtscxml-ftpclient-main-cpp.html
  9222. share/doc/qt5/qtscxml/qtscxml-ftpclient-simpleftp-scxml.html
  9223. share/doc/qt5/qtscxml/qtscxml-index.html
  9224. share/doc/qt5/qtscxml/qtscxml-instantiating-state-machines.html
  9225. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-example.html
  9226. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-cpp.html
  9227. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-pro.html
  9228. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qml.html
  9229. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qrc.html
  9230. share/doc/qt5/qtscxml/qtscxml-invoke-static-example.html
  9231. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-cpp.html
  9232. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-pro.html
  9233. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-qml.html
  9234. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-qrc.html
  9235. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-example.html
  9236. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-cppdatamodel-scxml.html
  9237. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-cpp.html
  9238. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-pro.html
  9239. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qml.html
  9240. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qrc.html
  9241. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-cpp.html
  9242. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-h.html
  9243. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-example.html
  9244. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-cpp.html
  9245. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-pro.html
  9246. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qml.html
  9247. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qrc.html
  9248. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-example.html
  9249. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-cpp.html
  9250. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-pro.html
  9251. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qml.html
  9252. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qrc.html
  9253. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-example.html
  9254. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-qrc.html
  9255. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-cpp.html
  9256. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-pro.html
  9257. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-example.html
  9258. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-cpp.html
  9259. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-pro.html
  9260. share/doc/qt5/qtscxml/qtscxml-module.html
  9261. share/doc/qt5/qtscxml/qtscxml-overview.html
  9262. share/doc/qt5/qtscxml/qtscxml-pinball-example.html
  9263. share/doc/qt5/qtscxml/qtscxml-pinball-main-cpp.html
  9264. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-cpp.html
  9265. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-h.html
  9266. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-ui.html
  9267. share/doc/qt5/qtscxml/qtscxml-pinball-pinball-pro.html
  9268. share/doc/qt5/qtscxml/qtscxml-pinball-pinball-scxml.html
  9269. share/doc/qt5/qtscxml/qtscxml-qmlmodule.html
  9270. share/doc/qt5/qtscxml/qtscxml-scxml-compliance.html
  9271. share/doc/qt5/qtscxml/qtscxml-sudoku-example.html
  9272. share/doc/qt5/qtscxml/qtscxml-sudoku-main-cpp.html
  9273. share/doc/qt5/qtscxml/qtscxml-sudoku-mainwindow-cpp.html
  9274. share/doc/qt5/qtscxml/qtscxml-sudoku-mainwindow-h.html
  9275. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-js.html
  9276. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-pro.html
  9277. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-qrc.html
  9278. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-scxml.html
  9279. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-example.html
  9280. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-cpp.html
  9281. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-pro.html
  9282. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qml.html
  9283. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qrc.html
  9284. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-example.html
  9285. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-light-qml.html
  9286. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-cpp.html
  9287. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-pro.html
  9288. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-qrc.html
  9289. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml.html
  9290. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-example.html
  9291. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-cpp.html
  9292. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-pro.html
  9293. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qml.html
  9294. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qrc.html
  9295. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-example.html
  9296. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-cpp.html
  9297. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-pro.html
  9298. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-qrc.html
  9299. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-example.html
  9300. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-cpp.html
  9301. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-pro.html
  9302. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-qrc.html
  9303. share/doc/qt5/qtscxml/qtscxml.index
  9304. share/doc/qt5/qtscxml/qtscxml.qhp
  9305. share/doc/qt5/qtscxml/qtscxml.qhp.sha1
  9306. share/doc/qt5/qtscxml/qtscxml.tags
  9307. share/doc/qt5/qtscxml/style/offline-simple.css
  9308. share/doc/qt5/qtscxml/style/offline.css
  9309. share/doc/qt5/qtsensors.qch
  9310. share/doc/qt5/qtsensors/compatmap.html
  9311. share/doc/qt5/qtsensors/creating-a-sensor-plugin.html
  9312. share/doc/qt5/qtsensors/determining-the-default-sensor-for-a-type.html
  9313. share/doc/qt5/qtsensors/dynamic-sensor-backend-registration.html
  9314. share/doc/qt5/qtsensors/examples-manifest.xml
  9315. share/doc/qt5/qtsensors/genericbackend.html
  9316. share/doc/qt5/qtsensors/images/accelbubble.png
  9317. share/doc/qt5/qtsensors/images/arrow_bc.png
  9318. share/doc/qt5/qtsensors/images/bgrContent.png
  9319. share/doc/qt5/qtsensors/images/btn_next.png
  9320. share/doc/qt5/qtsensors/images/btn_prev.png
  9321. share/doc/qt5/qtsensors/images/bullet_dn.png
  9322. share/doc/qt5/qtsensors/images/bullet_sq.png
  9323. share/doc/qt5/qtsensors/images/home.png
  9324. share/doc/qt5/qtsensors/images/ico_note.png
  9325. share/doc/qt5/qtsensors/images/ico_note_attention.png
  9326. share/doc/qt5/qtsensors/images/ico_out.png
  9327. share/doc/qt5/qtsensors/images/logo.png
  9328. share/doc/qt5/qtsensors/images/maze.png
  9329. share/doc/qt5/qtsensors/images/qmlqtsensors.png
  9330. share/doc/qt5/qtsensors/images/qtsensors-examples-explorer.png
  9331. share/doc/qt5/qtsensors/images/qtsensors-examples-grue.png
  9332. share/doc/qt5/qtsensors/images/sensorgesture-cover.png
  9333. share/doc/qt5/qtsensors/images/sensorgesture-doubletap.png
  9334. share/doc/qt5/qtsensors/images/sensorgesture-facedown.png
  9335. share/doc/qt5/qtsensors/images/sensorgesture-faceup.png
  9336. share/doc/qt5/qtsensors/images/sensorgesture-hover.png
  9337. share/doc/qt5/qtsensors/images/sensorgesture-shake.png
  9338. share/doc/qt5/qtsensors/images/sensorgesture-slam_1.png
  9339. share/doc/qt5/qtsensors/images/sensorgesture-slam_2.png
  9340. share/doc/qt5/qtsensors/images/sensorgesture-twist.png
  9341. share/doc/qt5/qtsensors/images/sensorgesture-whip.png
  9342. share/doc/qt5/qtsensors/images/sensorgesturecpp.png
  9343. share/doc/qt5/qtsensors/images/sensors-coordinates.jpg
  9344. share/doc/qt5/qtsensors/images/sensors-coordinates2.jpg
  9345. share/doc/qt5/qtsensors/images/sensors-coordinates3.jpg
  9346. share/doc/qt5/qtsensors/images/sensors-dynamic.png
  9347. share/doc/qt5/qtsensors/images/sensors-geo-vs-raw-magnetism.jpg
  9348. share/doc/qt5/qtsensors/images/sensors-orientation.jpg
  9349. share/doc/qt5/qtsensors/images/sensors-overview.png
  9350. share/doc/qt5/qtsensors/images/sensors-rotation-anim.gif
  9351. share/doc/qt5/qtsensors/images/sensors-rotation.jpg
  9352. share/doc/qt5/qtsensors/images/sensors-rotation2.jpg
  9353. share/doc/qt5/qtsensors/images/sensors-rotation3.jpg
  9354. share/doc/qt5/qtsensors/images/sensors-sides.jpg
  9355. share/doc/qt5/qtsensors/images/sensors-sides2.jpg
  9356. share/doc/qt5/qtsensors/images/sensors-static.png
  9357. share/doc/qt5/qtsensors/images/shakeit.png
  9358. share/doc/qt5/qtsensors/qaccelerometer-members.html
  9359. share/doc/qt5/qtsensors/qaccelerometer.html
  9360. share/doc/qt5/qtsensors/qaccelerometerfilter-members.html
  9361. share/doc/qt5/qtsensors/qaccelerometerfilter.html
  9362. share/doc/qt5/qtsensors/qaccelerometerreading-members.html
  9363. share/doc/qt5/qtsensors/qaccelerometerreading.html
  9364. share/doc/qt5/qtsensors/qaltimeter-members.html
  9365. share/doc/qt5/qtsensors/qaltimeter.html
  9366. share/doc/qt5/qtsensors/qaltimeterfilter-members.html
  9367. share/doc/qt5/qtsensors/qaltimeterfilter.html
  9368. share/doc/qt5/qtsensors/qaltimeterreading-members.html
  9369. share/doc/qt5/qtsensors/qaltimeterreading.html
  9370. share/doc/qt5/qtsensors/qambientlightfilter-members.html
  9371. share/doc/qt5/qtsensors/qambientlightfilter.html
  9372. share/doc/qt5/qtsensors/qambientlightreading-members.html
  9373. share/doc/qt5/qtsensors/qambientlightreading.html
  9374. share/doc/qt5/qtsensors/qambientlightsensor-members.html
  9375. share/doc/qt5/qtsensors/qambientlightsensor.html
  9376. share/doc/qt5/qtsensors/qambienttemperaturefilter-members.html
  9377. share/doc/qt5/qtsensors/qambienttemperaturefilter.html
  9378. share/doc/qt5/qtsensors/qambienttemperaturereading-members.html
  9379. share/doc/qt5/qtsensors/qambienttemperaturereading.html
  9380. share/doc/qt5/qtsensors/qambienttemperaturesensor-members.html
  9381. share/doc/qt5/qtsensors/qambienttemperaturesensor.html
  9382. share/doc/qt5/qtsensors/qcompass-members.html
  9383. share/doc/qt5/qtsensors/qcompass.html
  9384. share/doc/qt5/qtsensors/qcompassfilter-members.html
  9385. share/doc/qt5/qtsensors/qcompassfilter.html
  9386. share/doc/qt5/qtsensors/qcompassreading-members.html
  9387. share/doc/qt5/qtsensors/qcompassreading.html
  9388. share/doc/qt5/qtsensors/qdistancefilter-members.html
  9389. share/doc/qt5/qtsensors/qdistancefilter.html
  9390. share/doc/qt5/qtsensors/qdistancereading-members.html
  9391. share/doc/qt5/qtsensors/qdistancereading.html
  9392. share/doc/qt5/qtsensors/qdistancesensor-members.html
  9393. share/doc/qt5/qtsensors/qdistancesensor.html
  9394. share/doc/qt5/qtsensors/qgyroscope-members.html
  9395. share/doc/qt5/qtsensors/qgyroscope.html
  9396. share/doc/qt5/qtsensors/qgyroscopefilter-members.html
  9397. share/doc/qt5/qtsensors/qgyroscopefilter.html
  9398. share/doc/qt5/qtsensors/qgyroscopereading-members.html
  9399. share/doc/qt5/qtsensors/qgyroscopereading.html
  9400. share/doc/qt5/qtsensors/qholsterfilter-members.html
  9401. share/doc/qt5/qtsensors/qholsterfilter.html
  9402. share/doc/qt5/qtsensors/qholsterreading-members.html
  9403. share/doc/qt5/qtsensors/qholsterreading.html
  9404. share/doc/qt5/qtsensors/qholstersensor-members.html
  9405. share/doc/qt5/qtsensors/qholstersensor.html
  9406. share/doc/qt5/qtsensors/qhumidityfilter-members.html
  9407. share/doc/qt5/qtsensors/qhumidityfilter.html
  9408. share/doc/qt5/qtsensors/qhumidityreading-members.html
  9409. share/doc/qt5/qtsensors/qhumidityreading.html
  9410. share/doc/qt5/qtsensors/qhumiditysensor-members.html
  9411. share/doc/qt5/qtsensors/qhumiditysensor.html
  9412. share/doc/qt5/qtsensors/qirproximityfilter-members.html
  9413. share/doc/qt5/qtsensors/qirproximityfilter.html
  9414. share/doc/qt5/qtsensors/qirproximityreading-members.html
  9415. share/doc/qt5/qtsensors/qirproximityreading.html
  9416. share/doc/qt5/qtsensors/qirproximitysensor-members.html
  9417. share/doc/qt5/qtsensors/qirproximitysensor.html
  9418. share/doc/qt5/qtsensors/qlidfilter-members.html
  9419. share/doc/qt5/qtsensors/qlidfilter.html
  9420. share/doc/qt5/qtsensors/qlidreading-members.html
  9421. share/doc/qt5/qtsensors/qlidreading.html
  9422. share/doc/qt5/qtsensors/qlidsensor-members.html
  9423. share/doc/qt5/qtsensors/qlidsensor.html
  9424. share/doc/qt5/qtsensors/qlightfilter-members.html
  9425. share/doc/qt5/qtsensors/qlightfilter.html
  9426. share/doc/qt5/qtsensors/qlightreading-members.html
  9427. share/doc/qt5/qtsensors/qlightreading.html
  9428. share/doc/qt5/qtsensors/qlightsensor-members.html
  9429. share/doc/qt5/qtsensors/qlightsensor.html
  9430. share/doc/qt5/qtsensors/qmagnetometer-members.html
  9431. share/doc/qt5/qtsensors/qmagnetometer.html
  9432. share/doc/qt5/qtsensors/qmagnetometerfilter-members.html
  9433. share/doc/qt5/qtsensors/qmagnetometerfilter.html
  9434. share/doc/qt5/qtsensors/qmagnetometerreading-members.html
  9435. share/doc/qt5/qtsensors/qmagnetometerreading.html
  9436. share/doc/qt5/qtsensors/qml-qtsensors-accelerometer-members.html
  9437. share/doc/qt5/qtsensors/qml-qtsensors-accelerometer.html
  9438. share/doc/qt5/qtsensors/qml-qtsensors-accelerometerreading-members.html
  9439. share/doc/qt5/qtsensors/qml-qtsensors-accelerometerreading.html
  9440. share/doc/qt5/qtsensors/qml-qtsensors-altimeter-members.html
  9441. share/doc/qt5/qtsensors/qml-qtsensors-altimeter.html
  9442. share/doc/qt5/qtsensors/qml-qtsensors-altimeterreading-members.html
  9443. share/doc/qt5/qtsensors/qml-qtsensors-altimeterreading.html
  9444. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightreading-members.html
  9445. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightreading.html
  9446. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightsensor-members.html
  9447. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightsensor.html
  9448. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturereading-members.html
  9449. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturereading.html
  9450. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturesensor-members.html
  9451. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturesensor.html
  9452. share/doc/qt5/qtsensors/qml-qtsensors-compass-members.html
  9453. share/doc/qt5/qtsensors/qml-qtsensors-compass.html
  9454. share/doc/qt5/qtsensors/qml-qtsensors-compassreading-members.html
  9455. share/doc/qt5/qtsensors/qml-qtsensors-compassreading.html
  9456. share/doc/qt5/qtsensors/qml-qtsensors-distancereading-members.html
  9457. share/doc/qt5/qtsensors/qml-qtsensors-distancereading.html
  9458. share/doc/qt5/qtsensors/qml-qtsensors-distancesensor-members.html
  9459. share/doc/qt5/qtsensors/qml-qtsensors-distancesensor.html
  9460. share/doc/qt5/qtsensors/qml-qtsensors-gyroscope-members.html
  9461. share/doc/qt5/qtsensors/qml-qtsensors-gyroscope.html
  9462. share/doc/qt5/qtsensors/qml-qtsensors-gyroscopereading-members.html
  9463. share/doc/qt5/qtsensors/qml-qtsensors-gyroscopereading.html
  9464. share/doc/qt5/qtsensors/qml-qtsensors-holsterreading-members.html
  9465. share/doc/qt5/qtsensors/qml-qtsensors-holsterreading.html
  9466. share/doc/qt5/qtsensors/qml-qtsensors-holstersensor-members.html
  9467. share/doc/qt5/qtsensors/qml-qtsensors-holstersensor.html
  9468. share/doc/qt5/qtsensors/qml-qtsensors-humidityreading-members.html
  9469. share/doc/qt5/qtsensors/qml-qtsensors-humidityreading.html
  9470. share/doc/qt5/qtsensors/qml-qtsensors-humiditysensor-members.html
  9471. share/doc/qt5/qtsensors/qml-qtsensors-humiditysensor.html
  9472. share/doc/qt5/qtsensors/qml-qtsensors-irproximityreading-members.html
  9473. share/doc/qt5/qtsensors/qml-qtsensors-irproximityreading.html
  9474. share/doc/qt5/qtsensors/qml-qtsensors-irproximitysensor-members.html
  9475. share/doc/qt5/qtsensors/qml-qtsensors-irproximitysensor.html
  9476. share/doc/qt5/qtsensors/qml-qtsensors-lidreading-members.html
  9477. share/doc/qt5/qtsensors/qml-qtsensors-lidreading.html
  9478. share/doc/qt5/qtsensors/qml-qtsensors-lidsensor-members.html
  9479. share/doc/qt5/qtsensors/qml-qtsensors-lidsensor.html
  9480. share/doc/qt5/qtsensors/qml-qtsensors-lightreading-members.html
  9481. share/doc/qt5/qtsensors/qml-qtsensors-lightreading.html
  9482. share/doc/qt5/qtsensors/qml-qtsensors-lightsensor-members.html
  9483. share/doc/qt5/qtsensors/qml-qtsensors-lightsensor.html
  9484. share/doc/qt5/qtsensors/qml-qtsensors-magnetometer-members.html
  9485. share/doc/qt5/qtsensors/qml-qtsensors-magnetometer.html
  9486. share/doc/qt5/qtsensors/qml-qtsensors-magnetometerreading-members.html
  9487. share/doc/qt5/qtsensors/qml-qtsensors-magnetometerreading.html
  9488. share/doc/qt5/qtsensors/qml-qtsensors-orientationreading-members.html
  9489. share/doc/qt5/qtsensors/qml-qtsensors-orientationreading.html
  9490. share/doc/qt5/qtsensors/qml-qtsensors-orientationsensor-members.html
  9491. share/doc/qt5/qtsensors/qml-qtsensors-orientationsensor.html
  9492. share/doc/qt5/qtsensors/qml-qtsensors-pressurereading-members.html
  9493. share/doc/qt5/qtsensors/qml-qtsensors-pressurereading.html
  9494. share/doc/qt5/qtsensors/qml-qtsensors-pressuresensor-members.html
  9495. share/doc/qt5/qtsensors/qml-qtsensors-pressuresensor.html
  9496. share/doc/qt5/qtsensors/qml-qtsensors-proximityreading-members.html
  9497. share/doc/qt5/qtsensors/qml-qtsensors-proximityreading.html
  9498. share/doc/qt5/qtsensors/qml-qtsensors-proximitysensor-members.html
  9499. share/doc/qt5/qtsensors/qml-qtsensors-proximitysensor.html
  9500. share/doc/qt5/qtsensors/qml-qtsensors-rotationreading-members.html
  9501. share/doc/qt5/qtsensors/qml-qtsensors-rotationreading.html
  9502. share/doc/qt5/qtsensors/qml-qtsensors-rotationsensor-members.html
  9503. share/doc/qt5/qtsensors/qml-qtsensors-rotationsensor.html
  9504. share/doc/qt5/qtsensors/qml-qtsensors-sensor-members.html
  9505. share/doc/qt5/qtsensors/qml-qtsensors-sensor.html
  9506. share/doc/qt5/qtsensors/qml-qtsensors-sensorgesture-members.html
  9507. share/doc/qt5/qtsensors/qml-qtsensors-sensorgesture.html
  9508. share/doc/qt5/qtsensors/qml-qtsensors-sensorglobal-members.html
  9509. share/doc/qt5/qtsensors/qml-qtsensors-sensorglobal.html
  9510. share/doc/qt5/qtsensors/qml-qtsensors-sensorreading-members.html
  9511. share/doc/qt5/qtsensors/qml-qtsensors-sensorreading.html
  9512. share/doc/qt5/qtsensors/qml-qtsensors-tapreading-members.html
  9513. share/doc/qt5/qtsensors/qml-qtsensors-tapreading.html
  9514. share/doc/qt5/qtsensors/qml-qtsensors-tapsensor-members.html
  9515. share/doc/qt5/qtsensors/qml-qtsensors-tapsensor.html
  9516. share/doc/qt5/qtsensors/qml-qtsensors-tiltreading-members.html
  9517. share/doc/qt5/qtsensors/qml-qtsensors-tiltreading.html
  9518. share/doc/qt5/qtsensors/qml-qtsensors-tiltsensor-members.html
  9519. share/doc/qt5/qtsensors/qml-qtsensors-tiltsensor.html
  9520. share/doc/qt5/qtsensors/qorientationfilter-members.html
  9521. share/doc/qt5/qtsensors/qorientationfilter.html
  9522. share/doc/qt5/qtsensors/qorientationreading-members.html
  9523. share/doc/qt5/qtsensors/qorientationreading.html
  9524. share/doc/qt5/qtsensors/qorientationsensor-members.html
  9525. share/doc/qt5/qtsensors/qorientationsensor.html
  9526. share/doc/qt5/qtsensors/qpressurefilter-members.html
  9527. share/doc/qt5/qtsensors/qpressurefilter.html
  9528. share/doc/qt5/qtsensors/qpressurereading-members.html
  9529. share/doc/qt5/qtsensors/qpressurereading.html
  9530. share/doc/qt5/qtsensors/qpressuresensor-members.html
  9531. share/doc/qt5/qtsensors/qpressuresensor.html
  9532. share/doc/qt5/qtsensors/qproximityfilter-members.html
  9533. share/doc/qt5/qtsensors/qproximityfilter.html
  9534. share/doc/qt5/qtsensors/qproximityreading-members.html
  9535. share/doc/qt5/qtsensors/qproximityreading.html
  9536. share/doc/qt5/qtsensors/qproximitysensor-members.html
  9537. share/doc/qt5/qtsensors/qproximitysensor.html
  9538. share/doc/qt5/qtsensors/qrotationfilter-members.html
  9539. share/doc/qt5/qtsensors/qrotationfilter.html
  9540. share/doc/qt5/qtsensors/qrotationreading-members.html
  9541. share/doc/qt5/qtsensors/qrotationreading.html
  9542. share/doc/qt5/qtsensors/qrotationsensor-members.html
  9543. share/doc/qt5/qtsensors/qrotationsensor.html
  9544. share/doc/qt5/qtsensors/qsensor-members.html
  9545. share/doc/qt5/qtsensors/qsensor.html
  9546. share/doc/qt5/qtsensors/qsensorbackend-members.html
  9547. share/doc/qt5/qtsensors/qsensorbackend.html
  9548. share/doc/qt5/qtsensors/qsensorbackendfactory-members.html
  9549. share/doc/qt5/qtsensors/qsensorbackendfactory.html
  9550. share/doc/qt5/qtsensors/qsensorchangesinterface-members.html
  9551. share/doc/qt5/qtsensors/qsensorchangesinterface.html
  9552. share/doc/qt5/qtsensors/qsensorfilter-members.html
  9553. share/doc/qt5/qtsensors/qsensorfilter.html
  9554. share/doc/qt5/qtsensors/qsensorgesture-members.html
  9555. share/doc/qt5/qtsensors/qsensorgesture.html
  9556. share/doc/qt5/qtsensors/qsensorgesturemanager-members.html
  9557. share/doc/qt5/qtsensors/qsensorgesturemanager.html
  9558. share/doc/qt5/qtsensors/qsensorgestureplugininterface-members.html
  9559. share/doc/qt5/qtsensors/qsensorgestureplugininterface.html
  9560. share/doc/qt5/qtsensors/qsensorgesturerecognizer-members.html
  9561. share/doc/qt5/qtsensors/qsensorgesturerecognizer.html
  9562. share/doc/qt5/qtsensors/qsensormanager-members.html
  9563. share/doc/qt5/qtsensors/qsensormanager.html
  9564. share/doc/qt5/qtsensors/qsensorplugininterface-members.html
  9565. share/doc/qt5/qtsensors/qsensorplugininterface.html
  9566. share/doc/qt5/qtsensors/qsensorreading-members.html
  9567. share/doc/qt5/qtsensors/qsensorreading.html
  9568. share/doc/qt5/qtsensors/qtapfilter-members.html
  9569. share/doc/qt5/qtsensors/qtapfilter.html
  9570. share/doc/qt5/qtsensors/qtapreading-members.html
  9571. share/doc/qt5/qtsensors/qtapreading.html
  9572. share/doc/qt5/qtsensors/qtapsensor-members.html
  9573. share/doc/qt5/qtsensors/qtapsensor.html
  9574. share/doc/qt5/qtsensors/qtiltfilter-members.html
  9575. share/doc/qt5/qtsensors/qtiltfilter.html
  9576. share/doc/qt5/qtsensors/qtiltreading-members.html
  9577. share/doc/qt5/qtsensors/qtiltreading.html
  9578. share/doc/qt5/qtsensors/qtiltsensor-members.html
  9579. share/doc/qt5/qtsensors/qtiltsensor.html
  9580. share/doc/qt5/qtsensors/qtsensorgestures-cpp.html
  9581. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-pro.html
  9582. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-qml.html
  9583. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-qrc.html
  9584. share/doc/qt5/qtsensors/qtsensors-accelbubble-android-androidmanifest-xml.html
  9585. share/doc/qt5/qtsensors/qtsensors-accelbubble-content-bluebubble-svg.html
  9586. share/doc/qt5/qtsensors/qtsensors-accelbubble-example.html
  9587. share/doc/qt5/qtsensors/qtsensors-accelbubble-main-cpp.html
  9588. share/doc/qt5/qtsensors/qtsensors-cpp.html
  9589. share/doc/qt5/qtsensors/qtsensors-examples.html
  9590. share/doc/qt5/qtsensors/qtsensors-grue-console-app-console-app-pro.html
  9591. share/doc/qt5/qtsensors/qtsensors-grue-example.html
  9592. share/doc/qt5/qtsensors/qtsensors-grue-grue-pro.html
  9593. share/doc/qt5/qtsensors/qtsensors-grue-grue-qml.html
  9594. share/doc/qt5/qtsensors/qtsensors-grue-import-import-pro.html
  9595. share/doc/qt5/qtsensors/qtsensors-grue-import-qmldir.html
  9596. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-cpp.html
  9597. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-h.html
  9598. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-p-h.html
  9599. share/doc/qt5/qtsensors/qtsensors-grue-lib-lib-pro.html
  9600. share/doc/qt5/qtsensors/qtsensors-grue-main-cpp.html
  9601. share/doc/qt5/qtsensors/qtsensors-grue-plugin-gruesensorimpl-cpp.html
  9602. share/doc/qt5/qtsensors/qtsensors-grue-plugin-gruesensorimpl-h.html
  9603. share/doc/qt5/qtsensors/qtsensors-grue-plugin-plugin-pro.html
  9604. share/doc/qt5/qtsensors/qtsensors-grue-qml-pro.html
  9605. share/doc/qt5/qtsensors/qtsensors-grue-qml-qrc.html
  9606. share/doc/qt5/qtsensors/qtsensors-index.html
  9607. share/doc/qt5/qtsensors/qtsensors-maze-android-androidmanifest-xml.html
  9608. share/doc/qt5/qtsensors/qtsensors-maze-components-applicationwindow-qml.html
  9609. share/doc/qt5/qtsensors/qtsensors-maze-components-button-qml.html
  9610. share/doc/qt5/qtsensors/qtsensors-maze-congratulation-qml.html
  9611. share/doc/qt5/qtsensors/qtsensors-maze-example.html
  9612. share/doc/qt5/qtsensors/qtsensors-maze-labyrinthsquare-qml.html
  9613. share/doc/qt5/qtsensors/qtsensors-maze-lib-js.html
  9614. share/doc/qt5/qtsensors/qtsensors-maze-main-cpp.html
  9615. share/doc/qt5/qtsensors/qtsensors-maze-maze-pro.html
  9616. share/doc/qt5/qtsensors/qtsensors-maze-maze-qml.html
  9617. share/doc/qt5/qtsensors/qtsensors-maze-maze-qrc.html
  9618. share/doc/qt5/qtsensors/qtsensors-maze-mouse-qml.html
  9619. share/doc/qt5/qtsensors/qtsensors-module.html
  9620. share/doc/qt5/qtsensors/qtsensors-porting.html
  9621. share/doc/qt5/qtsensors/qtsensors-qmlmodule.html
  9622. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-applicationwindow-qml.html
  9623. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-button-qml.html
  9624. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-divider-qml.html
  9625. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-example.html
  9626. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-main-cpp.html
  9627. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-pro.html
  9628. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qml.html
  9629. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qrc.html
  9630. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-button-qml.html
  9631. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-example.html
  9632. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gesturelist-qml.html
  9633. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gesturesview-qml.html
  9634. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gestureview-qml.html
  9635. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-main-cpp.html
  9636. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-plugin-pro.html
  9637. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-cpp.html
  9638. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-h.html
  9639. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-cpp.html
  9640. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-h.html
  9641. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qml-pro.html
  9642. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qml-qrc.html
  9643. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-pro.html
  9644. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-qml.html
  9645. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-example.html
  9646. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-explorer-cpp.html
  9647. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-explorer-h.html
  9648. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-import-pro.html
  9649. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-cpp.html
  9650. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-h.html
  9651. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-qmldir.html
  9652. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-sensoritem-cpp.html
  9653. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-sensoritem-h.html
  9654. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-main-cpp.html
  9655. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-qml-pro.html
  9656. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-qml-qrc.html
  9657. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-sensor-explorer-pro.html
  9658. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-sensor-explorer-qml.html
  9659. share/doc/qt5/qtsensors/qtsensors-sensorgestures-example.html
  9660. share/doc/qt5/qtsensors/qtsensors-sensorgestures-main-cpp.html
  9661. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-cpp.html
  9662. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-h.html
  9663. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-ui.html
  9664. share/doc/qt5/qtsensors/qtsensors-sensorgestures-sensorgestures-pro.html
  9665. share/doc/qt5/qtsensors/qtsensors-shakeit-example.html
  9666. share/doc/qt5/qtsensors/qtsensors-shakeit-main-cpp.html
  9667. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-pro.html
  9668. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-qml.html
  9669. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-qrc.html
  9670. share/doc/qt5/qtsensors/qtsensors.index
  9671. share/doc/qt5/qtsensors/qtsensors.qhp
  9672. share/doc/qt5/qtsensors/qtsensors.qhp.sha1
  9673. share/doc/qt5/qtsensors/qtsensors.tags
  9674. share/doc/qt5/qtsensors/senorfwbackend.html
  9675. share/doc/qt5/qtsensors/sensorgesture-emulator-topics.html
  9676. share/doc/qt5/qtsensors/sensorgesture-plugins-topics.html
  9677. share/doc/qt5/qtsensors/sensors-backend-topics.html
  9678. share/doc/qt5/qtsensors/style/offline-simple.css
  9679. share/doc/qt5/qtsensors/style/offline.css
  9680. share/doc/qt5/qtserialbus.qch
  9681. share/doc/qt5/qtserialbus/examples-manifest.xml
  9682. share/doc/qt5/qtserialbus/images/arrow_bc.png
  9683. share/doc/qt5/qtserialbus/images/bgrContent.png
  9684. share/doc/qt5/qtserialbus/images/btn_next.png
  9685. share/doc/qt5/qtserialbus/images/btn_prev.png
  9686. share/doc/qt5/qtserialbus/images/bullet_dn.png
  9687. share/doc/qt5/qtserialbus/images/bullet_sq.png
  9688. share/doc/qt5/qtserialbus/images/can-example.png
  9689. share/doc/qt5/qtserialbus/images/home.png
  9690. share/doc/qt5/qtserialbus/images/ico_note.png
  9691. share/doc/qt5/qtserialbus/images/ico_note_attention.png
  9692. share/doc/qt5/qtserialbus/images/ico_out.png
  9693. share/doc/qt5/qtserialbus/images/logo.png
  9694. share/doc/qt5/qtserialbus/images/modbusmaster.png
  9695. share/doc/qt5/qtserialbus/images/modbusserver.png
  9696. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/application-exit.png
  9697. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/clear.png
  9698. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/connect.png
  9699. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/disconnect.png
  9700. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/application-exit.png
  9701. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/connect.png
  9702. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/disconnect.png
  9703. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/settings.png
  9704. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/application-exit.png
  9705. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/connect.png
  9706. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/disconnect.png
  9707. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/settings.png
  9708. share/doc/qt5/qtserialbus/qcanbus-members.html
  9709. share/doc/qt5/qtserialbus/qcanbus.html
  9710. share/doc/qt5/qtserialbus/qcanbusdevice-filter-members.html
  9711. share/doc/qt5/qtserialbus/qcanbusdevice-filter.html
  9712. share/doc/qt5/qtserialbus/qcanbusdevice-members.html
  9713. share/doc/qt5/qtserialbus/qcanbusdevice.html
  9714. share/doc/qt5/qtserialbus/qcanbusdeviceinfo-members.html
  9715. share/doc/qt5/qtserialbus/qcanbusdeviceinfo.html
  9716. share/doc/qt5/qtserialbus/qcanbusfactory-members.html
  9717. share/doc/qt5/qtserialbus/qcanbusfactory.html
  9718. share/doc/qt5/qtserialbus/qcanbusfactoryv2-members.html
  9719. share/doc/qt5/qtserialbus/qcanbusfactoryv2.html
  9720. share/doc/qt5/qtserialbus/qcanbusframe-members.html
  9721. share/doc/qt5/qtserialbus/qcanbusframe-timestamp-members.html
  9722. share/doc/qt5/qtserialbus/qcanbusframe-timestamp.html
  9723. share/doc/qt5/qtserialbus/qcanbusframe.html
  9724. share/doc/qt5/qtserialbus/qmodbusclient-members.html
  9725. share/doc/qt5/qtserialbus/qmodbusclient.html
  9726. share/doc/qt5/qtserialbus/qmodbusdataunit-members.html
  9727. share/doc/qt5/qtserialbus/qmodbusdataunit.html
  9728. share/doc/qt5/qtserialbus/qmodbusdevice-members.html
  9729. share/doc/qt5/qtserialbus/qmodbusdevice.html
  9730. share/doc/qt5/qtserialbus/qmodbusdeviceidentification-members.html
  9731. share/doc/qt5/qtserialbus/qmodbusdeviceidentification.html
  9732. share/doc/qt5/qtserialbus/qmodbusexceptionresponse-members.html
  9733. share/doc/qt5/qtserialbus/qmodbusexceptionresponse.html
  9734. share/doc/qt5/qtserialbus/qmodbuspdu-members.html
  9735. share/doc/qt5/qtserialbus/qmodbuspdu.html
  9736. share/doc/qt5/qtserialbus/qmodbusreply-members.html
  9737. share/doc/qt5/qtserialbus/qmodbusreply.html
  9738. share/doc/qt5/qtserialbus/qmodbusrequest-members.html
  9739. share/doc/qt5/qtserialbus/qmodbusrequest.html
  9740. share/doc/qt5/qtserialbus/qmodbusresponse-members.html
  9741. share/doc/qt5/qtserialbus/qmodbusresponse.html
  9742. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster-members.html
  9743. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster.html
  9744. share/doc/qt5/qtserialbus/qmodbusrtuserialslave-members.html
  9745. share/doc/qt5/qtserialbus/qmodbusrtuserialslave.html
  9746. share/doc/qt5/qtserialbus/qmodbusserver-members.html
  9747. share/doc/qt5/qtserialbus/qmodbusserver.html
  9748. share/doc/qt5/qtserialbus/qmodbustcpclient-members.html
  9749. share/doc/qt5/qtserialbus/qmodbustcpclient.html
  9750. share/doc/qt5/qtserialbus/qmodbustcpserver-members.html
  9751. share/doc/qt5/qtserialbus/qmodbustcpserver.html
  9752. share/doc/qt5/qtserialbus/qtcanbus-backends.html
  9753. share/doc/qt5/qtserialbus/qtmodbus-backends.html
  9754. share/doc/qt5/qtserialbus/qtserialbus-can-bitratebox-cpp.html
  9755. share/doc/qt5/qtserialbus/qtserialbus-can-bitratebox-h.html
  9756. share/doc/qt5/qtserialbus/qtserialbus-can-can-pro.html
  9757. share/doc/qt5/qtserialbus/qtserialbus-can-can-qrc.html
  9758. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-cpp.html
  9759. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-h.html
  9760. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-ui.html
  9761. share/doc/qt5/qtserialbus/qtserialbus-can-example.html
  9762. share/doc/qt5/qtserialbus/qtserialbus-can-main-cpp.html
  9763. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-cpp.html
  9764. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-h.html
  9765. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-ui.html
  9766. share/doc/qt5/qtserialbus/qtserialbus-examples.html
  9767. share/doc/qt5/qtserialbus/qtserialbus-index.html
  9768. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-example.html
  9769. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-main-cpp.html
  9770. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-cpp.html
  9771. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-h.html
  9772. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-ui.html
  9773. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-master-pro.html
  9774. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-master-qrc.html
  9775. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-cpp.html
  9776. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-h.html
  9777. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-ui.html
  9778. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-writeregistermodel-cpp.html
  9779. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-writeregistermodel-h.html
  9780. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-example.html
  9781. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-main-cpp.html
  9782. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-cpp.html
  9783. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-h.html
  9784. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-ui.html
  9785. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-cpp.html
  9786. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-h.html
  9787. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-ui.html
  9788. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-slave-pro.html
  9789. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-slave-qrc.html
  9790. share/doc/qt5/qtserialbus/qtserialbus-module.html
  9791. share/doc/qt5/qtserialbus/qtserialbus-peakcan-overview.html
  9792. share/doc/qt5/qtserialbus/qtserialbus-socketcan-overview.html
  9793. share/doc/qt5/qtserialbus/qtserialbus-systeccan-overview.html
  9794. share/doc/qt5/qtserialbus/qtserialbus-tinycan-overview.html
  9795. share/doc/qt5/qtserialbus/qtserialbus-vectorcan-overview.html
  9796. share/doc/qt5/qtserialbus/qtserialbus.index
  9797. share/doc/qt5/qtserialbus/qtserialbus.qhp
  9798. share/doc/qt5/qtserialbus/qtserialbus.qhp.sha1
  9799. share/doc/qt5/qtserialbus/qtserialbus.tags
  9800. share/doc/qt5/qtserialbus/style/offline-simple.css
  9801. share/doc/qt5/qtserialbus/style/offline.css
  9802. share/doc/qt5/qtserialport.qch
  9803. share/doc/qt5/qtserialport/examples-manifest.xml
  9804. share/doc/qt5/qtserialport/images/arrow_bc.png
  9805. share/doc/qt5/qtserialport/images/bgrContent.png
  9806. share/doc/qt5/qtserialport/images/blockingmaster-example.png
  9807. share/doc/qt5/qtserialport/images/blockingslave-example.png
  9808. share/doc/qt5/qtserialport/images/btn_next.png
  9809. share/doc/qt5/qtserialport/images/btn_prev.png
  9810. share/doc/qt5/qtserialport/images/bullet_dn.png
  9811. share/doc/qt5/qtserialport/images/bullet_sq.png
  9812. share/doc/qt5/qtserialport/images/cenumerator-example.png
  9813. share/doc/qt5/qtserialport/images/creaderasync-example.png
  9814. share/doc/qt5/qtserialport/images/creadersync-example.png
  9815. share/doc/qt5/qtserialport/images/cwriterasync-example.png
  9816. share/doc/qt5/qtserialport/images/cwritersync-example.png
  9817. share/doc/qt5/qtserialport/images/enumerator-example.png
  9818. share/doc/qt5/qtserialport/images/home.png
  9819. share/doc/qt5/qtserialport/images/ico_note.png
  9820. share/doc/qt5/qtserialport/images/ico_note_attention.png
  9821. share/doc/qt5/qtserialport/images/ico_out.png
  9822. share/doc/qt5/qtserialport/images/logo.png
  9823. share/doc/qt5/qtserialport/images/terminal-example.png
  9824. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/application-exit.png
  9825. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/clear.png
  9826. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/connect.png
  9827. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/disconnect.png
  9828. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/settings.png
  9829. share/doc/qt5/qtserialport/qserialport-members.html
  9830. share/doc/qt5/qtserialport/qserialport-obsolete.html
  9831. share/doc/qt5/qtserialport/qserialport.html
  9832. share/doc/qt5/qtserialport/qserialportinfo-members.html
  9833. share/doc/qt5/qtserialport/qserialportinfo-obsolete.html
  9834. share/doc/qt5/qtserialport/qserialportinfo.html
  9835. share/doc/qt5/qtserialport/qtserialport-blockingmaster-blockingmaster-pro.html
  9836. share/doc/qt5/qtserialport/qtserialport-blockingmaster-dialog-cpp.html
  9837. share/doc/qt5/qtserialport/qtserialport-blockingmaster-dialog-h.html
  9838. share/doc/qt5/qtserialport/qtserialport-blockingmaster-example.html
  9839. share/doc/qt5/qtserialport/qtserialport-blockingmaster-main-cpp.html
  9840. share/doc/qt5/qtserialport/qtserialport-blockingmaster-masterthread-cpp.html
  9841. share/doc/qt5/qtserialport/qtserialport-blockingmaster-masterthread-h.html
  9842. share/doc/qt5/qtserialport/qtserialport-blockingslave-blockingslave-pro.html
  9843. share/doc/qt5/qtserialport/qtserialport-blockingslave-dialog-cpp.html
  9844. share/doc/qt5/qtserialport/qtserialport-blockingslave-dialog-h.html
  9845. share/doc/qt5/qtserialport/qtserialport-blockingslave-example.html
  9846. share/doc/qt5/qtserialport/qtserialport-blockingslave-main-cpp.html
  9847. share/doc/qt5/qtserialport/qtserialport-blockingslave-slavethread-cpp.html
  9848. share/doc/qt5/qtserialport/qtserialport-blockingslave-slavethread-h.html
  9849. share/doc/qt5/qtserialport/qtserialport-cenumerator-cenumerator-pro.html
  9850. share/doc/qt5/qtserialport/qtserialport-cenumerator-example.html
  9851. share/doc/qt5/qtserialport/qtserialport-cenumerator-main-cpp.html
  9852. share/doc/qt5/qtserialport/qtserialport-creaderasync-creaderasync-pro.html
  9853. share/doc/qt5/qtserialport/qtserialport-creaderasync-example.html
  9854. share/doc/qt5/qtserialport/qtserialport-creaderasync-main-cpp.html
  9855. share/doc/qt5/qtserialport/qtserialport-creaderasync-serialportreader-cpp.html
  9856. share/doc/qt5/qtserialport/qtserialport-creaderasync-serialportreader-h.html
  9857. share/doc/qt5/qtserialport/qtserialport-creadersync-creadersync-pro.html
  9858. share/doc/qt5/qtserialport/qtserialport-creadersync-example.html
  9859. share/doc/qt5/qtserialport/qtserialport-creadersync-main-cpp.html
  9860. share/doc/qt5/qtserialport/qtserialport-cwriterasync-cwriterasync-pro.html
  9861. share/doc/qt5/qtserialport/qtserialport-cwriterasync-example.html
  9862. share/doc/qt5/qtserialport/qtserialport-cwriterasync-main-cpp.html
  9863. share/doc/qt5/qtserialport/qtserialport-cwriterasync-serialportwriter-cpp.html
  9864. share/doc/qt5/qtserialport/qtserialport-cwriterasync-serialportwriter-h.html
  9865. share/doc/qt5/qtserialport/qtserialport-cwritersync-cwritersync-pro.html
  9866. share/doc/qt5/qtserialport/qtserialport-cwritersync-example.html
  9867. share/doc/qt5/qtserialport/qtserialport-cwritersync-main-cpp.html
  9868. share/doc/qt5/qtserialport/qtserialport-enumerator-enumerator-pro.html
  9869. share/doc/qt5/qtserialport/qtserialport-enumerator-example.html
  9870. share/doc/qt5/qtserialport/qtserialport-enumerator-main-cpp.html
  9871. share/doc/qt5/qtserialport/qtserialport-examples.html
  9872. share/doc/qt5/qtserialport/qtserialport-index.html
  9873. share/doc/qt5/qtserialport/qtserialport-module.html
  9874. share/doc/qt5/qtserialport/qtserialport-terminal-console-cpp.html
  9875. share/doc/qt5/qtserialport/qtserialport-terminal-console-h.html
  9876. share/doc/qt5/qtserialport/qtserialport-terminal-example.html
  9877. share/doc/qt5/qtserialport/qtserialport-terminal-main-cpp.html
  9878. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-cpp.html
  9879. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-h.html
  9880. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-ui.html
  9881. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-cpp.html
  9882. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-h.html
  9883. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-ui.html
  9884. share/doc/qt5/qtserialport/qtserialport-terminal-terminal-pro.html
  9885. share/doc/qt5/qtserialport/qtserialport-terminal-terminal-qrc.html
  9886. share/doc/qt5/qtserialport/qtserialport.index
  9887. share/doc/qt5/qtserialport/qtserialport.qhp
  9888. share/doc/qt5/qtserialport/qtserialport.qhp.sha1
  9889. share/doc/qt5/qtserialport/style/offline-simple.css
  9890. share/doc/qt5/qtserialport/style/offline.css
  9891. share/doc/qt5/qtsql.qch
  9892. share/doc/qt5/qtsql/database.html
  9893. share/doc/qt5/qtsql/examples-manifest.xml
  9894. share/doc/qt5/qtsql/images/arrow_bc.png
  9895. share/doc/qt5/qtsql/images/bgrContent.png
  9896. share/doc/qt5/qtsql/images/books-demo.png
  9897. share/doc/qt5/qtsql/images/btn_next.png
  9898. share/doc/qt5/qtsql/images/btn_prev.png
  9899. share/doc/qt5/qtsql/images/bullet_dn.png
  9900. share/doc/qt5/qtsql/images/bullet_sq.png
  9901. share/doc/qt5/qtsql/images/cachedtable-example.png
  9902. share/doc/qt5/qtsql/images/drilldown-example.png
  9903. share/doc/qt5/qtsql/images/foreignkeys.png
  9904. share/doc/qt5/qtsql/images/home.png
  9905. share/doc/qt5/qtsql/images/ico_note.png
  9906. share/doc/qt5/qtsql/images/ico_note_attention.png
  9907. share/doc/qt5/qtsql/images/ico_out.png
  9908. share/doc/qt5/qtsql/images/insertrowinmodelview.png
  9909. share/doc/qt5/qtsql/images/logo.png
  9910. share/doc/qt5/qtsql/images/masterdetail-example.png
  9911. share/doc/qt5/qtsql/images/noforeignkeys.png
  9912. share/doc/qt5/qtsql/images/qdatawidgetmapper-simple.png
  9913. share/doc/qt5/qtsql/images/querymodel-example.png
  9914. share/doc/qt5/qtsql/images/relationaltable.png
  9915. share/doc/qt5/qtsql/images/relationaltablemodel-example.png
  9916. share/doc/qt5/qtsql/images/sql-widget-mapper.png
  9917. share/doc/qt5/qtsql/images/sqlbrowser-demo.png
  9918. share/doc/qt5/qtsql/images/tablemodel-example.png
  9919. share/doc/qt5/qtsql/images/used-in-examples/books/images/star.png
  9920. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-creator.png
  9921. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-logo.png
  9922. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-project.png
  9923. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-quick.png
  9924. share/doc/qt5/qtsql/images/used-in-examples/masterdetail/images/icon.png
  9925. share/doc/qt5/qtsql/images/used-in-examples/masterdetail/images/image.png
  9926. share/doc/qt5/qtsql/images/widgetmapper-sql-mapping-table.png
  9927. share/doc/qt5/qtsql/images/widgetmapper-sql-mapping.png
  9928. share/doc/qt5/qtsql/qsql.html
  9929. share/doc/qt5/qtsql/qsqldatabase-members.html
  9930. share/doc/qt5/qtsql/qsqldatabase.html
  9931. share/doc/qt5/qtsql/qsqldriver-members.html
  9932. share/doc/qt5/qtsql/qsqldriver.html
  9933. share/doc/qt5/qtsql/qsqldrivercreator-members.html
  9934. share/doc/qt5/qtsql/qsqldrivercreator.html
  9935. share/doc/qt5/qtsql/qsqldrivercreatorbase-members.html
  9936. share/doc/qt5/qtsql/qsqldrivercreatorbase.html
  9937. share/doc/qt5/qtsql/qsqldriverplugin-members.html
  9938. share/doc/qt5/qtsql/qsqldriverplugin.html
  9939. share/doc/qt5/qtsql/qsqlerror-members.html
  9940. share/doc/qt5/qtsql/qsqlerror-obsolete.html
  9941. share/doc/qt5/qtsql/qsqlerror.html
  9942. share/doc/qt5/qtsql/qsqlfield-members.html
  9943. share/doc/qt5/qtsql/qsqlfield.html
  9944. share/doc/qt5/qtsql/qsqlindex-members.html
  9945. share/doc/qt5/qtsql/qsqlindex.html
  9946. share/doc/qt5/qtsql/qsqlquery-members.html
  9947. share/doc/qt5/qtsql/qsqlquery.html
  9948. share/doc/qt5/qtsql/qsqlquerymodel-members.html
  9949. share/doc/qt5/qtsql/qsqlquerymodel.html
  9950. share/doc/qt5/qtsql/qsqlrecord-members.html
  9951. share/doc/qt5/qtsql/qsqlrecord.html
  9952. share/doc/qt5/qtsql/qsqlrelation-members.html
  9953. share/doc/qt5/qtsql/qsqlrelation.html
  9954. share/doc/qt5/qtsql/qsqlrelationaldelegate-members.html
  9955. share/doc/qt5/qtsql/qsqlrelationaldelegate.html
  9956. share/doc/qt5/qtsql/qsqlrelationaltablemodel-members.html
  9957. share/doc/qt5/qtsql/qsqlrelationaltablemodel.html
  9958. share/doc/qt5/qtsql/qsqlresult-members.html
  9959. share/doc/qt5/qtsql/qsqlresult.html
  9960. share/doc/qt5/qtsql/qsqltablemodel-members.html
  9961. share/doc/qt5/qtsql/qsqltablemodel.html
  9962. share/doc/qt5/qtsql/qtsql-attribution-sqlite.html
  9963. share/doc/qt5/qtsql/qtsql-books-bookdelegate-cpp.html
  9964. share/doc/qt5/qtsql/qtsql-books-bookdelegate-h.html
  9965. share/doc/qt5/qtsql/qtsql-books-books-pro.html
  9966. share/doc/qt5/qtsql/qtsql-books-books-qrc.html
  9967. share/doc/qt5/qtsql/qtsql-books-bookwindow-cpp.html
  9968. share/doc/qt5/qtsql/qtsql-books-bookwindow-h.html
  9969. share/doc/qt5/qtsql/qtsql-books-bookwindow-ui.html
  9970. share/doc/qt5/qtsql/qtsql-books-example.html
  9971. share/doc/qt5/qtsql/qtsql-books-initdb-h.html
  9972. share/doc/qt5/qtsql/qtsql-books-main-cpp.html
  9973. share/doc/qt5/qtsql/qtsql-cachedtable-cachedtable-pro.html
  9974. share/doc/qt5/qtsql/qtsql-cachedtable-example.html
  9975. share/doc/qt5/qtsql/qtsql-cachedtable-main-cpp.html
  9976. share/doc/qt5/qtsql/qtsql-cachedtable-tableeditor-cpp.html
  9977. share/doc/qt5/qtsql/qtsql-cachedtable-tableeditor-h.html
  9978. share/doc/qt5/qtsql/qtsql-drilldown-drilldown-pro.html
  9979. share/doc/qt5/qtsql/qtsql-drilldown-drilldown-qrc.html
  9980. share/doc/qt5/qtsql/qtsql-drilldown-example.html
  9981. share/doc/qt5/qtsql/qtsql-drilldown-imageitem-cpp.html
  9982. share/doc/qt5/qtsql/qtsql-drilldown-imageitem-h.html
  9983. share/doc/qt5/qtsql/qtsql-drilldown-informationwindow-cpp.html
  9984. share/doc/qt5/qtsql/qtsql-drilldown-informationwindow-h.html
  9985. share/doc/qt5/qtsql/qtsql-drilldown-main-cpp.html
  9986. share/doc/qt5/qtsql/qtsql-drilldown-view-cpp.html
  9987. share/doc/qt5/qtsql/qtsql-drilldown-view-h.html
  9988. share/doc/qt5/qtsql/qtsql-index.html
  9989. share/doc/qt5/qtsql/qtsql-masterdetail-albumdetails-xml.html
  9990. share/doc/qt5/qtsql/qtsql-masterdetail-database-h.html
  9991. share/doc/qt5/qtsql/qtsql-masterdetail-dialog-cpp.html
  9992. share/doc/qt5/qtsql/qtsql-masterdetail-dialog-h.html
  9993. share/doc/qt5/qtsql/qtsql-masterdetail-example.html
  9994. share/doc/qt5/qtsql/qtsql-masterdetail-main-cpp.html
  9995. share/doc/qt5/qtsql/qtsql-masterdetail-mainwindow-cpp.html
  9996. share/doc/qt5/qtsql/qtsql-masterdetail-mainwindow-h.html
  9997. share/doc/qt5/qtsql/qtsql-masterdetail-masterdetail-pro.html
  9998. share/doc/qt5/qtsql/qtsql-masterdetail-masterdetail-qrc.html
  9999. share/doc/qt5/qtsql/qtsql-module.html
  10000. share/doc/qt5/qtsql/qtsql-querymodel-customsqlmodel-cpp.html
  10001. share/doc/qt5/qtsql/qtsql-querymodel-customsqlmodel-h.html
  10002. share/doc/qt5/qtsql/qtsql-querymodel-editablesqlmodel-cpp.html
  10003. share/doc/qt5/qtsql/qtsql-querymodel-editablesqlmodel-h.html
  10004. share/doc/qt5/qtsql/qtsql-querymodel-example.html
  10005. share/doc/qt5/qtsql/qtsql-querymodel-main-cpp.html
  10006. share/doc/qt5/qtsql/qtsql-querymodel-querymodel-pro.html
  10007. share/doc/qt5/qtsql/qtsql-relationaltablemodel-example.html
  10008. share/doc/qt5/qtsql/qtsql-relationaltablemodel-relationaltablemodel-cpp.html
  10009. share/doc/qt5/qtsql/qtsql-relationaltablemodel-relationaltablemodel-pro.html
  10010. share/doc/qt5/qtsql/qtsql-sqlbrowser-browser-cpp.html
  10011. share/doc/qt5/qtsql/qtsql-sqlbrowser-browser-h.html
  10012. share/doc/qt5/qtsql/qtsql-sqlbrowser-browserwidget-ui.html
  10013. share/doc/qt5/qtsql/qtsql-sqlbrowser-connectionwidget-cpp.html
  10014. share/doc/qt5/qtsql/qtsql-sqlbrowser-connectionwidget-h.html
  10015. share/doc/qt5/qtsql/qtsql-sqlbrowser-example.html
  10016. share/doc/qt5/qtsql/qtsql-sqlbrowser-main-cpp.html
  10017. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-cpp.html
  10018. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-h.html
  10019. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-ui.html
  10020. share/doc/qt5/qtsql/qtsql-sqlbrowser-sqlbrowser-pro.html
  10021. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-example.html
  10022. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-main-cpp.html
  10023. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-sqlwidgetmapper-pro.html
  10024. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-window-cpp.html
  10025. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-window-h.html
  10026. share/doc/qt5/qtsql/qtsql-tablemodel-example.html
  10027. share/doc/qt5/qtsql/qtsql-tablemodel-tablemodel-cpp.html
  10028. share/doc/qt5/qtsql/qtsql-tablemodel-tablemodel-pro.html
  10029. share/doc/qt5/qtsql/qtsql.index
  10030. share/doc/qt5/qtsql/qtsql.qhp
  10031. share/doc/qt5/qtsql/qtsql.qhp.sha1
  10032. share/doc/qt5/qtsql/qtsql.tags
  10033. share/doc/qt5/qtsql/sql-connecting.html
  10034. share/doc/qt5/qtsql/sql-driver.html
  10035. share/doc/qt5/qtsql/sql-forms.html
  10036. share/doc/qt5/qtsql/sql-model.html
  10037. share/doc/qt5/qtsql/sql-presenting.html
  10038. share/doc/qt5/qtsql/sql-programming.html
  10039. share/doc/qt5/qtsql/sql-sqlstatements.html
  10040. share/doc/qt5/qtsql/sql-types.html
  10041. share/doc/qt5/qtsql/style/offline-simple.css
  10042. share/doc/qt5/qtsql/style/offline.css
  10043. share/doc/qt5/qtsvg.qch
  10044. share/doc/qt5/qtsvg/examples-manifest.xml
  10045. share/doc/qt5/qtsvg/images/arrow_bc.png
  10046. share/doc/qt5/qtsvg/images/bgrContent.png
  10047. share/doc/qt5/qtsvg/images/btn_next.png
  10048. share/doc/qt5/qtsvg/images/btn_prev.png
  10049. share/doc/qt5/qtsvg/images/bullet_dn.png
  10050. share/doc/qt5/qtsvg/images/bullet_sq.png
  10051. share/doc/qt5/qtsvg/images/home.png
  10052. share/doc/qt5/qtsvg/images/ico_note.png
  10053. share/doc/qt5/qtsvg/images/ico_note_attention.png
  10054. share/doc/qt5/qtsvg/images/ico_out.png
  10055. share/doc/qt5/qtsvg/images/logo.png
  10056. share/doc/qt5/qtsvg/images/svggenerator-example.png
  10057. share/doc/qt5/qtsvg/images/svgviewer-example.png
  10058. share/doc/qt5/qtsvg/images/textobject-example.png
  10059. share/doc/qt5/qtsvg/qgraphicssvgitem-members.html
  10060. share/doc/qt5/qtsvg/qgraphicssvgitem-obsolete.html
  10061. share/doc/qt5/qtsvg/qgraphicssvgitem.html
  10062. share/doc/qt5/qtsvg/qsvggenerator-members.html
  10063. share/doc/qt5/qtsvg/qsvggenerator.html
  10064. share/doc/qt5/qtsvg/qsvgrenderer-members.html
  10065. share/doc/qt5/qtsvg/qsvgrenderer.html
  10066. share/doc/qt5/qtsvg/qsvgwidget-members.html
  10067. share/doc/qt5/qtsvg/qsvgwidget.html
  10068. share/doc/qt5/qtsvg/qtsvg-attribution-xsvg.html
  10069. share/doc/qt5/qtsvg/qtsvg-index.html
  10070. share/doc/qt5/qtsvg/qtsvg-module.html
  10071. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-example.html
  10072. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-files-heart-svg.html
  10073. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-main-cpp.html
  10074. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-resources-qrc.html
  10075. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-svgtextobject-cpp.html
  10076. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-svgtextobject-h.html
  10077. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-textobject-pro.html
  10078. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-window-cpp.html
  10079. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-window-h.html
  10080. share/doc/qt5/qtsvg/qtsvg-svggenerator-displaywidget-cpp.html
  10081. share/doc/qt5/qtsvg/qtsvg-svggenerator-displaywidget-h.html
  10082. share/doc/qt5/qtsvg/qtsvg-svggenerator-example.html
  10083. share/doc/qt5/qtsvg/qtsvg-svggenerator-forms-window-ui.html
  10084. share/doc/qt5/qtsvg/qtsvg-svggenerator-main-cpp.html
  10085. share/doc/qt5/qtsvg/qtsvg-svggenerator-svggenerator-pro.html
  10086. share/doc/qt5/qtsvg/qtsvg-svggenerator-svggenerator-qrc.html
  10087. share/doc/qt5/qtsvg/qtsvg-svggenerator-window-cpp.html
  10088. share/doc/qt5/qtsvg/qtsvg-svggenerator-window-h.html
  10089. share/doc/qt5/qtsvg/qtsvg-svgviewer-example.html
  10090. share/doc/qt5/qtsvg/qtsvg-svgviewer-exportdialog-cpp.html
  10091. share/doc/qt5/qtsvg/qtsvg-svgviewer-exportdialog-h.html
  10092. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-bubbles-svg.html
  10093. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-cubic-svg.html
  10094. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-spheres-svg.html
  10095. share/doc/qt5/qtsvg/qtsvg-svgviewer-main-cpp.html
  10096. share/doc/qt5/qtsvg/qtsvg-svgviewer-mainwindow-cpp.html
  10097. share/doc/qt5/qtsvg/qtsvg-svgviewer-mainwindow-h.html
  10098. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgview-cpp.html
  10099. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgview-h.html
  10100. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgviewer-pro.html
  10101. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgviewer-qrc.html
  10102. share/doc/qt5/qtsvg/qtsvg.index
  10103. share/doc/qt5/qtsvg/qtsvg.qhp
  10104. share/doc/qt5/qtsvg/qtsvg.qhp.sha1
  10105. share/doc/qt5/qtsvg/qtsvg.tags
  10106. share/doc/qt5/qtsvg/style/offline-simple.css
  10107. share/doc/qt5/qtsvg/style/offline.css
  10108. share/doc/qt5/qtsvg/svgrendering.html
  10109. share/doc/qt5/qttestlib.qch
  10110. share/doc/qt5/qttestlib/examples-manifest.xml
  10111. share/doc/qt5/qttestlib/images/arrow_bc.png
  10112. share/doc/qt5/qttestlib/images/bgrContent.png
  10113. share/doc/qt5/qttestlib/images/btn_next.png
  10114. share/doc/qt5/qttestlib/images/btn_prev.png
  10115. share/doc/qt5/qttestlib/images/bullet_dn.png
  10116. share/doc/qt5/qttestlib/images/bullet_sq.png
  10117. share/doc/qt5/qttestlib/images/home.png
  10118. share/doc/qt5/qttestlib/images/ico_note.png
  10119. share/doc/qt5/qttestlib/images/ico_note_attention.png
  10120. share/doc/qt5/qttestlib/images/ico_out.png
  10121. share/doc/qt5/qttestlib/images/logo.png
  10122. share/doc/qt5/qttestlib/qsignalspy-members.html
  10123. share/doc/qt5/qttestlib/qsignalspy.html
  10124. share/doc/qt5/qttestlib/qtest-obsolete.html
  10125. share/doc/qt5/qttestlib/qtest-overview.html
  10126. share/doc/qt5/qttestlib/qtest-qtoucheventsequence-members.html
  10127. share/doc/qt5/qttestlib/qtest-qtoucheventsequence.html
  10128. share/doc/qt5/qttestlib/qtest-tutorial.html
  10129. share/doc/qt5/qttestlib/qtest.html
  10130. share/doc/qt5/qttestlib/qtesteventlist-members.html
  10131. share/doc/qt5/qttestlib/qtesteventlist.html
  10132. share/doc/qt5/qttestlib/qttest-index.html
  10133. share/doc/qt5/qttestlib/qttest-module.html
  10134. share/doc/qt5/qttestlib/qttestlib-attribution-cycle.html
  10135. share/doc/qt5/qttestlib/qttestlib-attribution-linuxperf.html
  10136. share/doc/qt5/qttestlib/qttestlib-attribution-valgrind.html
  10137. share/doc/qt5/qttestlib/qttestlib-tutorial1-example.html
  10138. share/doc/qt5/qttestlib/qttestlib-tutorial1-testqstring-cpp.html
  10139. share/doc/qt5/qttestlib/qttestlib-tutorial1-tutorial1-pro.html
  10140. share/doc/qt5/qttestlib/qttestlib-tutorial2-example.html
  10141. share/doc/qt5/qttestlib/qttestlib-tutorial2-testqstring-cpp.html
  10142. share/doc/qt5/qttestlib/qttestlib-tutorial2-tutorial2-pro.html
  10143. share/doc/qt5/qttestlib/qttestlib-tutorial3-example.html
  10144. share/doc/qt5/qttestlib/qttestlib-tutorial3-testgui-cpp.html
  10145. share/doc/qt5/qttestlib/qttestlib-tutorial3-tutorial3-pro.html
  10146. share/doc/qt5/qttestlib/qttestlib-tutorial4-example.html
  10147. share/doc/qt5/qttestlib/qttestlib-tutorial4-testgui-cpp.html
  10148. share/doc/qt5/qttestlib/qttestlib-tutorial4-tutorial4-pro.html
  10149. share/doc/qt5/qttestlib/qttestlib-tutorial5-benchmarking-cpp.html
  10150. share/doc/qt5/qttestlib/qttestlib-tutorial5-example.html
  10151. share/doc/qt5/qttestlib/qttestlib-tutorial5-tutorial5-pro.html
  10152. share/doc/qt5/qttestlib/qttestlib.index
  10153. share/doc/qt5/qttestlib/qttestlib.qhp
  10154. share/doc/qt5/qttestlib/qttestlib.qhp.sha1
  10155. share/doc/qt5/qttestlib/qttestlib.tags
  10156. share/doc/qt5/qttestlib/style/offline-simple.css
  10157. share/doc/qt5/qttestlib/style/offline.css
  10158. share/doc/qt5/qtuitools.qch
  10159. share/doc/qt5/qtuitools/examples-manifest.xml
  10160. share/doc/qt5/qtuitools/examples-qtuitools.html
  10161. share/doc/qt5/qtuitools/images/arrow_bc.png
  10162. share/doc/qt5/qtuitools/images/bgrContent.png
  10163. share/doc/qt5/qtuitools/images/btn_next.png
  10164. share/doc/qt5/qtuitools/images/btn_prev.png
  10165. share/doc/qt5/qtuitools/images/bullet_dn.png
  10166. share/doc/qt5/qtuitools/images/bullet_sq.png
  10167. share/doc/qt5/qtuitools/images/home.png
  10168. share/doc/qt5/qtuitools/images/ico_note.png
  10169. share/doc/qt5/qtuitools/images/ico_note_attention.png
  10170. share/doc/qt5/qtuitools/images/ico_out.png
  10171. share/doc/qt5/qtuitools/images/logo.png
  10172. share/doc/qt5/qtuitools/images/multipleinheritance-example.png
  10173. share/doc/qt5/qtuitools/images/textfinder-example-find.png
  10174. share/doc/qt5/qtuitools/images/textfinder-example-find2.png
  10175. share/doc/qt5/qtuitools/images/textfinder-example-userinterface.png
  10176. share/doc/qt5/qtuitools/images/uitools-examples.png
  10177. share/doc/qt5/qtuitools/qtuitools-index.html
  10178. share/doc/qt5/qtuitools/qtuitools-module.html
  10179. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-cpp.html
  10180. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-h.html
  10181. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-ui.html
  10182. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-example.html
  10183. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-main-cpp.html
  10184. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-multipleinheritance-pro.html
  10185. share/doc/qt5/qtuitools/qtuitools-textfinder-example.html
  10186. share/doc/qt5/qtuitools/qtuitools-textfinder-forms-textfinder-ui.html
  10187. share/doc/qt5/qtuitools/qtuitools-textfinder-main-cpp.html
  10188. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-cpp.html
  10189. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-h.html
  10190. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-pro.html
  10191. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-qrc.html
  10192. share/doc/qt5/qtuitools/qtuitools.index
  10193. share/doc/qt5/qtuitools/qtuitools.qhp
  10194. share/doc/qt5/qtuitools/qtuitools.qhp.sha1
  10195. share/doc/qt5/qtuitools/quiloader-members.html
  10196. share/doc/qt5/qtuitools/quiloader.html
  10197. share/doc/qt5/qtuitools/style/offline-simple.css
  10198. share/doc/qt5/qtuitools/style/offline.css
  10199. share/doc/qt5/qtwaylandcompositor.qch
  10200. share/doc/qt5/qtwaylandcompositor/examples-manifest.xml
  10201. share/doc/qt5/qtwaylandcompositor/images/arrow_bc.png
  10202. share/doc/qt5/qtwaylandcompositor/images/bgrContent.png
  10203. share/doc/qt5/qtwaylandcompositor/images/btn_next.png
  10204. share/doc/qt5/qtwaylandcompositor/images/btn_prev.png
  10205. share/doc/qt5/qtwaylandcompositor/images/bullet_dn.png
  10206. share/doc/qt5/qtwaylandcompositor/images/bullet_sq.png
  10207. share/doc/qt5/qtwaylandcompositor/images/home.png
  10208. share/doc/qt5/qtwaylandcompositor/images/ico_note.png
  10209. share/doc/qt5/qtwaylandcompositor/images/ico_note_attention.png
  10210. share/doc/qt5/qtwaylandcompositor/images/ico_out.png
  10211. share/doc/qt5/qtwaylandcompositor/images/logo.png
  10212. share/doc/qt5/qtwaylandcompositor/images/used-in-examples/multi-output/images/background.jpg
  10213. share/doc/qt5/qtwaylandcompositor/images/used-in-examples/pure-qml/images/background.jpg
  10214. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-members.html
  10215. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication.html
  10216. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface-members.html
  10217. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface.html
  10218. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem-members.html
  10219. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem.html
  10220. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient-members.html
  10221. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient.html
  10222. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor-members.html
  10223. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor.html
  10224. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput-members.html
  10225. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput.html
  10226. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem-members.html
  10227. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem.html
  10228. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat-members.html
  10229. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat.html
  10230. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface-members.html
  10231. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface.html
  10232. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandview-members.html
  10233. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandview.html
  10234. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-members.html
  10235. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshell.html
  10236. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface-members.html
  10237. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface.html
  10238. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5-members.html
  10239. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5.html
  10240. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5-members.html
  10241. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5.html
  10242. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5-members.html
  10243. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5.html
  10244. share/doc/qt5/qtwaylandcompositor/qtwayland-compositor-qmlmodule.html
  10245. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-ivi-extension-protocol.html
  10246. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-protocol.html
  10247. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-txt-input-unstable.html
  10248. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-shell-protocol.html
  10249. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-examples.html
  10250. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-index.html
  10251. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-example.html
  10252. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-ivi-compositor-pro.html
  10253. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-ivi-compositor-qrc.html
  10254. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-main-cpp.html
  10255. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-main-qml.html
  10256. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-example.html
  10257. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-main-cpp.html
  10258. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-main-qml.html
  10259. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-minimal-qml-pro.html
  10260. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-minimal-qml-qrc.html
  10261. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-module.html
  10262. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-example.html
  10263. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-main-cpp.html
  10264. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-multi-output-pro.html
  10265. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-multi-output-qrc.html
  10266. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-gridscreen-qml.html
  10267. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-main-qml.html
  10268. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-shellchrome-qml.html
  10269. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-shellscreen-qml.html
  10270. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-example.html
  10271. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-main-cpp.html
  10272. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-multi-screen-pro.html
  10273. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-multi-screen-qrc.html
  10274. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-chrome-qml.html
  10275. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-main-qml.html
  10276. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-screen-qml.html
  10277. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-example.html
  10278. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-main-cpp.html
  10279. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-pure-qml-pro.html
  10280. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-pure-qml-qrc.html
  10281. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-chrome-qml.html
  10282. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-keyboard-qml.html
  10283. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-main-qml.html
  10284. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-screen-qml.html
  10285. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-compositor-cpp.html
  10286. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-compositor-h.html
  10287. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-example.html
  10288. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-main-cpp.html
  10289. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-qwindow-compositor-pro.html
  10290. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-qwindow-compositor-qrc.html
  10291. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-window-cpp.html
  10292. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-window-h.html
  10293. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-example.html
  10294. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-main-cpp.html
  10295. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-main-qml.html
  10296. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-spanning-screens-pro.html
  10297. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-spanning-screens-qrc.html
  10298. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.index
  10299. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.qhp
  10300. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.qhp.sha1
  10301. share/doc/qt5/qtwaylandcompositor/qwaylandbufferref-members.html
  10302. share/doc/qt5/qtwaylandcompositor/qwaylandbufferref.html
  10303. share/doc/qt5/qtwaylandcompositor/qwaylandclient-members.html
  10304. share/doc/qt5/qtwaylandcompositor/qwaylandclient.html
  10305. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor-members.html
  10306. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor.html
  10307. share/doc/qt5/qtwaylandcompositor/qwaylandiviapplication-members.html
  10308. share/doc/qt5/qtwaylandcompositor/qwaylandiviapplication.html
  10309. share/doc/qt5/qtwaylandcompositor/qwaylandivisurface-members.html
  10310. share/doc/qt5/qtwaylandcompositor/qwaylandivisurface.html
  10311. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard-members.html
  10312. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard.html
  10313. share/doc/qt5/qtwaylandcompositor/qwaylandoutput-members.html
  10314. share/doc/qt5/qtwaylandcompositor/qwaylandoutput.html
  10315. share/doc/qt5/qtwaylandcompositor/qwaylandoutputmode-members.html
  10316. share/doc/qt5/qtwaylandcompositor/qwaylandoutputmode.html
  10317. share/doc/qt5/qtwaylandcompositor/qwaylandpointer-members.html
  10318. share/doc/qt5/qtwaylandcompositor/qwaylandpointer.html
  10319. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem-members.html
  10320. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem.html
  10321. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem-members.html
  10322. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem.html
  10323. share/doc/qt5/qtwaylandcompositor/qwaylandseat-members.html
  10324. share/doc/qt5/qtwaylandcompositor/qwaylandseat.html
  10325. share/doc/qt5/qtwaylandcompositor/qwaylandsurface-members.html
  10326. share/doc/qt5/qtwaylandcompositor/qwaylandsurface.html
  10327. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber-members.html
  10328. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber.html
  10329. share/doc/qt5/qtwaylandcompositor/qwaylandtouch-members.html
  10330. share/doc/qt5/qtwaylandcompositor/qwaylandtouch.html
  10331. share/doc/qt5/qtwaylandcompositor/qwaylandview-members.html
  10332. share/doc/qt5/qtwaylandcompositor/qwaylandview.html
  10333. share/doc/qt5/qtwaylandcompositor/qwaylandwlshell-members.html
  10334. share/doc/qt5/qtwaylandcompositor/qwaylandwlshell.html
  10335. share/doc/qt5/qtwaylandcompositor/qwaylandwlshellsurface-members.html
  10336. share/doc/qt5/qtwaylandcompositor/qwaylandwlshellsurface.html
  10337. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv5-members.html
  10338. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv5.html
  10339. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv5-members.html
  10340. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv5.html
  10341. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev5-members.html
  10342. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev5.html
  10343. share/doc/qt5/qtwaylandcompositor/style/offline-simple.css
  10344. share/doc/qt5/qtwaylandcompositor/style/offline.css
  10345. share/doc/qt5/qtwebchannel.qch
  10346. share/doc/qt5/qtwebchannel/examples-manifest.xml
  10347. share/doc/qt5/qtwebchannel/images/arrow_bc.png
  10348. share/doc/qt5/qtwebchannel/images/bgrContent.png
  10349. share/doc/qt5/qtwebchannel/images/btn_next.png
  10350. share/doc/qt5/qtwebchannel/images/btn_prev.png
  10351. share/doc/qt5/qtwebchannel/images/bullet_dn.png
  10352. share/doc/qt5/qtwebchannel/images/bullet_sq.png
  10353. share/doc/qt5/qtwebchannel/images/chatclient-html.png
  10354. share/doc/qt5/qtwebchannel/images/chatclient-qml.png
  10355. share/doc/qt5/qtwebchannel/images/chatserver-cpp.png
  10356. share/doc/qt5/qtwebchannel/images/home.png
  10357. share/doc/qt5/qtwebchannel/images/ico_note.png
  10358. share/doc/qt5/qtwebchannel/images/ico_note_attention.png
  10359. share/doc/qt5/qtwebchannel/images/ico_out.png
  10360. share/doc/qt5/qtwebchannel/images/logo.png
  10361. share/doc/qt5/qtwebchannel/images/standalone-screenshot.png
  10362. share/doc/qt5/qtwebchannel/qml-qtwebchannel-webchannel-members.html
  10363. share/doc/qt5/qtwebchannel/qml-qtwebchannel-webchannel.html
  10364. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html-pro.html
  10365. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html.html
  10366. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-example.html
  10367. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-chatclient-qml-pro.html
  10368. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-example.html
  10369. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-loginform-ui-qml.html
  10370. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-mainform-ui-qml.html
  10371. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-qmlchatclient-qml.html
  10372. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp-pro.html
  10373. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp.html
  10374. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-h.html
  10375. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-example.html
  10376. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-main-cpp.html
  10377. share/doc/qt5/qtwebchannel/qtwebchannel-examples.html
  10378. share/doc/qt5/qtwebchannel/qtwebchannel-index.html
  10379. share/doc/qt5/qtwebchannel/qtwebchannel-javascript.html
  10380. share/doc/qt5/qtwebchannel/qtwebchannel-module.html
  10381. share/doc/qt5/qtwebchannel/qtwebchannel-qmlmodule.html
  10382. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-core-h.html
  10383. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-cpp.html
  10384. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-h.html
  10385. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-ui.html
  10386. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-example.html
  10387. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-index-html.html
  10388. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-main-cpp.html
  10389. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-standalone-pro.html
  10390. share/doc/qt5/qtwebchannel/qtwebchannel.index
  10391. share/doc/qt5/qtwebchannel/qtwebchannel.qhp
  10392. share/doc/qt5/qtwebchannel/qtwebchannel.qhp.sha1
  10393. share/doc/qt5/qtwebchannel/qtwebchannel.tags
  10394. share/doc/qt5/qtwebchannel/qwebchannel-members.html
  10395. share/doc/qt5/qtwebchannel/qwebchannel.html
  10396. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport-members.html
  10397. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport.html
  10398. share/doc/qt5/qtwebchannel/style/offline-simple.css
  10399. share/doc/qt5/qtwebchannel/style/offline.css
  10400. share/doc/qt5/qtwebsockets.qch
  10401. share/doc/qt5/qtwebsockets/echoclient.html
  10402. share/doc/qt5/qtwebsockets/echoserver.html
  10403. share/doc/qt5/qtwebsockets/examples-manifest.xml
  10404. share/doc/qt5/qtwebsockets/images/arrow_bc.png
  10405. share/doc/qt5/qtwebsockets/images/bgrContent.png
  10406. share/doc/qt5/qtwebsockets/images/btn_next.png
  10407. share/doc/qt5/qtwebsockets/images/btn_prev.png
  10408. share/doc/qt5/qtwebsockets/images/bullet_dn.png
  10409. share/doc/qt5/qtwebsockets/images/bullet_sq.png
  10410. share/doc/qt5/qtwebsockets/images/echoclient-html-example.png
  10411. share/doc/qt5/qtwebsockets/images/home.png
  10412. share/doc/qt5/qtwebsockets/images/ico_note.png
  10413. share/doc/qt5/qtwebsockets/images/ico_note_attention.png
  10414. share/doc/qt5/qtwebsockets/images/ico_out.png
  10415. share/doc/qt5/qtwebsockets/images/logo.png
  10416. share/doc/qt5/qtwebsockets/images/websockets-pictorial-representation.jpg
  10417. share/doc/qt5/qtwebsockets/qmaskgenerator-members.html
  10418. share/doc/qt5/qtwebsockets/qmaskgenerator.html
  10419. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocket-members.html
  10420. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocket.html
  10421. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocketserver-members.html
  10422. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocketserver.html
  10423. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-cpp.html
  10424. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-h.html
  10425. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-pro.html
  10426. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-example.html
  10427. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-main-cpp.html
  10428. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoclient-html.html
  10429. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-cpp.html
  10430. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-h.html
  10431. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-pro.html
  10432. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-example.html
  10433. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-main-cpp.html
  10434. share/doc/qt5/qtwebsockets/qtwebsockets-examples.html
  10435. share/doc/qt5/qtwebsockets/qtwebsockets-index.html
  10436. share/doc/qt5/qtwebsockets/qtwebsockets-module.html
  10437. share/doc/qt5/qtwebsockets/qtwebsockets-qmlmodule.html
  10438. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-data-qrc.html
  10439. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-example.html
  10440. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-main-cpp.html
  10441. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-qml-qmlwebsocketclient-main-qml.html
  10442. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-qmlwebsocketclient-pro.html
  10443. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-data-qrc.html
  10444. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-example.html
  10445. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-main-cpp.html
  10446. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-qml-qmlwebsocketserver-main-qml.html
  10447. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-qmlwebsocketserver-pro.html
  10448. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatclient-html.html
  10449. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatserver-cpp.html
  10450. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatserver-h.html
  10451. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-example.html
  10452. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-main-cpp.html
  10453. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-simplechat-pro.html
  10454. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-example.html
  10455. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-main-cpp.html
  10456. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-cpp.html
  10457. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-h.html
  10458. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-pro.html
  10459. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-example.html
  10460. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-main-cpp.html
  10461. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-securesocketclient-qrc.html
  10462. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoclient-html.html
  10463. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-cpp.html
  10464. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-h.html
  10465. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-pro.html
  10466. share/doc/qt5/qtwebsockets/qtwebsockets-testing.html
  10467. share/doc/qt5/qtwebsockets/qtwebsockets.index
  10468. share/doc/qt5/qtwebsockets/qtwebsockets.qhp
  10469. share/doc/qt5/qtwebsockets/qtwebsockets.qhp.sha1
  10470. share/doc/qt5/qtwebsockets/qtwebsockets.tags
  10471. share/doc/qt5/qtwebsockets/qwebsocket-members.html
  10472. share/doc/qt5/qtwebsockets/qwebsocket.html
  10473. share/doc/qt5/qtwebsockets/qwebsocketcorsauthenticator-members.html
  10474. share/doc/qt5/qtwebsockets/qwebsocketcorsauthenticator.html
  10475. share/doc/qt5/qtwebsockets/qwebsocketprotocol.html
  10476. share/doc/qt5/qtwebsockets/qwebsocketserver-members.html
  10477. share/doc/qt5/qtwebsockets/qwebsocketserver.html
  10478. share/doc/qt5/qtwebsockets/style/offline-simple.css
  10479. share/doc/qt5/qtwebsockets/style/offline.css
  10480. share/doc/qt5/qtwebsockets/websockets-overview.html
  10481. share/doc/qt5/qtwebview.qch
  10482. share/doc/qt5/qtwebview/examples-manifest.xml
  10483. share/doc/qt5/qtwebview/images/arrow_bc.png
  10484. share/doc/qt5/qtwebview/images/bgrContent.png
  10485. share/doc/qt5/qtwebview/images/btn_next.png
  10486. share/doc/qt5/qtwebview/images/btn_prev.png
  10487. share/doc/qt5/qtwebview/images/bullet_dn.png
  10488. share/doc/qt5/qtwebview/images/bullet_sq.png
  10489. share/doc/qt5/qtwebview/images/home.png
  10490. share/doc/qt5/qtwebview/images/ico_note.png
  10491. share/doc/qt5/qtwebview/images/ico_note_attention.png
  10492. share/doc/qt5/qtwebview/images/ico_out.png
  10493. share/doc/qt5/qtwebview/images/logo.png
  10494. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/left-32.png
  10495. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/refresh-32.png
  10496. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/right-32.png
  10497. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/stop-32.png
  10498. share/doc/qt5/qtwebview/images/webview-example.jpg
  10499. share/doc/qt5/qtwebview/qml-qtwebview-webview-members.html
  10500. share/doc/qt5/qtwebview/qml-qtwebview-webview.html
  10501. share/doc/qt5/qtwebview/qml-qtwebview-webviewloadrequest-members.html
  10502. share/doc/qt5/qtwebview/qml-qtwebview-webviewloadrequest.html
  10503. share/doc/qt5/qtwebview/qtwebview-examples.html
  10504. share/doc/qt5/qtwebview/qtwebview-index.html
  10505. share/doc/qt5/qtwebview/qtwebview-minibrowser-android-loadprogressstyle-qml.html
  10506. share/doc/qt5/qtwebview/qtwebview-minibrowser-example.html
  10507. share/doc/qt5/qtwebview/qtwebview-minibrowser-loadprogressstyle-qml.html
  10508. share/doc/qt5/qtwebview/qtwebview-minibrowser-main-cpp.html
  10509. share/doc/qt5/qtwebview/qtwebview-minibrowser-main-qml.html
  10510. share/doc/qt5/qtwebview/qtwebview-minibrowser-minibrowser-pro.html
  10511. share/doc/qt5/qtwebview/qtwebview-minibrowser-qml-qrc.html
  10512. share/doc/qt5/qtwebview/qtwebview-module.html
  10513. share/doc/qt5/qtwebview/qtwebview-qmlmodule.html
  10514. share/doc/qt5/qtwebview/qtwebview.html
  10515. share/doc/qt5/qtwebview/qtwebview.index
  10516. share/doc/qt5/qtwebview/qtwebview.qhp
  10517. share/doc/qt5/qtwebview/qtwebview.qhp.sha1
  10518. share/doc/qt5/qtwebview/style/offline-simple.css
  10519. share/doc/qt5/qtwebview/style/offline.css
  10520. share/doc/qt5/qtwidgets.qch
  10521. share/doc/qt5/qtwidgets/application-windows.html
  10522. share/doc/qt5/qtwidgets/dialogs.html
  10523. share/doc/qt5/qtwidgets/examples-desktop.html
  10524. share/doc/qt5/qtwidgets/examples-dialogs.html
  10525. share/doc/qt5/qtwidgets/examples-graphicsview.html
  10526. share/doc/qt5/qtwidgets/examples-itemviews.html
  10527. share/doc/qt5/qtwidgets/examples-mainwindow.html
  10528. share/doc/qt5/qtwidgets/examples-manifest.xml
  10529. share/doc/qt5/qtwidgets/examples-painting.html
  10530. share/doc/qt5/qtwidgets/examples-richtext.html
  10531. share/doc/qt5/qtwidgets/examples-widgets.html
  10532. share/doc/qt5/qtwidgets/focus.html
  10533. share/doc/qt5/qtwidgets/gallery.html
  10534. share/doc/qt5/qtwidgets/gestures-overview.html
  10535. share/doc/qt5/qtwidgets/graphicsview.html
  10536. share/doc/qt5/qtwidgets/guibooks.html
  10537. share/doc/qt5/qtwidgets/images/addressbook-adddialog.png
  10538. share/doc/qt5/qtwidgets/images/addressbook-classes.png
  10539. share/doc/qt5/qtwidgets/images/addressbook-editdialog.png
  10540. share/doc/qt5/qtwidgets/images/addressbook-example.png
  10541. share/doc/qt5/qtwidgets/images/addressbook-filemenu.png
  10542. share/doc/qt5/qtwidgets/images/addressbook-newaddresstab.png
  10543. share/doc/qt5/qtwidgets/images/addressbook-signals.png
  10544. share/doc/qt5/qtwidgets/images/addressbook-toolsmenu.png
  10545. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-labeled-layout.png
  10546. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-labeled-screenshot.png
  10547. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-screenshot.png
  10548. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-contact.png
  10549. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-flowchart.png
  10550. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-successful.png
  10551. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-labeled-layout.png
  10552. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-signals-and-slots.png
  10553. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-stretch-effects.png
  10554. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-labeled-layout.png
  10555. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-linkedlist.png
  10556. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-screenshot.png
  10557. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part4-remove.png
  10558. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-finddialog.png
  10559. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-notfound.png
  10560. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-screenshot.png
  10561. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-signals-and-slots.png
  10562. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-load.png
  10563. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-save.png
  10564. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-screenshot.png
  10565. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part7-screenshot.png
  10566. share/doc/qt5/qtwidgets/images/addressbook-tutorial-screenshot.png
  10567. share/doc/qt5/qtwidgets/images/affine-demo.png
  10568. share/doc/qt5/qtwidgets/images/analogclock-example.png
  10569. share/doc/qt5/qtwidgets/images/analogclock-viewport.png
  10570. share/doc/qt5/qtwidgets/images/animatedtiles-example.png
  10571. share/doc/qt5/qtwidgets/images/appchooser-example.png
  10572. share/doc/qt5/qtwidgets/images/application-menus.png
  10573. share/doc/qt5/qtwidgets/images/application.png
  10574. share/doc/qt5/qtwidgets/images/arrow_bc.png
  10575. share/doc/qt5/qtwidgets/images/assistant-toolbar.png
  10576. share/doc/qt5/qtwidgets/images/basicdrawing-example.png
  10577. share/doc/qt5/qtwidgets/images/basicgraphicslayouts-example.png
  10578. share/doc/qt5/qtwidgets/images/basiclayouts-example.png
  10579. share/doc/qt5/qtwidgets/images/basicsortfiltermodel-example.png
  10580. share/doc/qt5/qtwidgets/images/bgrContent.png
  10581. share/doc/qt5/qtwidgets/images/blurpickereffect-example.png
  10582. share/doc/qt5/qtwidgets/images/borderlayout-example.png
  10583. share/doc/qt5/qtwidgets/images/boxes-demo.png
  10584. share/doc/qt5/qtwidgets/images/branchindicatorimage.png
  10585. share/doc/qt5/qtwidgets/images/btn_next.png
  10586. share/doc/qt5/qtwidgets/images/btn_prev.png
  10587. share/doc/qt5/qtwidgets/images/bullet_dn.png
  10588. share/doc/qt5/qtwidgets/images/bullet_sq.png
  10589. share/doc/qt5/qtwidgets/images/button.png
  10590. share/doc/qt5/qtwidgets/images/buttonbox-gnomelayout-horizontal.png
  10591. share/doc/qt5/qtwidgets/images/buttonbox-gnomelayout-vertical.png
  10592. share/doc/qt5/qtwidgets/images/buttonbox-kdelayout-horizontal.png
  10593. share/doc/qt5/qtwidgets/images/buttonbox-kdelayout-vertical.png
  10594. share/doc/qt5/qtwidgets/images/buttonbox-mac-modeless-horizontal.png
  10595. share/doc/qt5/qtwidgets/images/buttonbox-mac-modeless-vertical.png
  10596. share/doc/qt5/qtwidgets/images/buttonbox-maclayout-horizontal.png
  10597. share/doc/qt5/qtwidgets/images/buttonbox-maclayout-vertical.png
  10598. share/doc/qt5/qtwidgets/images/buttonbox-winlayout-horizontal.png
  10599. share/doc/qt5/qtwidgets/images/buttonbox-winlayout-vertical.png
  10600. share/doc/qt5/qtwidgets/images/calculator-example.png
  10601. share/doc/qt5/qtwidgets/images/calculator-ugly.png
  10602. share/doc/qt5/qtwidgets/images/calendar-example.png
  10603. share/doc/qt5/qtwidgets/images/calendarwidgetexample.png
  10604. share/doc/qt5/qtwidgets/images/charactermap-example.png
  10605. share/doc/qt5/qtwidgets/images/chart-example.png
  10606. share/doc/qt5/qtwidgets/images/checkbox.png
  10607. share/doc/qt5/qtwidgets/images/checkboxes-exclusive.png
  10608. share/doc/qt5/qtwidgets/images/checkboxes-non-exclusive.png
  10609. share/doc/qt5/qtwidgets/images/checkboxexample.png
  10610. share/doc/qt5/qtwidgets/images/chip-demo.png
  10611. share/doc/qt5/qtwidgets/images/classwizard-flow.png
  10612. share/doc/qt5/qtwidgets/images/classwizard.png
  10613. share/doc/qt5/qtwidgets/images/clock.png
  10614. share/doc/qt5/qtwidgets/images/codecs-example.png
  10615. share/doc/qt5/qtwidgets/images/codeeditor-example.png
  10616. share/doc/qt5/qtwidgets/images/collidingmice-example.png
  10617. share/doc/qt5/qtwidgets/images/coloreditorfactoryimage.png
  10618. share/doc/qt5/qtwidgets/images/columnview.png
  10619. share/doc/qt5/qtwidgets/images/combobox.png
  10620. share/doc/qt5/qtwidgets/images/comboboximage.png
  10621. share/doc/qt5/qtwidgets/images/combowidgetmapper-example.png
  10622. share/doc/qt5/qtwidgets/images/completer-example-country.png
  10623. share/doc/qt5/qtwidgets/images/completer-example-dirmodel.png
  10624. share/doc/qt5/qtwidgets/images/completer-example-qdirmodel.png
  10625. share/doc/qt5/qtwidgets/images/completer-example-word.png
  10626. share/doc/qt5/qtwidgets/images/completer-example.png
  10627. share/doc/qt5/qtwidgets/images/composition-demo.png
  10628. share/doc/qt5/qtwidgets/images/concentriccircles-example.png
  10629. share/doc/qt5/qtwidgets/images/conceptualpushbuttontree.png
  10630. share/doc/qt5/qtwidgets/images/configdialog-example.png
  10631. share/doc/qt5/qtwidgets/images/customcompleter-example.png
  10632. share/doc/qt5/qtwidgets/images/customcompleter-insertcompletion.png
  10633. share/doc/qt5/qtwidgets/images/customsortfiltermodel-example.png
  10634. share/doc/qt5/qtwidgets/images/deform-demo.png
  10635. share/doc/qt5/qtwidgets/images/designer-stylesheet-options.png
  10636. share/doc/qt5/qtwidgets/images/designer-stylesheet-usage.png
  10637. share/doc/qt5/qtwidgets/images/designer-validator-highlighter.png
  10638. share/doc/qt5/qtwidgets/images/desktop-examples.png
  10639. share/doc/qt5/qtwidgets/images/diagramscene.png
  10640. share/doc/qt5/qtwidgets/images/dialog-examples.png
  10641. share/doc/qt5/qtwidgets/images/digitalclock-example.png
  10642. share/doc/qt5/qtwidgets/images/dirview-example.png
  10643. share/doc/qt5/qtwidgets/images/dockwidget.png
  10644. share/doc/qt5/qtwidgets/images/dockwidgetimage.png
  10645. share/doc/qt5/qtwidgets/images/dockwidgets-example.png
  10646. share/doc/qt5/qtwidgets/images/draganddroppuzzle-example.png
  10647. share/doc/qt5/qtwidgets/images/dragdroprobot-example.png
  10648. share/doc/qt5/qtwidgets/images/draggableicons-example.png
  10649. share/doc/qt5/qtwidgets/images/draggabletext-example.png
  10650. share/doc/qt5/qtwidgets/images/dropsite-example.png
  10651. share/doc/qt5/qtwidgets/images/dummy_tree.png
  10652. share/doc/qt5/qtwidgets/images/easing-example.png
  10653. share/doc/qt5/qtwidgets/images/echopluginexample.png
  10654. share/doc/qt5/qtwidgets/images/elasticnodes-example.png
  10655. share/doc/qt5/qtwidgets/images/elidedlabel-example.png
  10656. share/doc/qt5/qtwidgets/images/embeddeddialogs-demo.png
  10657. share/doc/qt5/qtwidgets/images/example_model.png
  10658. share/doc/qt5/qtwidgets/images/extension-example.png
  10659. share/doc/qt5/qtwidgets/images/extension_more.png
  10660. share/doc/qt5/qtwidgets/images/factorial-example.png
  10661. share/doc/qt5/qtwidgets/images/fademessageeffect-example-faded.png
  10662. share/doc/qt5/qtwidgets/images/fademessageeffect-example.png
  10663. share/doc/qt5/qtwidgets/images/fetchmore-example.png
  10664. share/doc/qt5/qtwidgets/images/filedialogurls.png
  10665. share/doc/qt5/qtwidgets/images/findfiles-example.png
  10666. share/doc/qt5/qtwidgets/images/findfiles_progress_dialog.png
  10667. share/doc/qt5/qtwidgets/images/flowlayout-example.png
  10668. share/doc/qt5/qtwidgets/images/fontsampler-example.png
  10669. share/doc/qt5/qtwidgets/images/frames.png
  10670. share/doc/qt5/qtwidgets/images/fridgemagnets-example.png
  10671. share/doc/qt5/qtwidgets/images/frozencolumn-example.png
  10672. share/doc/qt5/qtwidgets/images/frozencolumn-tableview.png
  10673. share/doc/qt5/qtwidgets/images/fusion-calendarwidget.png
  10674. share/doc/qt5/qtwidgets/images/fusion-colordialog.png
  10675. share/doc/qt5/qtwidgets/images/fusion-combobox.png
  10676. share/doc/qt5/qtwidgets/images/fusion-fontdialog.png
  10677. share/doc/qt5/qtwidgets/images/fusion-label.png
  10678. share/doc/qt5/qtwidgets/images/fusion-menu.png
  10679. share/doc/qt5/qtwidgets/images/fusion-progressdialog.png
  10680. share/doc/qt5/qtwidgets/images/fusion-pushbutton-menu.png
  10681. share/doc/qt5/qtwidgets/images/fusion-statusbar-sizegrip.png
  10682. share/doc/qt5/qtwidgets/images/fusion-style.png
  10683. share/doc/qt5/qtwidgets/images/fusion-tabbar-truncated.png
  10684. share/doc/qt5/qtwidgets/images/fusion-tabbar.png
  10685. share/doc/qt5/qtwidgets/images/fusion-tabwidget.png
  10686. share/doc/qt5/qtwidgets/images/geometry.png
  10687. share/doc/qt5/qtwidgets/images/gradients-demo.png
  10688. share/doc/qt5/qtwidgets/images/graphicsanchorlayout-example.png
  10689. share/doc/qt5/qtwidgets/images/graphicseffect-blur.png
  10690. share/doc/qt5/qtwidgets/images/graphicseffect-colorize.png
  10691. share/doc/qt5/qtwidgets/images/graphicseffect-drop-shadow.png
  10692. share/doc/qt5/qtwidgets/images/graphicseffect-opacity.png
  10693. share/doc/qt5/qtwidgets/images/graphicseffect-plain.png
  10694. share/doc/qt5/qtwidgets/images/graphicseffect-widget.png
  10695. share/doc/qt5/qtwidgets/images/graphicsflowlayout-example.png
  10696. share/doc/qt5/qtwidgets/images/graphicssimpleanchorlayout-example.png
  10697. share/doc/qt5/qtwidgets/images/graphicsview-ellipseitem-pie.png
  10698. share/doc/qt5/qtwidgets/images/graphicsview-ellipseitem.png
  10699. share/doc/qt5/qtwidgets/images/graphicsview-examples.png
  10700. share/doc/qt5/qtwidgets/images/graphicsview-items.png
  10701. share/doc/qt5/qtwidgets/images/graphicsview-lineitem.png
  10702. share/doc/qt5/qtwidgets/images/graphicsview-parentchild.png
  10703. share/doc/qt5/qtwidgets/images/graphicsview-pathitem.png
  10704. share/doc/qt5/qtwidgets/images/graphicsview-pixmapitem.png
  10705. share/doc/qt5/qtwidgets/images/graphicsview-polygonitem.png
  10706. share/doc/qt5/qtwidgets/images/graphicsview-rectitem.png
  10707. share/doc/qt5/qtwidgets/images/graphicsview-simpletextitem.png
  10708. share/doc/qt5/qtwidgets/images/graphicsview-textitem.png
  10709. share/doc/qt5/qtwidgets/images/graphicsview-view.png
  10710. share/doc/qt5/qtwidgets/images/graphicsview-zorder.png
  10711. share/doc/qt5/qtwidgets/images/gridlayout.png
  10712. share/doc/qt5/qtwidgets/images/groupbox-example.png
  10713. share/doc/qt5/qtwidgets/images/groupbox.png
  10714. share/doc/qt5/qtwidgets/images/groupboximage.png
  10715. share/doc/qt5/qtwidgets/images/header.png
  10716. share/doc/qt5/qtwidgets/images/headerimage.png
  10717. share/doc/qt5/qtwidgets/images/home.png
  10718. share/doc/qt5/qtwidgets/images/i18n-example.png
  10719. share/doc/qt5/qtwidgets/images/ico_note.png
  10720. share/doc/qt5/qtwidgets/images/ico_note_attention.png
  10721. share/doc/qt5/qtwidgets/images/ico_out.png
  10722. share/doc/qt5/qtwidgets/images/icons-example.png
  10723. share/doc/qt5/qtwidgets/images/icons-view-menu.png
  10724. share/doc/qt5/qtwidgets/images/icons_find_normal.png
  10725. share/doc/qt5/qtwidgets/images/icons_find_normal_disabled.png
  10726. share/doc/qt5/qtwidgets/images/icons_images_groupbox.png
  10727. share/doc/qt5/qtwidgets/images/icons_monkey.png
  10728. share/doc/qt5/qtwidgets/images/icons_monkey_active.png
  10729. share/doc/qt5/qtwidgets/images/icons_monkey_mess.png
  10730. share/doc/qt5/qtwidgets/images/icons_preview_area.png
  10731. share/doc/qt5/qtwidgets/images/icons_qt_extended_16x16.png
  10732. share/doc/qt5/qtwidgets/images/icons_qt_extended_17x17.png
  10733. share/doc/qt5/qtwidgets/images/icons_qt_extended_32x32.png
  10734. share/doc/qt5/qtwidgets/images/icons_qt_extended_33x33.png
  10735. share/doc/qt5/qtwidgets/images/icons_qt_extended_48x48.png
  10736. share/doc/qt5/qtwidgets/images/icons_qt_extended_64x64.png
  10737. share/doc/qt5/qtwidgets/images/icons_qt_extended_8x8.png
  10738. share/doc/qt5/qtwidgets/images/icons_size_groupbox.png
  10739. share/doc/qt5/qtwidgets/images/icons_size_spinbox.png
  10740. share/doc/qt5/qtwidgets/images/imagecomposition-example.png
  10741. share/doc/qt5/qtwidgets/images/imagegestures-example.jpg
  10742. share/doc/qt5/qtwidgets/images/imageviewer-example.png
  10743. share/doc/qt5/qtwidgets/images/imageviewer-fit_to_window_1.png
  10744. share/doc/qt5/qtwidgets/images/imageviewer-fit_to_window_2.png
  10745. share/doc/qt5/qtwidgets/images/imageviewer-original_size.png
  10746. share/doc/qt5/qtwidgets/images/imageviewer-zoom_in_1.png
  10747. share/doc/qt5/qtwidgets/images/imageviewer-zoom_in_2.png
  10748. share/doc/qt5/qtwidgets/images/inputdialogs.png
  10749. share/doc/qt5/qtwidgets/images/interview-demo.png
  10750. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-indexes.png
  10751. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-items.png
  10752. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-model.png
  10753. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-values.png
  10754. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel.png
  10755. share/doc/qt5/qtwidgets/images/itemviews-examples.png
  10756. share/doc/qt5/qtwidgets/images/itemviewspuzzle-example.png
  10757. share/doc/qt5/qtwidgets/images/layout1.png
  10758. share/doc/qt5/qtwidgets/images/layout2.png
  10759. share/doc/qt5/qtwidgets/images/licensewizard-example.png
  10760. share/doc/qt5/qtwidgets/images/licensewizard-flow.png
  10761. share/doc/qt5/qtwidgets/images/lightingeffect-example.png
  10762. share/doc/qt5/qtwidgets/images/lineedits-example.png
  10763. share/doc/qt5/qtwidgets/images/list_table_tree.png
  10764. share/doc/qt5/qtwidgets/images/listview.png
  10765. share/doc/qt5/qtwidgets/images/logo.png
  10766. share/doc/qt5/qtwidgets/images/macos-lineedit.png
  10767. share/doc/qt5/qtwidgets/images/macos-progressbar.png
  10768. share/doc/qt5/qtwidgets/images/macos-style.png
  10769. share/doc/qt5/qtwidgets/images/macos-style2.png
  10770. share/doc/qt5/qtwidgets/images/macos-tabwidget.png
  10771. share/doc/qt5/qtwidgets/images/mainwindow-demo.png
  10772. share/doc/qt5/qtwidgets/images/mainwindow-docks-example.png
  10773. share/doc/qt5/qtwidgets/images/mainwindow-docks.png
  10774. share/doc/qt5/qtwidgets/images/mainwindow-examples.png
  10775. share/doc/qt5/qtwidgets/images/mainwindowlayout.png
  10776. share/doc/qt5/qtwidgets/images/mdi-cascade.png
  10777. share/doc/qt5/qtwidgets/images/mdi-example.png
  10778. share/doc/qt5/qtwidgets/images/mdi-tile.png
  10779. share/doc/qt5/qtwidgets/images/menu.png
  10780. share/doc/qt5/qtwidgets/images/menubar.png
  10781. share/doc/qt5/qtwidgets/images/menubarimage.png
  10782. share/doc/qt5/qtwidgets/images/menuimage.png
  10783. share/doc/qt5/qtwidgets/images/menus-example.png
  10784. share/doc/qt5/qtwidgets/images/modelview-combobox.png
  10785. share/doc/qt5/qtwidgets/images/modelview-header.png
  10786. share/doc/qt5/qtwidgets/images/modelview-models.png
  10787. share/doc/qt5/qtwidgets/images/modelview-overview.png
  10788. share/doc/qt5/qtwidgets/images/modelview-roles.png
  10789. share/doc/qt5/qtwidgets/images/modelview-tablemodel.png
  10790. share/doc/qt5/qtwidgets/images/modelview-treemodel.png
  10791. share/doc/qt5/qtwidgets/images/modelview.png
  10792. share/doc/qt5/qtwidgets/images/mousebutton-buttontester.png
  10793. share/doc/qt5/qtwidgets/images/move-blocks-chart.png
  10794. share/doc/qt5/qtwidgets/images/moveblocks-example.png
  10795. share/doc/qt5/qtwidgets/images/movie-example.png
  10796. share/doc/qt5/qtwidgets/images/msgbox1.png
  10797. share/doc/qt5/qtwidgets/images/msgbox2.png
  10798. share/doc/qt5/qtwidgets/images/msgbox3.png
  10799. share/doc/qt5/qtwidgets/images/msgbox4.png
  10800. share/doc/qt5/qtwidgets/images/orderform-example-detailsdialog.png
  10801. share/doc/qt5/qtwidgets/images/orderform-example.png
  10802. share/doc/qt5/qtwidgets/images/padnavigator-example.png
  10803. share/doc/qt5/qtwidgets/images/painterpaths-example.png
  10804. share/doc/qt5/qtwidgets/images/painting-examples.png
  10805. share/doc/qt5/qtwidgets/images/paintsystem-icon.png
  10806. share/doc/qt5/qtwidgets/images/paintsystem-stylepainter.png
  10807. share/doc/qt5/qtwidgets/images/pangesture.png
  10808. share/doc/qt5/qtwidgets/images/parent-child-widgets.png
  10809. share/doc/qt5/qtwidgets/images/pathstroke-demo.png
  10810. share/doc/qt5/qtwidgets/images/pinchgesture.png
  10811. share/doc/qt5/qtwidgets/images/pingpong-example.png
  10812. share/doc/qt5/qtwidgets/images/pixelator-example.png
  10813. share/doc/qt5/qtwidgets/images/plugandpaint-plugindialog.png
  10814. share/doc/qt5/qtwidgets/images/plugandpaint.png
  10815. share/doc/qt5/qtwidgets/images/progressBar-stylesheet.png
  10816. share/doc/qt5/qtwidgets/images/progressBar2-stylesheet.png
  10817. share/doc/qt5/qtwidgets/images/progressbar.png
  10818. share/doc/qt5/qtwidgets/images/progressbarimage.png
  10819. share/doc/qt5/qtwidgets/images/propagation-custom.png
  10820. share/doc/qt5/qtwidgets/images/propagation-standard.png
  10821. share/doc/qt5/qtwidgets/images/pushbutton.png
  10822. share/doc/qt5/qtwidgets/images/qactiongroup-align.png
  10823. share/doc/qt5/qtwidgets/images/qcalendarwidget-grid.png
  10824. share/doc/qt5/qtwidgets/images/qcalendarwidget-maximum.png
  10825. share/doc/qt5/qtwidgets/images/qcalendarwidget-minimum.png
  10826. share/doc/qt5/qtwidgets/images/qcolumnview.png
  10827. share/doc/qt5/qtwidgets/images/qcompleter.png
  10828. share/doc/qt5/qtwidgets/images/qdesktopwidget.png
  10829. share/doc/qt5/qtwidgets/images/qerrormessage.png
  10830. share/doc/qt5/qtwidgets/images/qformlayout-kde.png
  10831. share/doc/qt5/qtwidgets/images/qformlayout-mac.png
  10832. share/doc/qt5/qtwidgets/images/qformlayout-qpe.png
  10833. share/doc/qt5/qtwidgets/images/qformlayout-win.png
  10834. share/doc/qt5/qtwidgets/images/qformlayout-with-6-children.png
  10835. share/doc/qt5/qtwidgets/images/qgraphicsproxywidget-embed.png
  10836. share/doc/qt5/qtwidgets/images/qgridlayout-with-5-children.png
  10837. share/doc/qt5/qtwidgets/images/qhboxlayout-with-5-children.png
  10838. share/doc/qt5/qtwidgets/images/qmdisubwindowlayout.png
  10839. share/doc/qt5/qtwidgets/images/qmessagebox-crit.png
  10840. share/doc/qt5/qtwidgets/images/qmessagebox-info.png
  10841. share/doc/qt5/qtwidgets/images/qmessagebox-quest.png
  10842. share/doc/qt5/qtwidgets/images/qmessagebox-warn.png
  10843. share/doc/qt5/qtwidgets/images/qscrollarea-noscrollbars.png
  10844. share/doc/qt5/qtwidgets/images/qscrollarea-onescrollbar.png
  10845. share/doc/qt5/qtwidgets/images/qscrollarea-twoscrollbars.png
  10846. share/doc/qt5/qtwidgets/images/qscrollbar-picture.png
  10847. share/doc/qt5/qtwidgets/images/qscrollbar-values.png
  10848. share/doc/qt5/qtwidgets/images/qspinbox-plusminus.png
  10849. share/doc/qt5/qtwidgets/images/qspinbox-updown.png
  10850. share/doc/qt5/qtwidgets/images/qstyle-comboboxes.png
  10851. share/doc/qt5/qtwidgets/images/qstyleoptiontoolbar-position.png
  10852. share/doc/qt5/qtwidgets/images/qtableview-resized.png
  10853. share/doc/qt5/qtwidgets/images/qtwizard-aero1.png
  10854. share/doc/qt5/qtwidgets/images/qtwizard-aero2.png
  10855. share/doc/qt5/qtwidgets/images/qtwizard-classic1.png
  10856. share/doc/qt5/qtwidgets/images/qtwizard-classic2.png
  10857. share/doc/qt5/qtwidgets/images/qtwizard-mac1.png
  10858. share/doc/qt5/qtwidgets/images/qtwizard-mac2.png
  10859. share/doc/qt5/qtwidgets/images/qtwizard-macpage.png
  10860. share/doc/qt5/qtwidgets/images/qtwizard-modern1.png
  10861. share/doc/qt5/qtwidgets/images/qtwizard-modern2.png
  10862. share/doc/qt5/qtwidgets/images/qtwizard-nonmacpage.png
  10863. share/doc/qt5/qtwidgets/images/qundoview.png
  10864. share/doc/qt5/qtwidgets/images/qvboxlayout-with-5-children.png
  10865. share/doc/qt5/qtwidgets/images/readonlytable_role.png
  10866. share/doc/qt5/qtwidgets/images/regexp-example.png
  10867. share/doc/qt5/qtwidgets/images/regularexpression-example.png
  10868. share/doc/qt5/qtwidgets/images/richtext-examples.png
  10869. share/doc/qt5/qtwidgets/images/rogue-example.png
  10870. share/doc/qt5/qtwidgets/images/rogue-statechart.png
  10871. share/doc/qt5/qtwidgets/images/rubberband.png
  10872. share/doc/qt5/qtwidgets/images/rubberbandimage.png
  10873. share/doc/qt5/qtwidgets/images/screenshot-example.png
  10874. share/doc/qt5/qtwidgets/images/scribble-example.png
  10875. share/doc/qt5/qtwidgets/images/scrollbar.png
  10876. share/doc/qt5/qtwidgets/images/scrollbarimage.png
  10877. share/doc/qt5/qtwidgets/images/sdi-example.png
  10878. share/doc/qt5/qtwidgets/images/selected-items1.png
  10879. share/doc/qt5/qtwidgets/images/selected-items2.png
  10880. share/doc/qt5/qtwidgets/images/selected-items3.png
  10881. share/doc/qt5/qtwidgets/images/selection-extended.png
  10882. share/doc/qt5/qtwidgets/images/selection-multi.png
  10883. share/doc/qt5/qtwidgets/images/selection-single.png
  10884. share/doc/qt5/qtwidgets/images/selection2.png
  10885. share/doc/qt5/qtwidgets/images/settingseditor-example.png
  10886. share/doc/qt5/qtwidgets/images/shapedclock-dragging.png
  10887. share/doc/qt5/qtwidgets/images/shapedclock-example.png
  10888. share/doc/qt5/qtwidgets/images/shareddirmodel.png
  10889. share/doc/qt5/qtwidgets/images/sharedmodel-tableviews.png
  10890. share/doc/qt5/qtwidgets/images/sharedselection-tableviews.png
  10891. share/doc/qt5/qtwidgets/images/signals-n-slots-aw-nat.png
  10892. share/doc/qt5/qtwidgets/images/simpleanchorlayout-example.png
  10893. share/doc/qt5/qtwidgets/images/simpledommodel-example.png
  10894. share/doc/qt5/qtwidgets/images/simpletreemodel-example.png
  10895. share/doc/qt5/qtwidgets/images/simplewidgetmapper-example.png
  10896. share/doc/qt5/qtwidgets/images/sizegrip.png
  10897. share/doc/qt5/qtwidgets/images/sizegripimage.png
  10898. share/doc/qt5/qtwidgets/images/slider.png
  10899. share/doc/qt5/qtwidgets/images/sliderimage.png
  10900. share/doc/qt5/qtwidgets/images/sliders-example.png
  10901. share/doc/qt5/qtwidgets/images/spinbox.png
  10902. share/doc/qt5/qtwidgets/images/spinboxdelegate-example.png
  10903. share/doc/qt5/qtwidgets/images/spinboxes-example.png
  10904. share/doc/qt5/qtwidgets/images/spinboximage.png
  10905. share/doc/qt5/qtwidgets/images/spreadsheet-demo.png
  10906. share/doc/qt5/qtwidgets/images/standard-views.png
  10907. share/doc/qt5/qtwidgets/images/standarddialogs-example.png
  10908. share/doc/qt5/qtwidgets/images/standardwidget.png
  10909. share/doc/qt5/qtwidgets/images/stardelegate.png
  10910. share/doc/qt5/qtwidgets/images/states-example.png
  10911. share/doc/qt5/qtwidgets/images/stickman-example.png
  10912. share/doc/qt5/qtwidgets/images/stickman-example1.png
  10913. share/doc/qt5/qtwidgets/images/stickman-example2.png
  10914. share/doc/qt5/qtwidgets/images/stickman-example3.png
  10915. share/doc/qt5/qtwidgets/images/stringlistmodel.png
  10916. share/doc/qt5/qtwidgets/images/stylepluginexample.png
  10917. share/doc/qt5/qtwidgets/images/styles-3d.png
  10918. share/doc/qt5/qtwidgets/images/styles-aliasing.png
  10919. share/doc/qt5/qtwidgets/images/styles-disabledwood.png
  10920. share/doc/qt5/qtwidgets/images/styles-enabledwood.png
  10921. share/doc/qt5/qtwidgets/images/styles-woodbuttons.png
  10922. share/doc/qt5/qtwidgets/images/stylesheet-border-image-normal.png
  10923. share/doc/qt5/qtwidgets/images/stylesheet-border-image-stretched.png
  10924. share/doc/qt5/qtwidgets/images/stylesheet-border-image-wrong.png
  10925. share/doc/qt5/qtwidgets/images/stylesheet-boxmodel.png
  10926. share/doc/qt5/qtwidgets/images/stylesheet-branch-closed.png
  10927. share/doc/qt5/qtwidgets/images/stylesheet-branch-end.png
  10928. share/doc/qt5/qtwidgets/images/stylesheet-branch-more.png
  10929. share/doc/qt5/qtwidgets/images/stylesheet-branch-open.png
  10930. share/doc/qt5/qtwidgets/images/stylesheet-coffee-cleanlooks.png
  10931. share/doc/qt5/qtwidgets/images/stylesheet-coffee-xp.png
  10932. share/doc/qt5/qtwidgets/images/stylesheet-pagefold-mac.png
  10933. share/doc/qt5/qtwidgets/images/stylesheet-pagefold.png
  10934. share/doc/qt5/qtwidgets/images/stylesheet-redbutton1.png
  10935. share/doc/qt5/qtwidgets/images/stylesheet-redbutton2.png
  10936. share/doc/qt5/qtwidgets/images/stylesheet-redbutton3.png
  10937. share/doc/qt5/qtwidgets/images/stylesheet-scrollbar1.png
  10938. share/doc/qt5/qtwidgets/images/stylesheet-scrollbar2.png
  10939. share/doc/qt5/qtwidgets/images/stylesheet-treeview.png
  10940. share/doc/qt5/qtwidgets/images/stylesheet-vline.png
  10941. share/doc/qt5/qtwidgets/images/sub-attaq-demo.png
  10942. share/doc/qt5/qtwidgets/images/swipegesture.png
  10943. share/doc/qt5/qtwidgets/images/syntaxhighlighter-example.png
  10944. share/doc/qt5/qtwidgets/images/system-tray.png
  10945. share/doc/qt5/qtwidgets/images/systemtray-editor.png
  10946. share/doc/qt5/qtwidgets/images/systemtray-example.png
  10947. share/doc/qt5/qtwidgets/images/tab.png
  10948. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet1.png
  10949. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet2.png
  10950. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet3.png
  10951. share/doc/qt5/qtwidgets/images/tabdialog-example.png
  10952. share/doc/qt5/qtwidgets/images/tableWidget-stylesheet.png
  10953. share/doc/qt5/qtwidgets/images/tabletexample.png
  10954. share/doc/qt5/qtwidgets/images/tableview.png
  10955. share/doc/qt5/qtwidgets/images/tabwidget.png
  10956. share/doc/qt5/qtwidgets/images/tetrix-example.png
  10957. share/doc/qt5/qtwidgets/images/textedit-demo.png
  10958. share/doc/qt5/qtwidgets/images/titlebar.png
  10959. share/doc/qt5/qtwidgets/images/titlebarimage.png
  10960. share/doc/qt5/qtwidgets/images/toolbar.png
  10961. share/doc/qt5/qtwidgets/images/toolbarimage.png
  10962. share/doc/qt5/qtwidgets/images/toolbox.png
  10963. share/doc/qt5/qtwidgets/images/toolboximage.png
  10964. share/doc/qt5/qtwidgets/images/toolbutton.png
  10965. share/doc/qt5/qtwidgets/images/toolbuttonimage.png
  10966. share/doc/qt5/qtwidgets/images/tooltips-example.png
  10967. share/doc/qt5/qtwidgets/images/trafficlight-example.png
  10968. share/doc/qt5/qtwidgets/images/trafficlight-example1.png
  10969. share/doc/qt5/qtwidgets/images/trafficlight-example2.png
  10970. share/doc/qt5/qtwidgets/images/transformations-example.png
  10971. share/doc/qt5/qtwidgets/images/tree_2_with_algorithm.png
  10972. share/doc/qt5/qtwidgets/images/treemodel-structure.png
  10973. share/doc/qt5/qtwidgets/images/treemodelcompleter-example.png
  10974. share/doc/qt5/qtwidgets/images/treeview.png
  10975. share/doc/qt5/qtwidgets/images/trivialwizard-example-conclusion.png
  10976. share/doc/qt5/qtwidgets/images/trivialwizard-example-flow.png
  10977. share/doc/qt5/qtwidgets/images/trivialwizard-example-introduction.png
  10978. share/doc/qt5/qtwidgets/images/trivialwizard-example-registration.png
  10979. share/doc/qt5/qtwidgets/images/undodemo.png
  10980. share/doc/qt5/qtwidgets/images/undoframeworkexample.png
  10981. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/Time-For-Lunch-2.jpg
  10982. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/centered.png
  10983. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/ellipse.png
  10984. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/figure8.png
  10985. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/kinetic.png
  10986. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/random.png
  10987. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/tile.png
  10988. share/doc/qt5/qtwidgets/images/used-in-examples/animation/easing/images/qt-logo.png
  10989. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/bad.png
  10990. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/heart.png
  10991. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/trash.png
  10992. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/background.png
  10993. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/banner.png
  10994. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo1.png
  10995. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo2.png
  10996. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo3.png
  10997. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark1.png
  10998. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark2.png
  10999. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/configdialog/images/config.png
  11000. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/configdialog/images/query.png
  11001. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/configdialog/images/update.png
  11002. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/logo.png
  11003. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/watermark.png
  11004. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/boat.png
  11005. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/car.png
  11006. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/house.png
  11007. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-calculator.png
  11008. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-text-editor.png
  11009. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/background.jpg
  11010. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/help-browser.png
  11011. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-group-chat.png
  11012. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-mail.png
  11013. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-web-browser.png
  11014. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/office-calendar.png
  11015. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/system-users.png
  11016. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/basicgraphicslayouts/images/block.png
  11017. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/collidingmice/images/cheese.jpg
  11018. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background1.png
  11019. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background2.png
  11020. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background3.png
  11021. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background4.png
  11022. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bold.png
  11023. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bringtofront.png
  11024. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/delete.png
  11025. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/floodfill.png
  11026. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/italic.png
  11027. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linecolor.png
  11028. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linepointer.png
  11029. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/pointer.png
  11030. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/sendtoback.png
  11031. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/textpointer.png
  11032. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/underline.png
  11033. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/dragdroprobot/images/head.png
  11034. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/artsfftscope.png
  11035. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/blue_angle_swirl.jpg
  11036. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_contacts.png
  11037. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_journal.png
  11038. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_mail.png
  11039. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_notes.png
  11040. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kopeteavailable.png
  11041. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/metacontact_online.png
  11042. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/minitools.png
  11043. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/5days.jpg
  11044. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/details.jpg
  11045. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/place.jpg
  11046. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/tabbar.jpg
  11047. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/title.jpg
  11048. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/weather-few-clouds.png
  11049. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/customsortfiltermodel/images/find.png
  11050. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/folder.png
  11051. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/interview.png
  11052. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/services.png
  11053. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/pixelator/images/qt.png
  11054. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/spreadsheet/images/interview.png
  11055. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/copy.png
  11056. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/cut.png
  11057. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/new.png
  11058. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/open.png
  11059. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/paste.png
  11060. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/save.png
  11061. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/new.png
  11062. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/print.png
  11063. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/save.png
  11064. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/undo.png
  11065. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/copy.png
  11066. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/cut.png
  11067. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/new.png
  11068. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/open.png
  11069. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/paste.png
  11070. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/save.png
  11071. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/copy.png
  11072. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/cut.png
  11073. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/new.png
  11074. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/open.png
  11075. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/paste.png
  11076. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/save.png
  11077. share/doc/qt5/qtwidgets/images/used-in-examples/painting/basicdrawing/images/brick.png
  11078. share/doc/qt5/qtwidgets/images/used-in-examples/painting/basicdrawing/images/qt-logo.png
  11079. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/background.png
  11080. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/blackrectangle.png
  11081. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/butterfly.png
  11082. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/checker.png
  11083. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/logo32.png
  11084. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcopy.png
  11085. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcut.png
  11086. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editpaste.png
  11087. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editredo.png
  11088. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editundo.png
  11089. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/exportpdf.png
  11090. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filenew.png
  11091. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileopen.png
  11092. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileprint.png
  11093. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filesave.png
  11094. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textbold.png
  11095. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textcenter.png
  11096. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textitalic.png
  11097. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textjustify.png
  11098. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textleft.png
  11099. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textright.png
  11100. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textunder.png
  11101. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomin.png
  11102. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomout.png
  11103. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcopy.png
  11104. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcut.png
  11105. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editpaste.png
  11106. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editredo.png
  11107. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editundo.png
  11108. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/exportpdf.png
  11109. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filenew.png
  11110. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileopen.png
  11111. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileprint.png
  11112. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filesave.png
  11113. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textbold.png
  11114. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textcenter.png
  11115. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textitalic.png
  11116. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textjustify.png
  11117. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textleft.png
  11118. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textright.png
  11119. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textunder.png
  11120. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomin.png
  11121. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomout.png
  11122. share/doc/qt5/qtwidgets/images/used-in-examples/tools/regularexpression/images/copy.png
  11123. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undoframework/images/cross.png
  11124. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/designer.png
  11125. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/find_disabled.png
  11126. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/find_normal.png
  11127. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_128x128.png
  11128. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_16x16.png
  11129. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_32x32.png
  11130. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_64x64.png
  11131. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_128x128.png
  11132. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_16x16.png
  11133. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_32x32.png
  11134. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_64x64.png
  11135. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_16x16.png
  11136. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_32x32.png
  11137. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_48x48.png
  11138. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/styles/images/woodbackground.png
  11139. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/styles/images/woodbutton.png
  11140. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked.png
  11141. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_hover.png
  11142. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_pressed.png
  11143. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked.png
  11144. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_hover.png
  11145. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_pressed.png
  11146. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow.png
  11147. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow_disabled.png
  11148. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/frame.png
  11149. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pagefold.png
  11150. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton.png
  11151. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_hover.png
  11152. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_pressed.png
  11153. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked.png
  11154. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_hover.png
  11155. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_pressed.png
  11156. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked.png
  11157. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_hover.png
  11158. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_pressed.png
  11159. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/sizegrip.png
  11160. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown.png
  11161. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_hover.png
  11162. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_off.png
  11163. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_pressed.png
  11164. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup.png
  11165. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_hover.png
  11166. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_off.png
  11167. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_pressed.png
  11168. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow.png
  11169. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow_disabled.png
  11170. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-airbrush.png
  11171. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-eraser.png
  11172. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-felt-marker.png
  11173. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-pencil.png
  11174. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/circle.png
  11175. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/square.png
  11176. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/triangle.png
  11177. share/doc/qt5/qtwidgets/images/weatheranchorlayout-example.png
  11178. share/doc/qt5/qtwidgets/images/whatsthis.png
  11179. share/doc/qt5/qtwidgets/images/widget-examples.png
  11180. share/doc/qt5/qtwidgets/images/widgetdelegate.png
  11181. share/doc/qt5/qtwidgets/images/widgetmapper-combo-mapping.png
  11182. share/doc/qt5/qtwidgets/images/widgetmapper-simple-mapping.png
  11183. share/doc/qt5/qtwidgets/images/widgetmapper.png
  11184. share/doc/qt5/qtwidgets/images/widgets-tutorial-childwidget.png
  11185. share/doc/qt5/qtwidgets/images/widgets-tutorial-nestedlayouts.png
  11186. share/doc/qt5/qtwidgets/images/widgets-tutorial-toplevel.png
  11187. share/doc/qt5/qtwidgets/images/widgets-tutorial-windowlayout.png
  11188. share/doc/qt5/qtwidgets/images/wiggly-example.png
  11189. share/doc/qt5/qtwidgets/images/windowflags-example.png
  11190. share/doc/qt5/qtwidgets/images/windowflags_controllerwindow.png
  11191. share/doc/qt5/qtwidgets/images/windowflags_previewwindow.png
  11192. share/doc/qt5/qtwidgets/images/windows-checkbox.png
  11193. share/doc/qt5/qtwidgets/images/windows-combobox.png
  11194. share/doc/qt5/qtwidgets/images/windows-dateedit.png
  11195. share/doc/qt5/qtwidgets/images/windows-datetimeedit.png
  11196. share/doc/qt5/qtwidgets/images/windows-dial.png
  11197. share/doc/qt5/qtwidgets/images/windows-groupbox.png
  11198. share/doc/qt5/qtwidgets/images/windows-label.png
  11199. share/doc/qt5/qtwidgets/images/windows-lcdnumber.png
  11200. share/doc/qt5/qtwidgets/images/windows-lineedit.png
  11201. share/doc/qt5/qtwidgets/images/windows-listview.png
  11202. share/doc/qt5/qtwidgets/images/windows-progressbar.png
  11203. share/doc/qt5/qtwidgets/images/windows-radiobutton.png
  11204. share/doc/qt5/qtwidgets/images/windows-slider.png
  11205. share/doc/qt5/qtwidgets/images/windows-spinbox.png
  11206. share/doc/qt5/qtwidgets/images/windows-style.png
  11207. share/doc/qt5/qtwidgets/images/windows-style2.png
  11208. share/doc/qt5/qtwidgets/images/windows-tableview.png
  11209. share/doc/qt5/qtwidgets/images/windows-tabwidget.png
  11210. share/doc/qt5/qtwidgets/images/windows-timeedit.png
  11211. share/doc/qt5/qtwidgets/images/windows-treeview.png
  11212. share/doc/qt5/qtwidgets/images/windows-vista-style.png
  11213. share/doc/qt5/qtwidgets/images/windows-xp-style.png
  11214. share/doc/qt5/qtwidgets/images/windowstabimage.png
  11215. share/doc/qt5/qtwidgets/images/windowsvista-fontcombobox.png
  11216. share/doc/qt5/qtwidgets/images/windowsvista-pushbutton.png
  11217. share/doc/qt5/qtwidgets/images/windowsvista-radiobutton.png
  11218. share/doc/qt5/qtwidgets/images/windowsxp-tabwidget.png
  11219. share/doc/qt5/qtwidgets/images/windowsxp-treeview.png
  11220. share/doc/qt5/qtwidgets/images/woodbackground.png
  11221. share/doc/qt5/qtwidgets/images/woodbutton.png
  11222. share/doc/qt5/qtwidgets/layout.html
  11223. share/doc/qt5/qtwidgets/mainwindow.html
  11224. share/doc/qt5/qtwidgets/model-view-programming.html
  11225. share/doc/qt5/qtwidgets/modelview-part2-main-cpp.html
  11226. share/doc/qt5/qtwidgets/modelview.html
  11227. share/doc/qt5/qtwidgets/qabstractbutton-members.html
  11228. share/doc/qt5/qtwidgets/qabstractbutton.html
  11229. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem-members.html
  11230. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem.html
  11231. share/doc/qt5/qtwidgets/qabstractitemdelegate-members.html
  11232. share/doc/qt5/qtwidgets/qabstractitemdelegate-obsolete.html
  11233. share/doc/qt5/qtwidgets/qabstractitemdelegate.html
  11234. share/doc/qt5/qtwidgets/qabstractitemview-members.html
  11235. share/doc/qt5/qtwidgets/qabstractitemview-obsolete.html
  11236. share/doc/qt5/qtwidgets/qabstractitemview.html
  11237. share/doc/qt5/qtwidgets/qabstractscrollarea-members.html
  11238. share/doc/qt5/qtwidgets/qabstractscrollarea.html
  11239. share/doc/qt5/qtwidgets/qabstractslider-members.html
  11240. share/doc/qt5/qtwidgets/qabstractslider.html
  11241. share/doc/qt5/qtwidgets/qabstractspinbox-members.html
  11242. share/doc/qt5/qtwidgets/qabstractspinbox.html
  11243. share/doc/qt5/qtwidgets/qaccessiblewidget-members.html
  11244. share/doc/qt5/qtwidgets/qaccessiblewidget.html
  11245. share/doc/qt5/qtwidgets/qaction-members.html
  11246. share/doc/qt5/qtwidgets/qaction.html
  11247. share/doc/qt5/qtwidgets/qactiongroup-members.html
  11248. share/doc/qt5/qtwidgets/qactiongroup.html
  11249. share/doc/qt5/qtwidgets/qapplication-members.html
  11250. share/doc/qt5/qtwidgets/qapplication-obsolete.html
  11251. share/doc/qt5/qtwidgets/qapplication.html
  11252. share/doc/qt5/qtwidgets/qboxlayout-members.html
  11253. share/doc/qt5/qtwidgets/qboxlayout.html
  11254. share/doc/qt5/qtwidgets/qbuttongroup-members.html
  11255. share/doc/qt5/qtwidgets/qbuttongroup.html
  11256. share/doc/qt5/qtwidgets/qcalendarwidget-members.html
  11257. share/doc/qt5/qtwidgets/qcalendarwidget.html
  11258. share/doc/qt5/qtwidgets/qcheckbox-members.html
  11259. share/doc/qt5/qtwidgets/qcheckbox.html
  11260. share/doc/qt5/qtwidgets/qcolordialog-members.html
  11261. share/doc/qt5/qtwidgets/qcolordialog-obsolete.html
  11262. share/doc/qt5/qtwidgets/qcolordialog.html
  11263. share/doc/qt5/qtwidgets/qcolormap-members.html
  11264. share/doc/qt5/qtwidgets/qcolormap.html
  11265. share/doc/qt5/qtwidgets/qcolumnview-members.html
  11266. share/doc/qt5/qtwidgets/qcolumnview.html
  11267. share/doc/qt5/qtwidgets/qcombobox-members.html
  11268. share/doc/qt5/qtwidgets/qcombobox-obsolete.html
  11269. share/doc/qt5/qtwidgets/qcombobox.html
  11270. share/doc/qt5/qtwidgets/qcommandlinkbutton-members.html
  11271. share/doc/qt5/qtwidgets/qcommandlinkbutton.html
  11272. share/doc/qt5/qtwidgets/qcommonstyle-members.html
  11273. share/doc/qt5/qtwidgets/qcommonstyle.html
  11274. share/doc/qt5/qtwidgets/qcompleter-members.html
  11275. share/doc/qt5/qtwidgets/qcompleter.html
  11276. share/doc/qt5/qtwidgets/qdatawidgetmapper-members.html
  11277. share/doc/qt5/qtwidgets/qdatawidgetmapper.html
  11278. share/doc/qt5/qtwidgets/qdateedit-members.html
  11279. share/doc/qt5/qtwidgets/qdateedit.html
  11280. share/doc/qt5/qtwidgets/qdatetimeedit-members.html
  11281. share/doc/qt5/qtwidgets/qdatetimeedit.html
  11282. share/doc/qt5/qtwidgets/qdesktopwidget-members.html
  11283. share/doc/qt5/qtwidgets/qdesktopwidget-obsolete.html
  11284. share/doc/qt5/qtwidgets/qdesktopwidget.html
  11285. share/doc/qt5/qtwidgets/qdial-members.html
  11286. share/doc/qt5/qtwidgets/qdial.html
  11287. share/doc/qt5/qtwidgets/qdialog-members.html
  11288. share/doc/qt5/qtwidgets/qdialog-obsolete.html
  11289. share/doc/qt5/qtwidgets/qdialog.html
  11290. share/doc/qt5/qtwidgets/qdialogbuttonbox-members.html
  11291. share/doc/qt5/qtwidgets/qdialogbuttonbox.html
  11292. share/doc/qt5/qtwidgets/qdirmodel-members.html
  11293. share/doc/qt5/qtwidgets/qdirmodel.html
  11294. share/doc/qt5/qtwidgets/qdockwidget-members.html
  11295. share/doc/qt5/qtwidgets/qdockwidget.html
  11296. share/doc/qt5/qtwidgets/qdoublespinbox-members.html
  11297. share/doc/qt5/qtwidgets/qdoublespinbox.html
  11298. share/doc/qt5/qtwidgets/qdrawutil-h.html
  11299. share/doc/qt5/qtwidgets/qerrormessage-members.html
  11300. share/doc/qt5/qtwidgets/qerrormessage.html
  11301. share/doc/qt5/qtwidgets/qfiledialog-members.html
  11302. share/doc/qt5/qtwidgets/qfiledialog-obsolete.html
  11303. share/doc/qt5/qtwidgets/qfiledialog.html
  11304. share/doc/qt5/qtwidgets/qfileiconprovider-members.html
  11305. share/doc/qt5/qtwidgets/qfileiconprovider.html
  11306. share/doc/qt5/qtwidgets/qfilesystemmodel-members.html
  11307. share/doc/qt5/qtwidgets/qfilesystemmodel.html
  11308. share/doc/qt5/qtwidgets/qfocusframe-members.html
  11309. share/doc/qt5/qtwidgets/qfocusframe.html
  11310. share/doc/qt5/qtwidgets/qfontcombobox-members.html
  11311. share/doc/qt5/qtwidgets/qfontcombobox.html
  11312. share/doc/qt5/qtwidgets/qfontdialog-members.html
  11313. share/doc/qt5/qtwidgets/qfontdialog.html
  11314. share/doc/qt5/qtwidgets/qformlayout-members.html
  11315. share/doc/qt5/qtwidgets/qformlayout-takerowresult-members.html
  11316. share/doc/qt5/qtwidgets/qformlayout-takerowresult.html
  11317. share/doc/qt5/qtwidgets/qformlayout.html
  11318. share/doc/qt5/qtwidgets/qframe-members.html
  11319. share/doc/qt5/qtwidgets/qframe.html
  11320. share/doc/qt5/qtwidgets/qgesture-members.html
  11321. share/doc/qt5/qtwidgets/qgesture.html
  11322. share/doc/qt5/qtwidgets/qgestureevent-members.html
  11323. share/doc/qt5/qtwidgets/qgestureevent.html
  11324. share/doc/qt5/qtwidgets/qgesturerecognizer-members.html
  11325. share/doc/qt5/qtwidgets/qgesturerecognizer.html
  11326. share/doc/qt5/qtwidgets/qgraphicsanchor-members.html
  11327. share/doc/qt5/qtwidgets/qgraphicsanchor.html
  11328. share/doc/qt5/qtwidgets/qgraphicsanchorlayout-members.html
  11329. share/doc/qt5/qtwidgets/qgraphicsanchorlayout.html
  11330. share/doc/qt5/qtwidgets/qgraphicsblureffect-members.html
  11331. share/doc/qt5/qtwidgets/qgraphicsblureffect.html
  11332. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect-members.html
  11333. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect.html
  11334. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect-members.html
  11335. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect.html
  11336. share/doc/qt5/qtwidgets/qgraphicseffect-members.html
  11337. share/doc/qt5/qtwidgets/qgraphicseffect.html
  11338. share/doc/qt5/qtwidgets/qgraphicsellipseitem-members.html
  11339. share/doc/qt5/qtwidgets/qgraphicsellipseitem.html
  11340. share/doc/qt5/qtwidgets/qgraphicsgridlayout-members.html
  11341. share/doc/qt5/qtwidgets/qgraphicsgridlayout.html
  11342. share/doc/qt5/qtwidgets/qgraphicsitem-members.html
  11343. share/doc/qt5/qtwidgets/qgraphicsitem-obsolete.html
  11344. share/doc/qt5/qtwidgets/qgraphicsitem.html
  11345. share/doc/qt5/qtwidgets/qgraphicsitemanimation-members.html
  11346. share/doc/qt5/qtwidgets/qgraphicsitemanimation-obsolete.html
  11347. share/doc/qt5/qtwidgets/qgraphicsitemanimation.html
  11348. share/doc/qt5/qtwidgets/qgraphicsitemgroup-members.html
  11349. share/doc/qt5/qtwidgets/qgraphicsitemgroup.html
  11350. share/doc/qt5/qtwidgets/qgraphicslayout-members.html
  11351. share/doc/qt5/qtwidgets/qgraphicslayout.html
  11352. share/doc/qt5/qtwidgets/qgraphicslayoutitem-members.html
  11353. share/doc/qt5/qtwidgets/qgraphicslayoutitem.html
  11354. share/doc/qt5/qtwidgets/qgraphicslinearlayout-members.html
  11355. share/doc/qt5/qtwidgets/qgraphicslinearlayout.html
  11356. share/doc/qt5/qtwidgets/qgraphicslineitem-members.html
  11357. share/doc/qt5/qtwidgets/qgraphicslineitem.html
  11358. share/doc/qt5/qtwidgets/qgraphicsobject-members.html
  11359. share/doc/qt5/qtwidgets/qgraphicsobject.html
  11360. share/doc/qt5/qtwidgets/qgraphicsopacityeffect-members.html
  11361. share/doc/qt5/qtwidgets/qgraphicsopacityeffect.html
  11362. share/doc/qt5/qtwidgets/qgraphicspathitem-members.html
  11363. share/doc/qt5/qtwidgets/qgraphicspathitem.html
  11364. share/doc/qt5/qtwidgets/qgraphicspixmapitem-members.html
  11365. share/doc/qt5/qtwidgets/qgraphicspixmapitem.html
  11366. share/doc/qt5/qtwidgets/qgraphicspolygonitem-members.html
  11367. share/doc/qt5/qtwidgets/qgraphicspolygonitem.html
  11368. share/doc/qt5/qtwidgets/qgraphicsproxywidget-members.html
  11369. share/doc/qt5/qtwidgets/qgraphicsproxywidget.html
  11370. share/doc/qt5/qtwidgets/qgraphicsrectitem-members.html
  11371. share/doc/qt5/qtwidgets/qgraphicsrectitem.html
  11372. share/doc/qt5/qtwidgets/qgraphicsrotation-members.html
  11373. share/doc/qt5/qtwidgets/qgraphicsrotation.html
  11374. share/doc/qt5/qtwidgets/qgraphicsscale-members.html
  11375. share/doc/qt5/qtwidgets/qgraphicsscale.html
  11376. share/doc/qt5/qtwidgets/qgraphicsscene-members.html
  11377. share/doc/qt5/qtwidgets/qgraphicsscene-obsolete.html
  11378. share/doc/qt5/qtwidgets/qgraphicsscene.html
  11379. share/doc/qt5/qtwidgets/qgraphicsscenecontextmenuevent-members.html
  11380. share/doc/qt5/qtwidgets/qgraphicsscenecontextmenuevent.html
  11381. share/doc/qt5/qtwidgets/qgraphicsscenedragdropevent-members.html
  11382. share/doc/qt5/qtwidgets/qgraphicsscenedragdropevent.html
  11383. share/doc/qt5/qtwidgets/qgraphicssceneevent-members.html
  11384. share/doc/qt5/qtwidgets/qgraphicssceneevent.html
  11385. share/doc/qt5/qtwidgets/qgraphicsscenehelpevent-members.html
  11386. share/doc/qt5/qtwidgets/qgraphicsscenehelpevent.html
  11387. share/doc/qt5/qtwidgets/qgraphicsscenehoverevent-members.html
  11388. share/doc/qt5/qtwidgets/qgraphicsscenehoverevent.html
  11389. share/doc/qt5/qtwidgets/qgraphicsscenemouseevent-members.html
  11390. share/doc/qt5/qtwidgets/qgraphicsscenemouseevent.html
  11391. share/doc/qt5/qtwidgets/qgraphicsscenemoveevent-members.html
  11392. share/doc/qt5/qtwidgets/qgraphicsscenemoveevent.html
  11393. share/doc/qt5/qtwidgets/qgraphicssceneresizeevent-members.html
  11394. share/doc/qt5/qtwidgets/qgraphicssceneresizeevent.html
  11395. share/doc/qt5/qtwidgets/qgraphicsscenewheelevent-members.html
  11396. share/doc/qt5/qtwidgets/qgraphicsscenewheelevent.html
  11397. share/doc/qt5/qtwidgets/qgraphicssimpletextitem-members.html
  11398. share/doc/qt5/qtwidgets/qgraphicssimpletextitem.html
  11399. share/doc/qt5/qtwidgets/qgraphicstextitem-members.html
  11400. share/doc/qt5/qtwidgets/qgraphicstextitem.html
  11401. share/doc/qt5/qtwidgets/qgraphicstransform-members.html
  11402. share/doc/qt5/qtwidgets/qgraphicstransform.html
  11403. share/doc/qt5/qtwidgets/qgraphicsview-members.html
  11404. share/doc/qt5/qtwidgets/qgraphicsview-obsolete.html
  11405. share/doc/qt5/qtwidgets/qgraphicsview.html
  11406. share/doc/qt5/qtwidgets/qgraphicswidget-members.html
  11407. share/doc/qt5/qtwidgets/qgraphicswidget.html
  11408. share/doc/qt5/qtwidgets/qgridlayout-members.html
  11409. share/doc/qt5/qtwidgets/qgridlayout.html
  11410. share/doc/qt5/qtwidgets/qgroupbox-members.html
  11411. share/doc/qt5/qtwidgets/qgroupbox.html
  11412. share/doc/qt5/qtwidgets/qhboxlayout-members.html
  11413. share/doc/qt5/qtwidgets/qhboxlayout.html
  11414. share/doc/qt5/qtwidgets/qheaderview-members.html
  11415. share/doc/qt5/qtwidgets/qheaderview-obsolete.html
  11416. share/doc/qt5/qtwidgets/qheaderview.html
  11417. share/doc/qt5/qtwidgets/qinputdialog-members.html
  11418. share/doc/qt5/qtwidgets/qinputdialog-obsolete.html
  11419. share/doc/qt5/qtwidgets/qinputdialog.html
  11420. share/doc/qt5/qtwidgets/qitemdelegate-members.html
  11421. share/doc/qt5/qtwidgets/qitemdelegate.html
  11422. share/doc/qt5/qtwidgets/qitemeditorcreator-members.html
  11423. share/doc/qt5/qtwidgets/qitemeditorcreator.html
  11424. share/doc/qt5/qtwidgets/qitemeditorcreatorbase-members.html
  11425. share/doc/qt5/qtwidgets/qitemeditorcreatorbase.html
  11426. share/doc/qt5/qtwidgets/qitemeditorfactory-members.html
  11427. share/doc/qt5/qtwidgets/qitemeditorfactory.html
  11428. share/doc/qt5/qtwidgets/qkeyeventtransition-members.html
  11429. share/doc/qt5/qtwidgets/qkeyeventtransition.html
  11430. share/doc/qt5/qtwidgets/qkeysequenceedit-members.html
  11431. share/doc/qt5/qtwidgets/qkeysequenceedit.html
  11432. share/doc/qt5/qtwidgets/qlabel-members.html
  11433. share/doc/qt5/qtwidgets/qlabel.html
  11434. share/doc/qt5/qtwidgets/qlayout-members.html
  11435. share/doc/qt5/qtwidgets/qlayout-obsolete.html
  11436. share/doc/qt5/qtwidgets/qlayout.html
  11437. share/doc/qt5/qtwidgets/qlayoutitem-members.html
  11438. share/doc/qt5/qtwidgets/qlayoutitem.html
  11439. share/doc/qt5/qtwidgets/qlcdnumber-members.html
  11440. share/doc/qt5/qtwidgets/qlcdnumber.html
  11441. share/doc/qt5/qtwidgets/qlineedit-members.html
  11442. share/doc/qt5/qtwidgets/qlineedit.html
  11443. share/doc/qt5/qtwidgets/qlistview-members.html
  11444. share/doc/qt5/qtwidgets/qlistview.html
  11445. share/doc/qt5/qtwidgets/qlistwidget-members.html
  11446. share/doc/qt5/qtwidgets/qlistwidget-obsolete.html
  11447. share/doc/qt5/qtwidgets/qlistwidget.html
  11448. share/doc/qt5/qtwidgets/qlistwidgetitem-members.html
  11449. share/doc/qt5/qtwidgets/qlistwidgetitem-obsolete.html
  11450. share/doc/qt5/qtwidgets/qlistwidgetitem.html
  11451. share/doc/qt5/qtwidgets/qmaccocoaviewcontainer-members.html
  11452. share/doc/qt5/qtwidgets/qmaccocoaviewcontainer.html
  11453. share/doc/qt5/qtwidgets/qmacnativewidget-members.html
  11454. share/doc/qt5/qtwidgets/qmacnativewidget.html
  11455. share/doc/qt5/qtwidgets/qmainwindow-members.html
  11456. share/doc/qt5/qtwidgets/qmainwindow.html
  11457. share/doc/qt5/qtwidgets/qmdiarea-members.html
  11458. share/doc/qt5/qtwidgets/qmdiarea.html
  11459. share/doc/qt5/qtwidgets/qmdisubwindow-members.html
  11460. share/doc/qt5/qtwidgets/qmdisubwindow.html
  11461. share/doc/qt5/qtwidgets/qmenu-members.html
  11462. share/doc/qt5/qtwidgets/qmenu-obsolete.html
  11463. share/doc/qt5/qtwidgets/qmenu.html
  11464. share/doc/qt5/qtwidgets/qmenubar-members.html
  11465. share/doc/qt5/qtwidgets/qmenubar.html
  11466. share/doc/qt5/qtwidgets/qmessagebox-members.html
  11467. share/doc/qt5/qtwidgets/qmessagebox-obsolete.html
  11468. share/doc/qt5/qtwidgets/qmessagebox.html
  11469. share/doc/qt5/qtwidgets/qmouseeventtransition-members.html
  11470. share/doc/qt5/qtwidgets/qmouseeventtransition.html
  11471. share/doc/qt5/qtwidgets/qopenglwidget-members.html
  11472. share/doc/qt5/qtwidgets/qopenglwidget.html
  11473. share/doc/qt5/qtwidgets/qpangesture-members.html
  11474. share/doc/qt5/qtwidgets/qpangesture.html
  11475. share/doc/qt5/qtwidgets/qpinchgesture-members.html
  11476. share/doc/qt5/qtwidgets/qpinchgesture.html
  11477. share/doc/qt5/qtwidgets/qplaintextdocumentlayout-members.html
  11478. share/doc/qt5/qtwidgets/qplaintextdocumentlayout.html
  11479. share/doc/qt5/qtwidgets/qplaintextedit-members.html
  11480. share/doc/qt5/qtwidgets/qplaintextedit.html
  11481. share/doc/qt5/qtwidgets/qprogressbar-members.html
  11482. share/doc/qt5/qtwidgets/qprogressbar.html
  11483. share/doc/qt5/qtwidgets/qprogressdialog-members.html
  11484. share/doc/qt5/qtwidgets/qprogressdialog.html
  11485. share/doc/qt5/qtwidgets/qproxystyle-members.html
  11486. share/doc/qt5/qtwidgets/qproxystyle.html
  11487. share/doc/qt5/qtwidgets/qpushbutton-members.html
  11488. share/doc/qt5/qtwidgets/qpushbutton.html
  11489. share/doc/qt5/qtwidgets/qradiobutton-members.html
  11490. share/doc/qt5/qtwidgets/qradiobutton.html
  11491. share/doc/qt5/qtwidgets/qrubberband-members.html
  11492. share/doc/qt5/qtwidgets/qrubberband.html
  11493. share/doc/qt5/qtwidgets/qscrollarea-members.html
  11494. share/doc/qt5/qtwidgets/qscrollarea.html
  11495. share/doc/qt5/qtwidgets/qscrollbar-members.html
  11496. share/doc/qt5/qtwidgets/qscrollbar.html
  11497. share/doc/qt5/qtwidgets/qscroller-members.html
  11498. share/doc/qt5/qtwidgets/qscroller.html
  11499. share/doc/qt5/qtwidgets/qscrollerproperties-members.html
  11500. share/doc/qt5/qtwidgets/qscrollerproperties.html
  11501. share/doc/qt5/qtwidgets/qshortcut-members.html
  11502. share/doc/qt5/qtwidgets/qshortcut.html
  11503. share/doc/qt5/qtwidgets/qsizegrip-members.html
  11504. share/doc/qt5/qtwidgets/qsizegrip.html
  11505. share/doc/qt5/qtwidgets/qsizepolicy-members.html
  11506. share/doc/qt5/qtwidgets/qsizepolicy.html
  11507. share/doc/qt5/qtwidgets/qslider-members.html
  11508. share/doc/qt5/qtwidgets/qslider.html
  11509. share/doc/qt5/qtwidgets/qspaceritem-members.html
  11510. share/doc/qt5/qtwidgets/qspaceritem.html
  11511. share/doc/qt5/qtwidgets/qspinbox-members.html
  11512. share/doc/qt5/qtwidgets/qspinbox.html
  11513. share/doc/qt5/qtwidgets/qsplashscreen-members.html
  11514. share/doc/qt5/qtwidgets/qsplashscreen.html
  11515. share/doc/qt5/qtwidgets/qsplitter-members.html
  11516. share/doc/qt5/qtwidgets/qsplitter-obsolete.html
  11517. share/doc/qt5/qtwidgets/qsplitter.html
  11518. share/doc/qt5/qtwidgets/qsplitterhandle-members.html
  11519. share/doc/qt5/qtwidgets/qsplitterhandle.html
  11520. share/doc/qt5/qtwidgets/qstackedlayout-members.html
  11521. share/doc/qt5/qtwidgets/qstackedlayout.html
  11522. share/doc/qt5/qtwidgets/qstackedwidget-members.html
  11523. share/doc/qt5/qtwidgets/qstackedwidget.html
  11524. share/doc/qt5/qtwidgets/qstandarditemeditorcreator-members.html
  11525. share/doc/qt5/qtwidgets/qstandarditemeditorcreator.html
  11526. share/doc/qt5/qtwidgets/qstatusbar-members.html
  11527. share/doc/qt5/qtwidgets/qstatusbar.html
  11528. share/doc/qt5/qtwidgets/qstyle-members.html
  11529. share/doc/qt5/qtwidgets/qstyle-obsolete.html
  11530. share/doc/qt5/qtwidgets/qstyle.html
  11531. share/doc/qt5/qtwidgets/qstyleditemdelegate-members.html
  11532. share/doc/qt5/qtwidgets/qstyleditemdelegate.html
  11533. share/doc/qt5/qtwidgets/qstylefactory-members.html
  11534. share/doc/qt5/qtwidgets/qstylefactory.html
  11535. share/doc/qt5/qtwidgets/qstylehintreturn-members.html
  11536. share/doc/qt5/qtwidgets/qstylehintreturn.html
  11537. share/doc/qt5/qtwidgets/qstylehintreturnmask-members.html
  11538. share/doc/qt5/qtwidgets/qstylehintreturnmask.html
  11539. share/doc/qt5/qtwidgets/qstylehintreturnvariant-members.html
  11540. share/doc/qt5/qtwidgets/qstylehintreturnvariant.html
  11541. share/doc/qt5/qtwidgets/qstyleoption-members.html
  11542. share/doc/qt5/qtwidgets/qstyleoption-obsolete.html
  11543. share/doc/qt5/qtwidgets/qstyleoption.html
  11544. share/doc/qt5/qtwidgets/qstyleoptionbutton-members.html
  11545. share/doc/qt5/qtwidgets/qstyleoptionbutton.html
  11546. share/doc/qt5/qtwidgets/qstyleoptioncombobox-members.html
  11547. share/doc/qt5/qtwidgets/qstyleoptioncombobox.html
  11548. share/doc/qt5/qtwidgets/qstyleoptioncomplex-members.html
  11549. share/doc/qt5/qtwidgets/qstyleoptioncomplex.html
  11550. share/doc/qt5/qtwidgets/qstyleoptiondockwidget-members.html
  11551. share/doc/qt5/qtwidgets/qstyleoptiondockwidget-obsolete.html
  11552. share/doc/qt5/qtwidgets/qstyleoptiondockwidget.html
  11553. share/doc/qt5/qtwidgets/qstyleoptionfocusrect-members.html
  11554. share/doc/qt5/qtwidgets/qstyleoptionfocusrect.html
  11555. share/doc/qt5/qtwidgets/qstyleoptionframe-members.html
  11556. share/doc/qt5/qtwidgets/qstyleoptionframe-obsolete.html
  11557. share/doc/qt5/qtwidgets/qstyleoptionframe.html
  11558. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem-members.html
  11559. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem-obsolete.html
  11560. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem.html
  11561. share/doc/qt5/qtwidgets/qstyleoptiongroupbox-members.html
  11562. share/doc/qt5/qtwidgets/qstyleoptiongroupbox.html
  11563. share/doc/qt5/qtwidgets/qstyleoptionheader-members.html
  11564. share/doc/qt5/qtwidgets/qstyleoptionheader.html
  11565. share/doc/qt5/qtwidgets/qstyleoptionmenuitem-members.html
  11566. share/doc/qt5/qtwidgets/qstyleoptionmenuitem.html
  11567. share/doc/qt5/qtwidgets/qstyleoptionprogressbar-members.html
  11568. share/doc/qt5/qtwidgets/qstyleoptionprogressbar-obsolete.html
  11569. share/doc/qt5/qtwidgets/qstyleoptionprogressbar.html
  11570. share/doc/qt5/qtwidgets/qstyleoptionrubberband-members.html
  11571. share/doc/qt5/qtwidgets/qstyleoptionrubberband.html
  11572. share/doc/qt5/qtwidgets/qstyleoptionsizegrip-members.html
  11573. share/doc/qt5/qtwidgets/qstyleoptionsizegrip.html
  11574. share/doc/qt5/qtwidgets/qstyleoptionslider-members.html
  11575. share/doc/qt5/qtwidgets/qstyleoptionslider.html
  11576. share/doc/qt5/qtwidgets/qstyleoptionspinbox-members.html
  11577. share/doc/qt5/qtwidgets/qstyleoptionspinbox.html
  11578. share/doc/qt5/qtwidgets/qstyleoptiontab-members.html
  11579. share/doc/qt5/qtwidgets/qstyleoptiontab-obsolete.html
  11580. share/doc/qt5/qtwidgets/qstyleoptiontab.html
  11581. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase-members.html
  11582. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase-obsolete.html
  11583. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase.html
  11584. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe-members.html
  11585. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe-obsolete.html
  11586. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe.html
  11587. share/doc/qt5/qtwidgets/qstyleoptiontitlebar-members.html
  11588. share/doc/qt5/qtwidgets/qstyleoptiontitlebar.html
  11589. share/doc/qt5/qtwidgets/qstyleoptiontoolbar-members.html
  11590. share/doc/qt5/qtwidgets/qstyleoptiontoolbar.html
  11591. share/doc/qt5/qtwidgets/qstyleoptiontoolbox-members.html
  11592. share/doc/qt5/qtwidgets/qstyleoptiontoolbox-obsolete.html
  11593. share/doc/qt5/qtwidgets/qstyleoptiontoolbox.html
  11594. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton-members.html
  11595. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton.html
  11596. share/doc/qt5/qtwidgets/qstyleoptionviewitem-members.html
  11597. share/doc/qt5/qtwidgets/qstyleoptionviewitem-obsolete.html
  11598. share/doc/qt5/qtwidgets/qstyleoptionviewitem.html
  11599. share/doc/qt5/qtwidgets/qstylepainter-members.html
  11600. share/doc/qt5/qtwidgets/qstylepainter.html
  11601. share/doc/qt5/qtwidgets/qstyleplugin-members.html
  11602. share/doc/qt5/qtwidgets/qstyleplugin.html
  11603. share/doc/qt5/qtwidgets/qswipegesture-members.html
  11604. share/doc/qt5/qtwidgets/qswipegesture.html
  11605. share/doc/qt5/qtwidgets/qsystemtrayicon-members.html
  11606. share/doc/qt5/qtwidgets/qsystemtrayicon.html
  11607. share/doc/qt5/qtwidgets/qtabbar-members.html
  11608. share/doc/qt5/qtwidgets/qtabbar.html
  11609. share/doc/qt5/qtwidgets/qtableview-members.html
  11610. share/doc/qt5/qtwidgets/qtableview-obsolete.html
  11611. share/doc/qt5/qtwidgets/qtableview.html
  11612. share/doc/qt5/qtwidgets/qtablewidget-members.html
  11613. share/doc/qt5/qtwidgets/qtablewidget-obsolete.html
  11614. share/doc/qt5/qtwidgets/qtablewidget.html
  11615. share/doc/qt5/qtwidgets/qtablewidgetitem-members.html
  11616. share/doc/qt5/qtwidgets/qtablewidgetitem-obsolete.html
  11617. share/doc/qt5/qtwidgets/qtablewidgetitem.html
  11618. share/doc/qt5/qtwidgets/qtablewidgetselectionrange-members.html
  11619. share/doc/qt5/qtwidgets/qtablewidgetselectionrange.html
  11620. share/doc/qt5/qtwidgets/qtabwidget-members.html
  11621. share/doc/qt5/qtwidgets/qtabwidget.html
  11622. share/doc/qt5/qtwidgets/qtapandholdgesture-members.html
  11623. share/doc/qt5/qtwidgets/qtapandholdgesture.html
  11624. share/doc/qt5/qtwidgets/qtapgesture-members.html
  11625. share/doc/qt5/qtwidgets/qtapgesture.html
  11626. share/doc/qt5/qtwidgets/qtextbrowser-members.html
  11627. share/doc/qt5/qtwidgets/qtextbrowser.html
  11628. share/doc/qt5/qtwidgets/qtextedit-extraselection-members.html
  11629. share/doc/qt5/qtwidgets/qtextedit-extraselection.html
  11630. share/doc/qt5/qtwidgets/qtextedit-members.html
  11631. share/doc/qt5/qtwidgets/qtextedit.html
  11632. share/doc/qt5/qtwidgets/qtilerules-members.html
  11633. share/doc/qt5/qtwidgets/qtilerules.html
  11634. share/doc/qt5/qtwidgets/qtimeedit-members.html
  11635. share/doc/qt5/qtwidgets/qtimeedit.html
  11636. share/doc/qt5/qtwidgets/qtoolbar-members.html
  11637. share/doc/qt5/qtwidgets/qtoolbar.html
  11638. share/doc/qt5/qtwidgets/qtoolbox-members.html
  11639. share/doc/qt5/qtwidgets/qtoolbox.html
  11640. share/doc/qt5/qtwidgets/qtoolbutton-members.html
  11641. share/doc/qt5/qtwidgets/qtoolbutton.html
  11642. share/doc/qt5/qtwidgets/qtooltip-members.html
  11643. share/doc/qt5/qtwidgets/qtooltip.html
  11644. share/doc/qt5/qtwidgets/qtreeview-members.html
  11645. share/doc/qt5/qtwidgets/qtreeview-obsolete.html
  11646. share/doc/qt5/qtwidgets/qtreeview.html
  11647. share/doc/qt5/qtwidgets/qtreewidget-members.html
  11648. share/doc/qt5/qtwidgets/qtreewidget-obsolete.html
  11649. share/doc/qt5/qtwidgets/qtreewidget.html
  11650. share/doc/qt5/qtwidgets/qtreewidgetitem-members.html
  11651. share/doc/qt5/qtwidgets/qtreewidgetitem-obsolete.html
  11652. share/doc/qt5/qtwidgets/qtreewidgetitem.html
  11653. share/doc/qt5/qtwidgets/qtreewidgetitemiterator-members.html
  11654. share/doc/qt5/qtwidgets/qtreewidgetitemiterator.html
  11655. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-pro.html
  11656. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-qrc.html
  11657. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-example.html
  11658. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-main-cpp.html
  11659. share/doc/qt5/qtwidgets/qtwidgets-animation-appchooser-appchooser-pro.html
  11660. share/doc/qt5/qtwidgets/qtwidgets-animation-appchooser-appchooser-qrc.html
  11661. share/doc/qt5/qtwidgets/qtwidgets-animation-appchooser-example.html
  11662. share/doc/qt5/qtwidgets/qtwidgets-animation-appchooser-main-cpp.html
  11663. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-animation-h.html
  11664. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-easing-pro.html
  11665. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-easing-qrc.html
  11666. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-example.html
  11667. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-form-ui.html
  11668. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-main-cpp.html
  11669. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-window-cpp.html
  11670. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-window-h.html
  11671. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-example.html
  11672. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-main-cpp.html
  11673. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-moveblocks-pro.html
  11674. share/doc/qt5/qtwidgets/qtwidgets-animation-states-example.html
  11675. share/doc/qt5/qtwidgets/qtwidgets-animation-states-main-cpp.html
  11676. share/doc/qt5/qtwidgets/qtwidgets-animation-states-states-pro.html
  11677. share/doc/qt5/qtwidgets/qtwidgets-animation-states-states-qrc.html
  11678. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-animation-cpp.html
  11679. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-animation-h.html
  11680. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-example.html
  11681. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-graphicsview-cpp.html
  11682. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-graphicsview-h.html
  11683. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-lifecycle-cpp.html
  11684. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-lifecycle-h.html
  11685. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-main-cpp.html
  11686. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-node-cpp.html
  11687. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-node-h.html
  11688. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-rectbutton-cpp.html
  11689. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-rectbutton-h.html
  11690. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-cpp.html
  11691. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-h.html
  11692. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-pro.html
  11693. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-qrc.html
  11694. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-animationmanager-cpp.html
  11695. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-animationmanager-h.html
  11696. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-boat-cpp.html
  11697. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-boat-h.html
  11698. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-boat-p-h.html
  11699. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-bomb-cpp.html
  11700. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-bomb-h.html
  11701. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-data-xml.html
  11702. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-example.html
  11703. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-graphicsscene-cpp.html
  11704. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-graphicsscene-h.html
  11705. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-main-cpp.html
  11706. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-mainwindow-cpp.html
  11707. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-mainwindow-h.html
  11708. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-background-n810-svg.html
  11709. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-background-svg.html
  11710. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-boat-svg.html
  11711. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-bomb-svg.html
  11712. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sand-svg.html
  11713. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-see-svg.html
  11714. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sky-svg.html
  11715. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sub-attaq-svg.html
  11716. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-submarine-svg.html
  11717. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-surface-svg.html
  11718. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-torpedo-svg.html
  11719. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pixmapitem-cpp.html
  11720. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pixmapitem-h.html
  11721. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-progressitem-cpp.html
  11722. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-progressitem-h.html
  11723. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-qanimationstate-cpp.html
  11724. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-qanimationstate-h.html
  11725. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-states-cpp.html
  11726. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-states-h.html
  11727. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-sub-attaq-pro.html
  11728. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-subattaq-qrc.html
  11729. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-submarine-cpp.html
  11730. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-submarine-h.html
  11731. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-submarine-p-h.html
  11732. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-textinformationitem-cpp.html
  11733. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-textinformationitem-h.html
  11734. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-torpedo-cpp.html
  11735. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-torpedo-h.html
  11736. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-example.html
  11737. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-main-cpp.html
  11738. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-screenshot-cpp.html
  11739. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-screenshot-h.html
  11740. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-screenshot-pro.html
  11741. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-example.html
  11742. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-main-cpp.html
  11743. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-systray-pro.html
  11744. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-systray-qrc.html
  11745. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-window-cpp.html
  11746. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-window-h.html
  11747. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-cpp.html
  11748. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-h.html
  11749. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-pro.html
  11750. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-qrc.html
  11751. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-example.html
  11752. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-main-cpp.html
  11753. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-cpp.html
  11754. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-h.html
  11755. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-pro.html
  11756. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-qrc.html
  11757. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-example.html
  11758. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-main-cpp.html
  11759. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-pages-cpp.html
  11760. share/doc/qt5/qtwidgets/qtwidgets-dialogs-configdialog-pages-h.html
  11761. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-example.html
  11762. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-extension-pro.html
  11763. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-finddialog-cpp.html
  11764. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-finddialog-h.html
  11765. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-main-cpp.html
  11766. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-example.html
  11767. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-findfiles-pro.html
  11768. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-main-cpp.html
  11769. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-window-cpp.html
  11770. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-window-h.html
  11771. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-example.html
  11772. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-cpp.html
  11773. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-h.html
  11774. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-pro.html
  11775. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-qrc.html
  11776. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-main-cpp.html
  11777. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-dialog-cpp.html
  11778. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-dialog-h.html
  11779. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-example.html
  11780. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-main-cpp.html
  11781. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-standarddialogs-pro.html
  11782. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-example.html
  11783. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-main-cpp.html
  11784. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-cpp.html
  11785. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-h.html
  11786. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-pro.html
  11787. share/doc/qt5/qtwidgets/qtwidgets-dialogs-trivialwizard-example.html
  11788. share/doc/qt5/qtwidgets/qtwidgets-dialogs-trivialwizard-trivialwizard-cpp.html
  11789. share/doc/qt5/qtwidgets/qtwidgets-dialogs-trivialwizard-trivialwizard-pro.html
  11790. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-draggableicons-pro.html
  11791. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-draggableicons-qrc.html
  11792. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-dragwidget-cpp.html
  11793. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-dragwidget-h.html
  11794. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-example.html
  11795. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-main-cpp.html
  11796. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-draggabletext-pro.html
  11797. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-draggabletext-qrc.html
  11798. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-dragwidget-cpp.html
  11799. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-dragwidget-h.html
  11800. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-example.html
  11801. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-main-cpp.html
  11802. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-droparea-cpp.html
  11803. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-droparea-h.html
  11804. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-dropsite-pro.html
  11805. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-dropsitewindow-cpp.html
  11806. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-dropsitewindow-h.html
  11807. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-example.html
  11808. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-main-cpp.html
  11809. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-draglabel-cpp.html
  11810. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-draglabel-h.html
  11811. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-dragwidget-cpp.html
  11812. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-dragwidget-h.html
  11813. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-example.html
  11814. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-fridgemagnets-pro.html
  11815. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-fridgemagnets-qrc.html
  11816. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-main-cpp.html
  11817. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-example.html
  11818. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-main-cpp.html
  11819. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-mainwindow-cpp.html
  11820. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-mainwindow-h.html
  11821. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-pieceslist-cpp.html
  11822. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-pieceslist-h.html
  11823. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzle-pro.html
  11824. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzle-qrc.html
  11825. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzlewidget-cpp.html
  11826. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzlewidget-h.html
  11827. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blureffect-cpp.html
  11828. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blureffect-h.html
  11829. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-cpp.html
  11830. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-h.html
  11831. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-pro.html
  11832. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-qrc.html
  11833. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-example.html
  11834. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-main-cpp.html
  11835. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-example.html
  11836. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-cpp.html
  11837. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-h.html
  11838. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-pro.html
  11839. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-qrc.html
  11840. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-main-cpp.html
  11841. share/doc/qt5/qtwidgets/qtwidgets-effects-lighting-example.html
  11842. share/doc/qt5/qtwidgets/qtwidgets-effects-lighting-lighting-cpp.html
  11843. share/doc/qt5/qtwidgets/qtwidgets-effects-lighting-lighting-h.html
  11844. share/doc/qt5/qtwidgets/qtwidgets-effects-lighting-lighting-pro.html
  11845. share/doc/qt5/qtwidgets/qtwidgets-effects-lighting-main-cpp.html
  11846. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-example.html
  11847. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-imagegestures-pro.html
  11848. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-imagewidget-cpp.html
  11849. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-imagewidget-h.html
  11850. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-main-cpp.html
  11851. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-mainwidget-cpp.html
  11852. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-mainwidget-h.html
  11853. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-anchorlayout-anchorlayout-pro.html
  11854. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-anchorlayout-example.html
  11855. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-anchorlayout-main-cpp.html
  11856. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-pro.html
  11857. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-qrc.html
  11858. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-example.html
  11859. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-cpp.html
  11860. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-h.html
  11861. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-main-cpp.html
  11862. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-window-cpp.html
  11863. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-window-h.html
  11864. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-3rdparty-fbm-h.html
  11865. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-boxes-pro.html
  11866. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-boxes-qrc.html
  11867. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-example.html
  11868. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glbuffers-cpp.html
  11869. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glbuffers-h.html
  11870. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glextensions-cpp.html
  11871. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glextensions-h.html
  11872. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-gltrianglemesh-h.html
  11873. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-main-cpp.html
  11874. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-qtbox-cpp.html
  11875. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-qtbox-h.html
  11876. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-roundedbox-cpp.html
  11877. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-roundedbox-h.html
  11878. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-scene-cpp.html
  11879. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-scene-h.html
  11880. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-trackball-cpp.html
  11881. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-trackball-h.html
  11882. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-chip-cpp.html
  11883. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-chip-h.html
  11884. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-chip-pro.html
  11885. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-example.html
  11886. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-images-qrc.html
  11887. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-main-cpp.html
  11888. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-mainwindow-cpp.html
  11889. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-mainwindow-h.html
  11890. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-view-cpp.html
  11891. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-view-h.html
  11892. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-collidingmice-pro.html
  11893. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-example.html
  11894. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-main-cpp.html
  11895. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-mice-qrc.html
  11896. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-mouse-cpp.html
  11897. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-mouse-h.html
  11898. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-arrow-cpp.html
  11899. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-arrow-h.html
  11900. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramitem-cpp.html
  11901. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramitem-h.html
  11902. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-cpp.html
  11903. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-h.html
  11904. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-pro.html
  11905. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-qrc.html
  11906. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramtextitem-cpp.html
  11907. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramtextitem-h.html
  11908. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-example.html
  11909. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-main-cpp.html
  11910. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-mainwindow-cpp.html
  11911. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-mainwindow-h.html
  11912. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-coloritem-cpp.html
  11913. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-coloritem-h.html
  11914. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-dragdroprobot-pro.html
  11915. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-example.html
  11916. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-main-cpp.html
  11917. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-cpp.html
  11918. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-h.html
  11919. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-qrc.html
  11920. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-edge-cpp.html
  11921. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-edge-h.html
  11922. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-elasticnodes-pro.html
  11923. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-example.html
  11924. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-graphwidget-cpp.html
  11925. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-graphwidget-h.html
  11926. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-main-cpp.html
  11927. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-node-cpp.html
  11928. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-node-h.html
  11929. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-customproxy-cpp.html
  11930. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-customproxy-h.html
  11931. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-cpp.html
  11932. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-h.html
  11933. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-ui.html
  11934. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-pro.html
  11935. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-qrc.html
  11936. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-example.html
  11937. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-main-cpp.html
  11938. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-example.html
  11939. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-cpp.html
  11940. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-h.html
  11941. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-pro.html
  11942. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-main-cpp.html
  11943. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-window-cpp.html
  11944. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-window-h.html
  11945. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-example.html
  11946. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-flippablepad-cpp.html
  11947. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-flippablepad-h.html
  11948. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-form-ui.html
  11949. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-main-cpp.html
  11950. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-cpp.html
  11951. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-h.html
  11952. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-pro.html
  11953. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-qrc.html
  11954. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-roundrectitem-cpp.html
  11955. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-roundrectitem-h.html
  11956. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-splashitem-cpp.html
  11957. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-splashitem-h.html
  11958. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-example.html
  11959. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-main-cpp.html
  11960. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-simpleanchorlayout-pro.html
  11961. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-example.html
  11962. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-main-cpp.html
  11963. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-pro.html
  11964. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-qrc.html
  11965. share/doc/qt5/qtwidgets/qtwidgets-index.html
  11966. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-adddialog-cpp.html
  11967. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-adddialog-h.html
  11968. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-addressbook-pro.html
  11969. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-addresswidget-cpp.html
  11970. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-addresswidget-h.html
  11971. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-example.html
  11972. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-main-cpp.html
  11973. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-mainwindow-cpp.html
  11974. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-mainwindow-h.html
  11975. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-newaddresstab-cpp.html
  11976. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-newaddresstab-h.html
  11977. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-tablemodel-cpp.html
  11978. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-tablemodel-h.html
  11979. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-basicsortfiltermodel-pro.html
  11980. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-example.html
  11981. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-main-cpp.html
  11982. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-window-cpp.html
  11983. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-window-h.html
  11984. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-chart-pro.html
  11985. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-chart-qrc.html
  11986. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-example.html
  11987. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-main-cpp.html
  11988. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-mainwindow-cpp.html
  11989. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-mainwindow-h.html
  11990. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-pieview-cpp.html
  11991. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-pieview-h.html
  11992. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-coloreditorfactory-pro.html
  11993. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-colorlisteditor-cpp.html
  11994. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-colorlisteditor-h.html
  11995. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-example.html
  11996. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-main-cpp.html
  11997. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-window-cpp.html
  11998. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-window-h.html
  11999. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-combowidgetmapper-pro.html
  12000. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-example.html
  12001. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-main-cpp.html
  12002. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-window-cpp.html
  12003. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-window-h.html
  12004. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-pro.html
  12005. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-qrc.html
  12006. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-example.html
  12007. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-filterwidget-cpp.html
  12008. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-filterwidget-h.html
  12009. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-main-cpp.html
  12010. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-cpp.html
  12011. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-h.html
  12012. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-window-cpp.html
  12013. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-window-h.html
  12014. share/doc/qt5/qtwidgets/qtwidgets-itemviews-dirview-dirview-pro.html
  12015. share/doc/qt5/qtwidgets/qtwidgets-itemviews-dirview-example.html
  12016. share/doc/qt5/qtwidgets/qtwidgets-itemviews-dirview-main-cpp.html
  12017. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-editabletreemodel-pro.html
  12018. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-editabletreemodel-qrc.html
  12019. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-example.html
  12020. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-main-cpp.html
  12021. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-cpp.html
  12022. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-h.html
  12023. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-ui.html
  12024. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treeitem-cpp.html
  12025. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treeitem-h.html
  12026. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treemodel-cpp.html
  12027. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treemodel-h.html
  12028. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-example.html
  12029. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-fetchmore-pro.html
  12030. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-filelistmodel-cpp.html
  12031. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-filelistmodel-h.html
  12032. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-main-cpp.html
  12033. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-window-cpp.html
  12034. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-window-h.html
  12035. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-example.html
  12036. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-freezetablewidget-cpp.html
  12037. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-freezetablewidget-h.html
  12038. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-frozencolumn-pro.html
  12039. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-grades-qrc.html
  12040. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-main-cpp.html
  12041. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-example.html
  12042. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-interview-pro.html
  12043. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-interview-qrc.html
  12044. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-main-cpp.html
  12045. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-model-cpp.html
  12046. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-model-h.html
  12047. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-example.html
  12048. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-imagemodel-cpp.html
  12049. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-imagemodel-h.html
  12050. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-images-qrc.html
  12051. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-main-cpp.html
  12052. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-mainwindow-cpp.html
  12053. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-mainwindow-h.html
  12054. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-pixelator-pro.html
  12055. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-pixeldelegate-cpp.html
  12056. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-pixeldelegate-h.html
  12057. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-example.html
  12058. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-main-cpp.html
  12059. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-mainwindow-cpp.html
  12060. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-mainwindow-h.html
  12061. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-piecesmodel-cpp.html
  12062. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-piecesmodel-h.html
  12063. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzle-pro.html
  12064. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzle-qrc.html
  12065. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzlewidget-cpp.html
  12066. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzlewidget-h.html
  12067. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-domitem-cpp.html
  12068. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-domitem-h.html
  12069. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-dommodel-cpp.html
  12070. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-dommodel-h.html
  12071. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-example.html
  12072. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-main-cpp.html
  12073. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-mainwindow-cpp.html
  12074. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-mainwindow-h.html
  12075. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-simpledommodel-pro.html
  12076. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-example.html
  12077. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-main-cpp.html
  12078. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-simpletreemodel-pro.html
  12079. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-simpletreemodel-qrc.html
  12080. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treeitem-cpp.html
  12081. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treeitem-h.html
  12082. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treemodel-cpp.html
  12083. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treemodel-h.html
  12084. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-example.html
  12085. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-main-cpp.html
  12086. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-simplewidgetmapper-pro.html
  12087. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-window-cpp.html
  12088. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-window-h.html
  12089. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-delegate-cpp.html
  12090. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-delegate-h.html
  12091. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-example.html
  12092. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-main-cpp.html
  12093. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-spinboxdelegate-pro.html
  12094. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-example.html
  12095. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-main-cpp.html
  12096. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-printview-cpp.html
  12097. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-printview-h.html
  12098. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-cpp.html
  12099. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-h.html
  12100. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-pro.html
  12101. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-qrc.html
  12102. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-cpp.html
  12103. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-h.html
  12104. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetitem-cpp.html
  12105. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetitem-h.html
  12106. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-example.html
  12107. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-main-cpp.html
  12108. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-cpp.html
  12109. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-h.html
  12110. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-pro.html
  12111. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stareditor-cpp.html
  12112. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stareditor-h.html
  12113. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-starrating-cpp.html
  12114. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-starrating-h.html
  12115. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-basiclayouts-pro.html
  12116. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-dialog-cpp.html
  12117. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-dialog-h.html
  12118. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-example.html
  12119. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-main-cpp.html
  12120. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-cpp.html
  12121. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-h.html
  12122. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-pro.html
  12123. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-example.html
  12124. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-main-cpp.html
  12125. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-window-cpp.html
  12126. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-window-h.html
  12127. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-dialog-cpp.html
  12128. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-dialog-h.html
  12129. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-dynamiclayouts-pro.html
  12130. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-example.html
  12131. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-main-cpp.html
  12132. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-example.html
  12133. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-cpp.html
  12134. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-h.html
  12135. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-pro.html
  12136. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-main-cpp.html
  12137. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-window-cpp.html
  12138. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-window-h.html
  12139. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-application-pro.html
  12140. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-application-qrc.html
  12141. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-example.html
  12142. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-main-cpp.html
  12143. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-mainwindow-cpp.html
  12144. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-mainwindow-h.html
  12145. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-dockwidgets-pro.html
  12146. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-dockwidgets-qrc.html
  12147. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-example.html
  12148. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-main-cpp.html
  12149. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-mainwindow-cpp.html
  12150. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-mainwindow-h.html
  12151. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-colorswatch-cpp.html
  12152. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-colorswatch-h.html
  12153. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-example.html
  12154. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-main-cpp.html
  12155. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-cpp.html
  12156. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-h.html
  12157. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-pro.html
  12158. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-qrc.html
  12159. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-toolbar-cpp.html
  12160. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-toolbar-h.html
  12161. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-example.html
  12162. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-main-cpp.html
  12163. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mainwindow-cpp.html
  12164. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mainwindow-h.html
  12165. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdi-pro.html
  12166. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdi-qrc.html
  12167. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdichild-cpp.html
  12168. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdichild-h.html
  12169. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-example.html
  12170. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-main-cpp.html
  12171. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-mainwindow-cpp.html
  12172. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-mainwindow-h.html
  12173. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-menus-pro.html
  12174. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-example.html
  12175. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-main-cpp.html
  12176. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-mainwindow-cpp.html
  12177. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-mainwindow-h.html
  12178. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-sdi-pro.html
  12179. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-sdi-qrc.html
  12180. share/doc/qt5/qtwidgets/qtwidgets-module.html
  12181. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-affine-pro.html
  12182. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-affine-qrc.html
  12183. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-example.html
  12184. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-main-cpp.html
  12185. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-xform-cpp.html
  12186. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-xform-h.html
  12187. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-basicdrawing-pro.html
  12188. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-basicdrawing-qrc.html
  12189. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-example.html
  12190. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-main-cpp.html
  12191. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-renderarea-cpp.html
  12192. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-renderarea-h.html
  12193. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-window-cpp.html
  12194. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-window-h.html
  12195. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-cpp.html
  12196. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-h.html
  12197. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-pro.html
  12198. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-qrc.html
  12199. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-example.html
  12200. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-main-cpp.html
  12201. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-circlewidget-cpp.html
  12202. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-circlewidget-h.html
  12203. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-concentriccircles-pro.html
  12204. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-example.html
  12205. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-main-cpp.html
  12206. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-window-cpp.html
  12207. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-window-h.html
  12208. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-deform-pro.html
  12209. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-deform-qrc.html
  12210. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-example.html
  12211. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-main-cpp.html
  12212. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-pathdeform-cpp.html
  12213. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-pathdeform-h.html
  12214. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-example.html
  12215. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-fontsampler-pro.html
  12216. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-main-cpp.html
  12217. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-mainwindow-cpp.html
  12218. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-mainwindow-h.html
  12219. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-mainwindowbase-ui.html
  12220. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-example.html
  12221. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-cpp.html
  12222. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-h.html
  12223. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-pro.html
  12224. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-qrc.html
  12225. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-main-cpp.html
  12226. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-example.html
  12227. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposer-cpp.html
  12228. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposer-h.html
  12229. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposition-pro.html
  12230. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposition-qrc.html
  12231. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-main-cpp.html
  12232. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-example.html
  12233. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-main-cpp.html
  12234. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-painterpaths-pro.html
  12235. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-renderarea-cpp.html
  12236. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-renderarea-h.html
  12237. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-window-cpp.html
  12238. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-window-h.html
  12239. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-example.html
  12240. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-main-cpp.html
  12241. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-cpp.html
  12242. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-h.html
  12243. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-pro.html
  12244. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-qrc.html
  12245. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-example.html
  12246. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-main-cpp.html
  12247. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-renderarea-cpp.html
  12248. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-renderarea-h.html
  12249. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-transformations-pro.html
  12250. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-window-cpp.html
  12251. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-window-h.html
  12252. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-calendar-pro.html
  12253. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-example.html
  12254. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-main-cpp.html
  12255. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-mainwindow-cpp.html
  12256. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-mainwindow-h.html
  12257. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-detailsdialog-cpp.html
  12258. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-detailsdialog-h.html
  12259. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-example.html
  12260. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-main-cpp.html
  12261. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-mainwindow-cpp.html
  12262. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-mainwindow-h.html
  12263. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-orderform-pro.html
  12264. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-example.html
  12265. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-highlighter-cpp.html
  12266. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-highlighter-h.html
  12267. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-main-cpp.html
  12268. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-mainwindow-cpp.html
  12269. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-mainwindow-h.html
  12270. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-syntaxhighlighter-pro.html
  12271. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-example.html
  12272. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-main-cpp.html
  12273. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-cpp.html
  12274. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-h.html
  12275. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-pro.html
  12276. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-qrc.html
  12277. share/doc/qt5/qtwidgets/qtwidgets-statemachine-eventtransitions-eventtransitions-pro.html
  12278. share/doc/qt5/qtwidgets/qtwidgets-statemachine-eventtransitions-example.html
  12279. share/doc/qt5/qtwidgets/qtwidgets-statemachine-eventtransitions-main-cpp.html
  12280. share/doc/qt5/qtwidgets/qtwidgets-statemachine-factorial-example.html
  12281. share/doc/qt5/qtwidgets/qtwidgets-statemachine-factorial-factorial-pro.html
  12282. share/doc/qt5/qtwidgets/qtwidgets-statemachine-factorial-main-cpp.html
  12283. share/doc/qt5/qtwidgets/qtwidgets-statemachine-pingpong-example.html
  12284. share/doc/qt5/qtwidgets/qtwidgets-statemachine-pingpong-main-cpp.html
  12285. share/doc/qt5/qtwidgets/qtwidgets-statemachine-pingpong-pingpong-pro.html
  12286. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-example.html
  12287. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-main-cpp.html
  12288. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-movementtransition-h.html
  12289. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-rogue-pro.html
  12290. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-window-cpp.html
  12291. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-window-h.html
  12292. share/doc/qt5/qtwidgets/qtwidgets-statemachine-trafficlight-example.html
  12293. share/doc/qt5/qtwidgets/qtwidgets-statemachine-trafficlight-main-cpp.html
  12294. share/doc/qt5/qtwidgets/qtwidgets-statemachine-trafficlight-trafficlight-pro.html
  12295. share/doc/qt5/qtwidgets/qtwidgets-statemachine-twowaybutton-example.html
  12296. share/doc/qt5/qtwidgets/qtwidgets-statemachine-twowaybutton-main-cpp.html
  12297. share/doc/qt5/qtwidgets/qtwidgets-statemachine-twowaybutton-twowaybutton-pro.html
  12298. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-codecs-pro.html
  12299. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-example.html
  12300. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-main-cpp.html
  12301. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-mainwindow-cpp.html
  12302. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-mainwindow-h.html
  12303. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-previewform-cpp.html
  12304. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-previewform-h.html
  12305. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-completer-pro.html
  12306. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-completer-qrc.html
  12307. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-example.html
  12308. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-fsmodel-cpp.html
  12309. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-fsmodel-h.html
  12310. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-main-cpp.html
  12311. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-mainwindow-cpp.html
  12312. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-mainwindow-h.html
  12313. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-customcompleter-pro.html
  12314. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-customcompleter-qrc.html
  12315. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-example.html
  12316. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-main-cpp.html
  12317. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-mainwindow-cpp.html
  12318. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-mainwindow-h.html
  12319. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-textedit-cpp.html
  12320. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-textedit-h.html
  12321. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echoplugin-pro.html
  12322. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echointerface-h.html
  12323. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-cpp.html
  12324. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-h.html
  12325. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-pro.html
  12326. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-main-cpp.html
  12327. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-example.html
  12328. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-plugin-echoplugin-cpp.html
  12329. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-plugin-echoplugin-h.html
  12330. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-plugin-plugin-pro.html
  12331. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-example.html
  12332. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-i18n-pro.html
  12333. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-i18n-qrc.html
  12334. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-languagechooser-cpp.html
  12335. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-languagechooser-h.html
  12336. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-main-cpp.html
  12337. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-mainwindow-cpp.html
  12338. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-mainwindow-h.html
  12339. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-app-pro.html
  12340. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-example.html
  12341. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-interfaces-h.html
  12342. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-main-cpp.html
  12343. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-mainwindow-cpp.html
  12344. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-mainwindow-h.html
  12345. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-paintarea-cpp.html
  12346. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-paintarea-h.html
  12347. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-plugindialog-cpp.html
  12348. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-plugindialog-h.html
  12349. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictools-pro.html
  12350. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-cpp.html
  12351. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-h.html
  12352. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-example.html
  12353. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-example.html
  12354. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafilters-pro.html
  12355. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-cpp.html
  12356. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-h.html
  12357. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-example.html
  12358. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-main-cpp.html
  12359. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-regexp-pro.html
  12360. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-regexpdialog-cpp.html
  12361. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-regexpdialog-h.html
  12362. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-example.html
  12363. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-main-cpp.html
  12364. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpression-pro.html
  12365. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpression-qrc.html
  12366. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpressiondialog-cpp.html
  12367. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpressiondialog-h.html
  12368. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-example.html
  12369. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-locationdialog-cpp.html
  12370. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-locationdialog-h.html
  12371. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-main-cpp.html
  12372. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-mainwindow-cpp.html
  12373. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-mainwindow-h.html
  12374. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-settingseditor-pro.html
  12375. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-settingstree-cpp.html
  12376. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-settingstree-h.html
  12377. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-variantdelegate-cpp.html
  12378. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-variantdelegate-h.html
  12379. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-example.html
  12380. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-plugin-pro.html
  12381. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyle-cpp.html
  12382. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyle-h.html
  12383. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyleplugin-cpp.html
  12384. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyleplugin-h.html
  12385. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-styleplugin-pro.html
  12386. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-main-cpp.html
  12387. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-cpp.html
  12388. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-h.html
  12389. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-pro.html
  12390. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-example.html
  12391. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-main-cpp.html
  12392. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-mainwindow-cpp.html
  12393. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-mainwindow-h.html
  12394. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-cpp.html
  12395. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-h.html
  12396. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-pro.html
  12397. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-qrc.html
  12398. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-commands-cpp.html
  12399. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-commands-h.html
  12400. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-document-cpp.html
  12401. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-document-h.html
  12402. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-example.html
  12403. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-main-cpp.html
  12404. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-mainwindow-cpp.html
  12405. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-mainwindow-h.html
  12406. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-mainwindow-ui.html
  12407. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-undo-pro.html
  12408. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-undo-qrc.html
  12409. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-commands-cpp.html
  12410. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-commands-h.html
  12411. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramitem-cpp.html
  12412. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramitem-h.html
  12413. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramscene-cpp.html
  12414. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramscene-h.html
  12415. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-example.html
  12416. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-main-cpp.html
  12417. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-mainwindow-cpp.html
  12418. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-mainwindow-h.html
  12419. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-undoframework-pro.html
  12420. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-undoframework-qrc.html
  12421. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-addressbook-cpp.html
  12422. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-addressbook-h.html
  12423. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-example.html
  12424. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-main-cpp.html
  12425. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-part1-pro.html
  12426. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-addressbook-cpp.html
  12427. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-addressbook-h.html
  12428. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-example.html
  12429. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-main-cpp.html
  12430. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-part2-pro.html
  12431. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-addressbook-cpp.html
  12432. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-addressbook-h.html
  12433. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-example.html
  12434. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-main-cpp.html
  12435. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-part3-pro.html
  12436. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-addressbook-cpp.html
  12437. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-addressbook-h.html
  12438. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-example.html
  12439. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-main-cpp.html
  12440. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-part4-pro.html
  12441. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-addressbook-cpp.html
  12442. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-addressbook-h.html
  12443. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-example.html
  12444. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-finddialog-cpp.html
  12445. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-finddialog-h.html
  12446. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-main-cpp.html
  12447. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-part5-pro.html
  12448. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-addressbook-cpp.html
  12449. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-addressbook-h.html
  12450. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-example.html
  12451. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-finddialog-cpp.html
  12452. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-finddialog-h.html
  12453. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-main-cpp.html
  12454. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-part6-pro.html
  12455. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-addressbook-cpp.html
  12456. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-addressbook-h.html
  12457. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-example.html
  12458. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-finddialog-cpp.html
  12459. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-finddialog-h.html
  12460. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-main-cpp.html
  12461. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-part7-pro.html
  12462. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-childwidget-childwidget-pro.html
  12463. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-childwidget-example.html
  12464. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-childwidget-main-cpp.html
  12465. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-example.html
  12466. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-main-cpp.html
  12467. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-nestedlayouts-pro.html
  12468. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-toplevel-example.html
  12469. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-toplevel-main-cpp.html
  12470. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-toplevel-toplevel-pro.html
  12471. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-example.html
  12472. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-main-cpp.html
  12473. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-windowlayout-pro.html
  12474. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-analogclock-cpp.html
  12475. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-analogclock-h.html
  12476. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-analogclock-pro.html
  12477. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-example.html
  12478. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-main-cpp.html
  12479. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-button-cpp.html
  12480. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-button-h.html
  12481. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-calculator-cpp.html
  12482. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-calculator-h.html
  12483. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-calculator-pro.html
  12484. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-example.html
  12485. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-main-cpp.html
  12486. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-calendarwidget-pro.html
  12487. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-example.html
  12488. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-main-cpp.html
  12489. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-window-cpp.html
  12490. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-window-h.html
  12491. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-charactermap-pro.html
  12492. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-characterwidget-cpp.html
  12493. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-characterwidget-h.html
  12494. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-example.html
  12495. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-main-cpp.html
  12496. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-mainwindow-cpp.html
  12497. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-mainwindow-h.html
  12498. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-cpp.html
  12499. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-h.html
  12500. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-pro.html
  12501. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-example.html
  12502. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-main-cpp.html
  12503. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-cpp.html
  12504. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-h.html
  12505. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-pro.html
  12506. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-example.html
  12507. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-main-cpp.html
  12508. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-cpp.html
  12509. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-h.html
  12510. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-pro.html
  12511. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-example.html
  12512. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-main-cpp.html
  12513. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-testwidget-cpp.html
  12514. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-testwidget-h.html
  12515. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-example.html
  12516. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-groupbox-pro.html
  12517. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-main-cpp.html
  12518. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-window-cpp.html
  12519. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-window-h.html
  12520. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-example.html
  12521. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconpreviewarea-cpp.html
  12522. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconpreviewarea-h.html
  12523. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-icons-pro.html
  12524. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconsizespinbox-cpp.html
  12525. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconsizespinbox-h.html
  12526. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-imagedelegate-cpp.html
  12527. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-imagedelegate-h.html
  12528. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-main-cpp.html
  12529. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-mainwindow-cpp.html
  12530. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-mainwindow-h.html
  12531. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-example.html
  12532. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-cpp.html
  12533. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-h.html
  12534. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-pro.html
  12535. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-main-cpp.html
  12536. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-example.html
  12537. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-lineedits-pro.html
  12538. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-main-cpp.html
  12539. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-window-cpp.html
  12540. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-window-h.html
  12541. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-buttontester-cpp.html
  12542. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-buttontester-h.html
  12543. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-example.html
  12544. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-main-cpp.html
  12545. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-mousebuttons-pro.html
  12546. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-example.html
  12547. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-main-cpp.html
  12548. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-movie-pro.html
  12549. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-movieplayer-cpp.html
  12550. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-movieplayer-h.html
  12551. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-example.html
  12552. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-main-cpp.html
  12553. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-mainwindow-cpp.html
  12554. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-mainwindow-h.html
  12555. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-scribble-pro.html
  12556. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-scribblearea-cpp.html
  12557. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-scribblearea-h.html
  12558. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-example.html
  12559. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-main-cpp.html
  12560. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-cpp.html
  12561. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-h.html
  12562. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-pro.html
  12563. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-example.html
  12564. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-main-cpp.html
  12565. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-sliders-pro.html
  12566. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-slidersgroup-cpp.html
  12567. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-slidersgroup-h.html
  12568. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-window-cpp.html
  12569. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-window-h.html
  12570. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-example.html
  12571. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-main-cpp.html
  12572. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-spinboxes-pro.html
  12573. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-window-cpp.html
  12574. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-window-h.html
  12575. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-example.html
  12576. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-main-cpp.html
  12577. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-norwegianwoodstyle-cpp.html
  12578. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-norwegianwoodstyle-h.html
  12579. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-styles-pro.html
  12580. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-styles-qrc.html
  12581. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-widgetgallery-cpp.html
  12582. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-widgetgallery-h.html
  12583. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-example.html
  12584. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-layouts-default-ui.html
  12585. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-layouts-pagefold-ui.html
  12586. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-main-cpp.html
  12587. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-cpp.html
  12588. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-h.html
  12589. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-ui.html
  12590. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheet-pro.html
  12591. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheet-qrc.html
  12592. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-cpp.html
  12593. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-h.html
  12594. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-ui.html
  12595. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-example.html
  12596. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-images-qrc.html
  12597. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-main-cpp.html
  12598. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-mainwindow-cpp.html
  12599. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-mainwindow-h.html
  12600. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tablet-pro.html
  12601. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletapplication-cpp.html
  12602. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletapplication-h.html
  12603. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletcanvas-cpp.html
  12604. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletcanvas-h.html
  12605. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-example.html
  12606. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-main-cpp.html
  12607. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrix-pro.html
  12608. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixboard-cpp.html
  12609. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixboard-h.html
  12610. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixpiece-cpp.html
  12611. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixpiece-h.html
  12612. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixwindow-cpp.html
  12613. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixwindow-h.html
  12614. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-example.html
  12615. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-main-cpp.html
  12616. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-shapeitem-cpp.html
  12617. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-shapeitem-h.html
  12618. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-sortingbox-cpp.html
  12619. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-sortingbox-h.html
  12620. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-tooltips-pro.html
  12621. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-tooltips-qrc.html
  12622. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-example.html
  12623. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-ledwidget-cpp.html
  12624. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-ledwidget-h.html
  12625. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-localeselector-cpp.html
  12626. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-localeselector-h.html
  12627. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-main-cpp.html
  12628. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-validators-pro.html
  12629. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-validators-qrc.html
  12630. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-validators-ui.html
  12631. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-dialog-cpp.html
  12632. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-dialog-h.html
  12633. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-example.html
  12634. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-main-cpp.html
  12635. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-wiggly-pro.html
  12636. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-wigglywidget-cpp.html
  12637. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-wigglywidget-h.html
  12638. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-controllerwindow-cpp.html
  12639. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-controllerwindow-h.html
  12640. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-example.html
  12641. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-main-cpp.html
  12642. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-previewwindow-cpp.html
  12643. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-previewwindow-h.html
  12644. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-windowflags-pro.html
  12645. share/doc/qt5/qtwidgets/qtwidgets.index
  12646. share/doc/qt5/qtwidgets/qtwidgets.qhp
  12647. share/doc/qt5/qtwidgets/qtwidgets.qhp.sha1
  12648. share/doc/qt5/qtwidgets/qtwidgets.tags
  12649. share/doc/qt5/qtwidgets/qundocommand-members.html
  12650. share/doc/qt5/qtwidgets/qundocommand.html
  12651. share/doc/qt5/qtwidgets/qundogroup-members.html
  12652. share/doc/qt5/qtwidgets/qundogroup.html
  12653. share/doc/qt5/qtwidgets/qundostack-members.html
  12654. share/doc/qt5/qtwidgets/qundostack.html
  12655. share/doc/qt5/qtwidgets/qundoview-members.html
  12656. share/doc/qt5/qtwidgets/qundoview.html
  12657. share/doc/qt5/qtwidgets/qvboxlayout-members.html
  12658. share/doc/qt5/qtwidgets/qvboxlayout.html
  12659. share/doc/qt5/qtwidgets/qwhatsthis-members.html
  12660. share/doc/qt5/qtwidgets/qwhatsthis.html
  12661. share/doc/qt5/qtwidgets/qwidget-members.html
  12662. share/doc/qt5/qtwidgets/qwidget-obsolete.html
  12663. share/doc/qt5/qtwidgets/qwidget-styling.html
  12664. share/doc/qt5/qtwidgets/qwidget.html
  12665. share/doc/qt5/qtwidgets/qwidgetaction-members.html
  12666. share/doc/qt5/qtwidgets/qwidgetaction.html
  12667. share/doc/qt5/qtwidgets/qwidgetitem-members.html
  12668. share/doc/qt5/qtwidgets/qwidgetitem.html
  12669. share/doc/qt5/qtwidgets/qwizard-members.html
  12670. share/doc/qt5/qtwidgets/qwizard.html
  12671. share/doc/qt5/qtwidgets/qwizardpage-members.html
  12672. share/doc/qt5/qtwidgets/qwizardpage.html
  12673. share/doc/qt5/qtwidgets/standard-dialogs.html
  12674. share/doc/qt5/qtwidgets/style-reference.html
  12675. share/doc/qt5/qtwidgets/style/offline-simple.css
  12676. share/doc/qt5/qtwidgets/style/offline.css
  12677. share/doc/qt5/qtwidgets/stylesheet-customizing.html
  12678. share/doc/qt5/qtwidgets/stylesheet-designer.html
  12679. share/doc/qt5/qtwidgets/stylesheet-examples.html
  12680. share/doc/qt5/qtwidgets/stylesheet-reference.html
  12681. share/doc/qt5/qtwidgets/stylesheet-syntax.html
  12682. share/doc/qt5/qtwidgets/stylesheet.html
  12683. share/doc/qt5/qtwidgets/textedit-example.html
  12684. share/doc/qt5/qtwidgets/tutorials-addressbook.html
  12685. share/doc/qt5/qtwidgets/widget-classes.html
  12686. share/doc/qt5/qtwidgets/widgets-tutorial.html
  12687. share/doc/qt5/qtwinextras.qch
  12688. share/doc/qt5/qtwinextras/examples-manifest.xml
  12689. share/doc/qt5/qtwinextras/examples-qtwinextras.html
  12690. share/doc/qt5/qtwinextras/images/arrow_bc.png
  12691. share/doc/qt5/qtwinextras/images/bgrContent.png
  12692. share/doc/qt5/qtwinextras/images/btn_next.png
  12693. share/doc/qt5/qtwinextras/images/btn_prev.png
  12694. share/doc/qt5/qtwinextras/images/bullet_dn.png
  12695. share/doc/qt5/qtwinextras/images/bullet_sq.png
  12696. share/doc/qt5/qtwinextras/images/glass.png
  12697. share/doc/qt5/qtwinextras/images/home.png
  12698. share/doc/qt5/qtwinextras/images/ico_note.png
  12699. share/doc/qt5/qtwinextras/images/ico_note_attention.png
  12700. share/doc/qt5/qtwinextras/images/ico_out.png
  12701. share/doc/qt5/qtwinextras/images/jumplist.png
  12702. share/doc/qt5/qtwinextras/images/logo.png
  12703. share/doc/qt5/qtwinextras/images/peek-on.png
  12704. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-composited.png
  12705. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-non-composited.png
  12706. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-taskbar.png
  12707. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-thumbnail.png
  12708. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-composited.png
  12709. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-non-composited.png
  12710. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-taskbar.png
  12711. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-thumbnail.png
  12712. share/doc/qt5/qtwinextras/images/taskbar-button.png
  12713. share/doc/qt5/qtwinextras/images/taskbar-progress-indeterminate.png
  12714. share/doc/qt5/qtwinextras/images/taskbar-progress-paused.png
  12715. share/doc/qt5/qtwinextras/images/taskbar-progress-stopped.png
  12716. share/doc/qt5/qtwinextras/images/taskbar-progress.png
  12717. share/doc/qt5/qtwinextras/images/thumbbar.png
  12718. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-pause-16.png
  12719. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-pause-32.png
  12720. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-play-16.png
  12721. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-play-32.png
  12722. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-seek-backward-32.png
  12723. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-seek-forward-32.png
  12724. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-stop-32.png
  12725. share/doc/qt5/qtwinextras/qml-qtwinextras-dwmfeatures-members.html
  12726. share/doc/qt5/qtwinextras/qml-qtwinextras-dwmfeatures.html
  12727. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplist-members.html
  12728. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplist.html
  12729. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistcategory-members.html
  12730. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistcategory.html
  12731. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistdestination-members.html
  12732. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistdestination.html
  12733. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistlink-members.html
  12734. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistlink.html
  12735. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistseparator-members.html
  12736. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistseparator.html
  12737. share/doc/qt5/qtwinextras/qml-qtwinextras-taskbarbutton-members.html
  12738. share/doc/qt5/qtwinextras/qml-qtwinextras-taskbarbutton.html
  12739. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbar-members.html
  12740. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbar.html
  12741. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbutton-members.html
  12742. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbutton.html
  12743. share/doc/qt5/qtwinextras/qtwin.html
  12744. share/doc/qt5/qtwinextras/qtwinextras-iconextractor-example.html
  12745. share/doc/qt5/qtwinextras/qtwinextras-iconextractor-iconextractor-pro.html
  12746. share/doc/qt5/qtwinextras/qtwinextras-iconextractor-main-cpp.html
  12747. share/doc/qt5/qtwinextras/qtwinextras-index.html
  12748. share/doc/qt5/qtwinextras/qtwinextras-module.html
  12749. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-example.html
  12750. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-main-cpp.html
  12751. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-musicplayer-cpp.html
  12752. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-musicplayer-h.html
  12753. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-musicplayer-pro.html
  12754. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-volumebutton-cpp.html
  12755. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-volumebutton-h.html
  12756. share/doc/qt5/qtwinextras/qtwinextras-overview.html
  12757. share/doc/qt5/qtwinextras/qtwinextras-qmlmodule.html
  12758. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-example.html
  12759. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-main-cpp.html
  12760. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-qml-main-qml.html
  12761. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-quickplayer-pro.html
  12762. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-quickplayer-qrc.html
  12763. share/doc/qt5/qtwinextras/qtwinextras.index
  12764. share/doc/qt5/qtwinextras/qtwinextras.qhp
  12765. share/doc/qt5/qtwinextras/qtwinextras.qhp.sha1
  12766. share/doc/qt5/qtwinextras/qwinjumplist-members.html
  12767. share/doc/qt5/qtwinextras/qwinjumplist.html
  12768. share/doc/qt5/qtwinextras/qwinjumplistcategory-members.html
  12769. share/doc/qt5/qtwinextras/qwinjumplistcategory.html
  12770. share/doc/qt5/qtwinextras/qwinjumplistitem-members.html
  12771. share/doc/qt5/qtwinextras/qwinjumplistitem.html
  12772. share/doc/qt5/qtwinextras/qwinmime-members.html
  12773. share/doc/qt5/qtwinextras/qwinmime.html
  12774. share/doc/qt5/qtwinextras/qwintaskbarbutton-members.html
  12775. share/doc/qt5/qtwinextras/qwintaskbarbutton.html
  12776. share/doc/qt5/qtwinextras/qwintaskbarprogress-members.html
  12777. share/doc/qt5/qtwinextras/qwintaskbarprogress.html
  12778. share/doc/qt5/qtwinextras/qwinthumbnailtoolbar-members.html
  12779. share/doc/qt5/qtwinextras/qwinthumbnailtoolbar.html
  12780. share/doc/qt5/qtwinextras/qwinthumbnailtoolbutton-members.html
  12781. share/doc/qt5/qtwinextras/qwinthumbnailtoolbutton.html
  12782. share/doc/qt5/qtwinextras/style/offline-simple.css
  12783. share/doc/qt5/qtwinextras/style/offline.css
  12784. share/doc/qt5/qtx11extras.qch
  12785. share/doc/qt5/qtx11extras/images/arrow_bc.png
  12786. share/doc/qt5/qtx11extras/images/bgrContent.png
  12787. share/doc/qt5/qtx11extras/images/btn_next.png
  12788. share/doc/qt5/qtx11extras/images/btn_prev.png
  12789. share/doc/qt5/qtx11extras/images/bullet_dn.png
  12790. share/doc/qt5/qtx11extras/images/bullet_sq.png
  12791. share/doc/qt5/qtx11extras/images/home.png
  12792. share/doc/qt5/qtx11extras/images/ico_note.png
  12793. share/doc/qt5/qtx11extras/images/ico_note_attention.png
  12794. share/doc/qt5/qtx11extras/images/ico_out.png
  12795. share/doc/qt5/qtx11extras/images/logo.png
  12796. share/doc/qt5/qtx11extras/qtx11extras-index.html
  12797. share/doc/qt5/qtx11extras/qtx11extras-module.html
  12798. share/doc/qt5/qtx11extras/qtx11extras.index
  12799. share/doc/qt5/qtx11extras/qtx11extras.qhp
  12800. share/doc/qt5/qtx11extras/qtx11extras.qhp.sha1
  12801. share/doc/qt5/qtx11extras/qx11info-members.html
  12802. share/doc/qt5/qtx11extras/qx11info.html
  12803. share/doc/qt5/qtx11extras/style/offline-simple.css
  12804. share/doc/qt5/qtx11extras/style/offline.css
  12805. share/doc/qt5/qtxml.qch
  12806. share/doc/qt5/qtxml/examples-manifest.xml
  12807. share/doc/qt5/qtxml/images/arrow_bc.png
  12808. share/doc/qt5/qtxml/images/bgrContent.png
  12809. share/doc/qt5/qtxml/images/btn_next.png
  12810. share/doc/qt5/qtxml/images/btn_prev.png
  12811. share/doc/qt5/qtxml/images/bullet_dn.png
  12812. share/doc/qt5/qtxml/images/bullet_sq.png
  12813. share/doc/qt5/qtxml/images/dombookmarks-example.png
  12814. share/doc/qt5/qtxml/images/home.png
  12815. share/doc/qt5/qtxml/images/ico_note.png
  12816. share/doc/qt5/qtxml/images/ico_note_attention.png
  12817. share/doc/qt5/qtxml/images/ico_out.png
  12818. share/doc/qt5/qtxml/images/logo.png
  12819. share/doc/qt5/qtxml/images/saxbookmarks-example.png
  12820. share/doc/qt5/qtxml/images/xmlstreamexample-filemenu.png
  12821. share/doc/qt5/qtxml/images/xmlstreamexample-helpmenu.png
  12822. share/doc/qt5/qtxml/images/xmlstreamexample-screenshot.png
  12823. share/doc/qt5/qtxml/qdomattr-members.html
  12824. share/doc/qt5/qtxml/qdomattr.html
  12825. share/doc/qt5/qtxml/qdomcdatasection-members.html
  12826. share/doc/qt5/qtxml/qdomcdatasection.html
  12827. share/doc/qt5/qtxml/qdomcharacterdata-members.html
  12828. share/doc/qt5/qtxml/qdomcharacterdata.html
  12829. share/doc/qt5/qtxml/qdomcomment-members.html
  12830. share/doc/qt5/qtxml/qdomcomment.html
  12831. share/doc/qt5/qtxml/qdomdocument-members.html
  12832. share/doc/qt5/qtxml/qdomdocument.html
  12833. share/doc/qt5/qtxml/qdomdocumentfragment-members.html
  12834. share/doc/qt5/qtxml/qdomdocumentfragment.html
  12835. share/doc/qt5/qtxml/qdomdocumenttype-members.html
  12836. share/doc/qt5/qtxml/qdomdocumenttype.html
  12837. share/doc/qt5/qtxml/qdomelement-members.html
  12838. share/doc/qt5/qtxml/qdomelement.html
  12839. share/doc/qt5/qtxml/qdomentity-members.html
  12840. share/doc/qt5/qtxml/qdomentity.html
  12841. share/doc/qt5/qtxml/qdomentityreference-members.html
  12842. share/doc/qt5/qtxml/qdomentityreference.html
  12843. share/doc/qt5/qtxml/qdomimplementation-members.html
  12844. share/doc/qt5/qtxml/qdomimplementation.html
  12845. share/doc/qt5/qtxml/qdomnamednodemap-members.html
  12846. share/doc/qt5/qtxml/qdomnamednodemap.html
  12847. share/doc/qt5/qtxml/qdomnode-members.html
  12848. share/doc/qt5/qtxml/qdomnode.html
  12849. share/doc/qt5/qtxml/qdomnodelist-members.html
  12850. share/doc/qt5/qtxml/qdomnodelist.html
  12851. share/doc/qt5/qtxml/qdomnotation-members.html
  12852. share/doc/qt5/qtxml/qdomnotation.html
  12853. share/doc/qt5/qtxml/qdomprocessinginstruction-members.html
  12854. share/doc/qt5/qtxml/qdomprocessinginstruction.html
  12855. share/doc/qt5/qtxml/qdomtext-members.html
  12856. share/doc/qt5/qtxml/qdomtext.html
  12857. share/doc/qt5/qtxml/qtxml-dombookmarks-dombookmarks-pro.html
  12858. share/doc/qt5/qtxml/qtxml-dombookmarks-example.html
  12859. share/doc/qt5/qtxml/qtxml-dombookmarks-main-cpp.html
  12860. share/doc/qt5/qtxml/qtxml-dombookmarks-mainwindow-cpp.html
  12861. share/doc/qt5/qtxml/qtxml-dombookmarks-mainwindow-h.html
  12862. share/doc/qt5/qtxml/qtxml-dombookmarks-xbeltree-cpp.html
  12863. share/doc/qt5/qtxml/qtxml-dombookmarks-xbeltree-h.html
  12864. share/doc/qt5/qtxml/qtxml-index.html
  12865. share/doc/qt5/qtxml/qtxml-module.html
  12866. share/doc/qt5/qtxml/qtxml-saxbookmarks-example.html
  12867. share/doc/qt5/qtxml/qtxml-saxbookmarks-main-cpp.html
  12868. share/doc/qt5/qtxml/qtxml-saxbookmarks-mainwindow-cpp.html
  12869. share/doc/qt5/qtxml/qtxml-saxbookmarks-mainwindow-h.html
  12870. share/doc/qt5/qtxml/qtxml-saxbookmarks-saxbookmarks-pro.html
  12871. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelgenerator-cpp.html
  12872. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelgenerator-h.html
  12873. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelhandler-cpp.html
  12874. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelhandler-h.html
  12875. share/doc/qt5/qtxml/qtxml-streambookmarks-example.html
  12876. share/doc/qt5/qtxml/qtxml-streambookmarks-main-cpp.html
  12877. share/doc/qt5/qtxml/qtxml-streambookmarks-mainwindow-cpp.html
  12878. share/doc/qt5/qtxml/qtxml-streambookmarks-mainwindow-h.html
  12879. share/doc/qt5/qtxml/qtxml-streambookmarks-streambookmarks-pro.html
  12880. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelreader-cpp.html
  12881. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelreader-h.html
  12882. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelwriter-cpp.html
  12883. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelwriter-h.html
  12884. share/doc/qt5/qtxml/qtxml-xmlstreamlint-example.html
  12885. share/doc/qt5/qtxml/qtxml-xmlstreamlint-main-cpp.html
  12886. share/doc/qt5/qtxml/qtxml-xmlstreamlint-xmlstreamlint-pro.html
  12887. share/doc/qt5/qtxml/qtxml.index
  12888. share/doc/qt5/qtxml/qtxml.qhp
  12889. share/doc/qt5/qtxml/qtxml.qhp.sha1
  12890. share/doc/qt5/qtxml/qtxml.tags
  12891. share/doc/qt5/qtxml/qxmlattributes-members.html
  12892. share/doc/qt5/qtxml/qxmlattributes.html
  12893. share/doc/qt5/qtxml/qxmlcontenthandler-members.html
  12894. share/doc/qt5/qtxml/qxmlcontenthandler.html
  12895. share/doc/qt5/qtxml/qxmldeclhandler-members.html
  12896. share/doc/qt5/qtxml/qxmldeclhandler.html
  12897. share/doc/qt5/qtxml/qxmldefaulthandler-members.html
  12898. share/doc/qt5/qtxml/qxmldefaulthandler.html
  12899. share/doc/qt5/qtxml/qxmldtdhandler-members.html
  12900. share/doc/qt5/qtxml/qxmldtdhandler.html
  12901. share/doc/qt5/qtxml/qxmlentityresolver-members.html
  12902. share/doc/qt5/qtxml/qxmlentityresolver.html
  12903. share/doc/qt5/qtxml/qxmlerrorhandler-members.html
  12904. share/doc/qt5/qtxml/qxmlerrorhandler.html
  12905. share/doc/qt5/qtxml/qxmlinputsource-members.html
  12906. share/doc/qt5/qtxml/qxmlinputsource.html
  12907. share/doc/qt5/qtxml/qxmllexicalhandler-members.html
  12908. share/doc/qt5/qtxml/qxmllexicalhandler.html
  12909. share/doc/qt5/qtxml/qxmllocator-members.html
  12910. share/doc/qt5/qtxml/qxmllocator.html
  12911. share/doc/qt5/qtxml/qxmlnamespacesupport-members.html
  12912. share/doc/qt5/qtxml/qxmlnamespacesupport.html
  12913. share/doc/qt5/qtxml/qxmlparseexception-members.html
  12914. share/doc/qt5/qtxml/qxmlparseexception.html
  12915. share/doc/qt5/qtxml/qxmlreader-members.html
  12916. share/doc/qt5/qtxml/qxmlreader-obsolete.html
  12917. share/doc/qt5/qtxml/qxmlreader.html
  12918. share/doc/qt5/qtxml/qxmlsimplereader-members.html
  12919. share/doc/qt5/qtxml/qxmlsimplereader.html
  12920. share/doc/qt5/qtxml/style/offline-simple.css
  12921. share/doc/qt5/qtxml/style/offline.css
  12922. share/doc/qt5/qtxml/xml-dom-tml.html
  12923. share/doc/qt5/qtxml/xml-namespaces.html
  12924. share/doc/qt5/qtxml/xml-processing.html
  12925. share/doc/qt5/qtxml/xml-sax.html
  12926. share/doc/qt5/qtxml/xml-streaming.html
  12927. share/doc/qt5/qtxml/xml-tools.html
  12928. share/doc/qt5/qtxmlpatterns.qch
  12929. share/doc/qt5/qtxmlpatterns/examples-manifest.xml
  12930. share/doc/qt5/qtxmlpatterns/images/arrow_bc.png
  12931. share/doc/qt5/qtxmlpatterns/images/bgrContent.png
  12932. share/doc/qt5/qtxmlpatterns/images/btn_next.png
  12933. share/doc/qt5/qtxmlpatterns/images/btn_prev.png
  12934. share/doc/qt5/qtxmlpatterns/images/bullet_dn.png
  12935. share/doc/qt5/qtxmlpatterns/images/bullet_sq.png
  12936. share/doc/qt5/qtxmlpatterns/images/filetree_1-example.png
  12937. share/doc/qt5/qtxmlpatterns/images/filetree_2-example.png
  12938. share/doc/qt5/qtxmlpatterns/images/home.png
  12939. share/doc/qt5/qtxmlpatterns/images/ico_note.png
  12940. share/doc/qt5/qtxmlpatterns/images/ico_note_attention.png
  12941. share/doc/qt5/qtxmlpatterns/images/ico_out.png
  12942. share/doc/qt5/qtxmlpatterns/images/logo.png
  12943. share/doc/qt5/qtxmlpatterns/images/patternist-wordProcessor.png
  12944. share/doc/qt5/qtxmlpatterns/images/recipes-example.png
  12945. share/doc/qt5/qtxmlpatterns/images/schema-example.png
  12946. share/doc/qt5/qtxmlpatterns/qabstractmessagehandler-members.html
  12947. share/doc/qt5/qtxmlpatterns/qabstractmessagehandler.html
  12948. share/doc/qt5/qtxmlpatterns/qabstracturiresolver-members.html
  12949. share/doc/qt5/qtxmlpatterns/qabstracturiresolver.html
  12950. share/doc/qt5/qtxmlpatterns/qabstractxmlnodemodel-members.html
  12951. share/doc/qt5/qtxmlpatterns/qabstractxmlnodemodel.html
  12952. share/doc/qt5/qtxmlpatterns/qabstractxmlreceiver-members.html
  12953. share/doc/qt5/qtxmlpatterns/qabstractxmlreceiver.html
  12954. share/doc/qt5/qtxmlpatterns/qsimplexmlnodemodel-members.html
  12955. share/doc/qt5/qtxmlpatterns/qsimplexmlnodemodel.html
  12956. share/doc/qt5/qtxmlpatterns/qsourcelocation-members.html
  12957. share/doc/qt5/qtxmlpatterns/qsourcelocation.html
  12958. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-example.html
  12959. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-filetree-cpp.html
  12960. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-filetree-h.html
  12961. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-filetree-pro.html
  12962. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-forms-mainwindow-ui.html
  12963. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-main-cpp.html
  12964. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-mainwindow-cpp.html
  12965. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-mainwindow-h.html
  12966. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-queries-listcppfiles-xq.html
  12967. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-queries-qrc.html
  12968. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-queries-wholetree-xq.html
  12969. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-index.html
  12970. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-module.html
  12971. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-example.html
  12972. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-allrecipes-xq.html
  12973. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-cookbook-xml.html
  12974. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-liquidingredientsinsoup-xq.html
  12975. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-mushroomsoup-xq.html
  12976. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-preparationlessthan30-xq.html
  12977. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-preparationtimes-xq.html
  12978. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-forms-querywidget-mobiles-ui.html
  12979. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-forms-querywidget-ui.html
  12980. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-main-cpp.html
  12981. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-querymainwindow-cpp.html
  12982. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-querymainwindow-h.html
  12983. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-recipes-pro.html
  12984. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-recipes-qrc.html
  12985. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-example.html
  12986. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-contact-xml.html
  12987. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-order-xml.html
  12988. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-recipe-xml.html
  12989. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-valid-contact-xml.html
  12990. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-valid-order-xml.html
  12991. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-valid-recipe-xml.html
  12992. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-main-cpp.html
  12993. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-mainwindow-cpp.html
  12994. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-mainwindow-h.html
  12995. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-mobiles-ui.html
  12996. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-pro.html
  12997. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-qrc.html
  12998. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-ui.html
  12999. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-example.html
  13000. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-globalvariables-globals-cpp.html
  13001. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-globalvariables-reportglobals-xq.html
  13002. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-xquery-pro.html
  13003. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.index
  13004. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.qhp
  13005. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.qhp.sha1
  13006. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.tags
  13007. share/doc/qt5/qtxmlpatterns/qxmlformatter-members.html
  13008. share/doc/qt5/qtxmlpatterns/qxmlformatter.html
  13009. share/doc/qt5/qtxmlpatterns/qxmlitem-members.html
  13010. share/doc/qt5/qtxmlpatterns/qxmlitem.html
  13011. share/doc/qt5/qtxmlpatterns/qxmlname-members.html
  13012. share/doc/qt5/qtxmlpatterns/qxmlname.html
  13013. share/doc/qt5/qtxmlpatterns/qxmlnamepool-members.html
  13014. share/doc/qt5/qtxmlpatterns/qxmlnamepool.html
  13015. share/doc/qt5/qtxmlpatterns/qxmlnodemodelindex-members.html
  13016. share/doc/qt5/qtxmlpatterns/qxmlnodemodelindex.html
  13017. share/doc/qt5/qtxmlpatterns/qxmlquery-members.html
  13018. share/doc/qt5/qtxmlpatterns/qxmlquery.html
  13019. share/doc/qt5/qtxmlpatterns/qxmlresultitems-members.html
  13020. share/doc/qt5/qtxmlpatterns/qxmlresultitems.html
  13021. share/doc/qt5/qtxmlpatterns/qxmlschema-members.html
  13022. share/doc/qt5/qtxmlpatterns/qxmlschema.html
  13023. share/doc/qt5/qtxmlpatterns/qxmlschemavalidator-members.html
  13024. share/doc/qt5/qtxmlpatterns/qxmlschemavalidator.html
  13025. share/doc/qt5/qtxmlpatterns/qxmlserializer-members.html
  13026. share/doc/qt5/qtxmlpatterns/qxmlserializer.html
  13027. share/doc/qt5/qtxmlpatterns/style/offline-simple.css
  13028. share/doc/qt5/qtxmlpatterns/style/offline.css
  13029. share/doc/qt5/qtxmlpatterns/xmlpattern-examples.html
  13030. share/doc/qt5/qtxmlpatterns/xmlprocessing.html
  13031. share/doc/qt5/qtxmlpatterns/xquery-introduction.html
  13032. Collapse this list.

To install the port: cd /usr/ports/misc/qt5-doc/ && make install clean
To add the package: pkg install qt5-doc

PKGNAME: qt5-doc

distinfo:

TIMESTAMP = 1516799161
SHA256 (KDE/Qt/5.9.4/5.9.4-0-201801220610qt-everywhere-documentation.7z) = 4045ea1b3a789de51cf7f3e1cbca782d423d1678c264bf9a56462ccb41977969
SIZE (KDE/Qt/5.9.4/5.9.4-0-201801220610qt-everywhere-documentation.7z) = 213285230

Patch dependencies:

  1. 7z : archivers/p7zip

This port is required by:

for Run * - deleted ports are only shown under the This port is required by section. It was harder to do for the Required section. Perhaps later...
Configuration Options
     No options to configure

USES:
7z:p7zip qmake:_env

Master Sites:
  1. http://ftp.jaist.ac.jp/pub/qtproject/online/qtsdkrepository/linux_x64/desktop/qt5_594_src_doc_examples/qt.594.doc/
  2. http://master.qt.io/online/qtsdkrepository/linux_x64/desktop/qt5_594_src_doc_examples/qt.594.doc/
  3. http://qtmirror.ics.com/pub/qtproject/online/qtsdkrepository/linux_x64/desktop/qt5_594_src_doc_examples/qt.594.doc/
  4. http://www.mirrorservice.org/sites/download.qt-project.org/online/qtsdkrepository/linux_x64/desktop/qt5_594_src_doc_examples/qt.594.doc/
  5. http://www.nic.funet.fi/pub/mirrors/download.qt-project.org/online/qtsdkrepository/linux_x64/desktop/qt5_594_src_doc_examples/qt.594.doc/
  6. https://download.qt.io/online/qtsdkrepository/linux_x64/desktop/qt5_594_src_doc_examples/qt.594.doc/

Number of commits found: 6

Commit History - (may be incomplete: see SVNWeb link above for full details)
DateByDescription
29 Jan 2018 12:37:05
Original commit files touched by this commit  5.9.4
Revision:460296
rakuco search for other commits by this committer
Update Qt5 to 5.9.4.

Announcement:
https://blog.qt.io/blog/2018/01/23/qt-5-9-4-released/

This is a minor update and a lot easier to land than the previous 5.7.1 ->
5.9.3 commit.

Thanks to antoine for the exp-run.

PR:		225436
06 Jan 2018 21:30:33
Original commit files touched by this commit  5.9.3
Revision:458293
rakuco search for other commits by this committer
Update Qt5 ports to 5.9.3.

This took quite a lot of time because Qt's own build system underwent
several changes in 5.8.0 that took a while to adapt to.

And, of course, qt5-webengine is a behemoth that we need to patch like crazy
due to its bundling of Chromium. In fact, most of the Chromium patches in
qt5-webengine have been imported with no changes from www/chromium@433510
("www/chromium: update to 56.0.2924.87").

New port: accessibility/qt5-speech

Bigger changes to Qt5 ports we had to make:
- Qt now allows using a configure.json file to define configuration options
  and specify configuration checks that can be done when qmake is invoked.
(Only the first 15 lines of the commit message are shown above View all of this commit message)
18 Feb 2017 19:48:05
Original commit files touched by this commit  5.7.1
Revision:434380
tcberner search for other commits by this committer
Update Qt5 to 5.7.1, and unify the Qt4 and Qt5 ports some more

* Update Qt5 to 5.7.1
* Move Qt4 binaries to lib/qt4/bin
* Move Qt5 libraries to lib/qt5/lib
  By moving the libraries we should finally be able to get rid of the inplace
  upgrade bug (see ports bugs 194088, 195105 and 198720):  when Qt5's libraries
  were lying in /usr/local/lib, which would often get added by pkgconfig to the
  linker paths via dependencies, the already installed libraries were linked
  against, instead of the ones that were being built. This forced us to make
  sure, that -L${WRKSRC}/lib was always coming before -L/usr/local/lib in the
  linker flags. With this change this should no longer be the case.
* Rename some ports to match the rest (foo-qtX -> qtX-foo)
* Depend on new port misc/qtchooser [see UPDATING & CHANGES]

There are several new Qt5 ports which all have been created by Marie Loise
Nolden
<nolden@kde.org>. Thanks again.

PR:		216797
Exp-Run by:	antoine
Reviewed by:	rakuco, mat, groot_kde.org
Approved by:	rakuco (mentor)
Differential Revision:	https://reviews.freebsd.org/D9213
28 Oct 2016 13:43:14
Original commit files touched by this commit  5.6.2
Revision:424842
tcberner search for other commits by this committer
Update Qt to 5.6.2 [1,2]

Thanks to the upstream work of Marie Loise Nolden, we could get rid of a handful
of patches, as they have been properly upstreamed. The rest of the work is just
some minor plist changes.

I would like to thank Loise <nolden@kde.org> for the upstream work, and Adriaan
<groot@kde.org> for getting the update into shape.

[1] http://blog.qt.io/blog/2016/10/12/qt-5-6-2-released/
[2] http://wiki.qt.io/Qt_5.6.2_Change_Files

PR: 213530
Exp-run by: antoine
Submitted by: Adriaan de Groot <groot@kde.org>
Reviewed by: rakuco, mat, tcberner
Approved by: rakuco (mentor)
Differential Revision: https://reviews.freebsd.org/D8228
17 Sep 2016 09:46:54
Original commit files touched by this commit  5.6.1
Revision:422306
rakuco search for other commits by this committer
Update the Qt5 ports to 5.6.1.

This took longer than expected, but there are quite a few changes to the
existing ports and a few new ones.

General upstream changes:
- Starting with Qt 5.6.2, Qt will fail at configuration time if LibreSSL is
  being used. According to the discussion here:
  https://codereview.qt-project.org/#/c/154800/
  The Qt project is not opposed to LibreSSL, but does not want to mix
  support for it into the OpenSSL backend code, especially as they move
  towards supporting OpenSSL 1.1.
  People interested in LibreSSL support are welcome to submit a separate
  backend upstream, but are expected to maintain it. We (kde@) are not
  opposed to carrying some patches authored by others in the future, as long
(Only the first 15 lines of the commit message are shown above View all of this commit message)
31 May 2016 18:02:42
Original commit files touched by this commit  5.5.1
Revision:416213
pi search for other commits by this committer
New port: misc/qt5-doc

This port builds and installs the Qt5 API documentation for use
with IDEs such as qtcreator or kdevelop in qch file format and HTML
file format.

Limitations: The port is made for Qt 5.5.1 and excludes the
documentation for qtwebkit, qtwebkit-examples and qtwebengine. The
reasons are, webkit is deprecated and should not be used for further
development, it will not be part of the Qt 5.6.x sources by default
and only provided on FreeBSD for backwards compatibility with ports.
API documentation may be later added to the qt5-webkit port (as
well for qtwebkit-examples). The qtwebengine hasn't been ported to
FreeBSD yet, so no documenation can be generated either.
(Only the first 15 lines of the commit message are shown above View all of this commit message)

Number of commits found: 6

Login
User Login
Create account

Servers and bandwidth provided by
New York Internet, SuperNews, and RootBSD

This site
What is FreshPorts?
About the authors
Issues
FAQ
How big is it?
The latest upgrade!
Privacy
Forums
Blog
Contact

Search
Enter Keywords:
 
more...

Latest Vulnerabilities
irssiFeb 19
p5-MojoliciousFeb 17
broFeb 16
broFeb 16
bugzilla44Feb 16
bugzilla50Feb 16
consulFeb 16
librawFeb 15
librawFeb 15
quaggaFeb 15
bitmessageFeb 14
jenkinsFeb 14
jenkins-ltsFeb 14
bchunkFeb 13
bchunkFeb 13

26 vulnerabilities affecting 83 ports have been reported in the past 14 days

* - modified, not new

All vulnerabilities

Last updated:
2018-02-19 12:25:28


Ports
Home
Categories
Deleted ports
Sanity Test Failures
Newsfeeds

Statistics
Graphs
NEW Graphs (Javascript)
Traffic

Calculated hourly:
Port count 32868
Broken 94
Deprecated 103
Ignore 336
Forbidden 4
Restricted 169
No CDROM 77
Vulnerable 36
Expired 7
Set to expire 93
Interactive 0
new 24 hours 5
new 48 hours13
new 7 days1674
new fortnight12548
new month12664

Servers and bandwidth provided by
New York Internet, SuperNews, and RootBSD
Valid HTML, CSS, and RSS.
Copyright © 2000-2018 Dan Langille. All rights reserved.