notbugIf you buy from Amazon USA, please support us by using this link.
Port details
qt5-doc Qt 5 documentation
5.10.1 misc on this many watch lists=0 search for ports that depend on this port Find issues related to this port Report an issue related to this port
Maintainer: kde@FreeBSD.org search for ports maintained by this maintainer
Port Added: 31 May 2016 20:39:07
License: not specified in port
Qt is a cross-platform application and UI framework for developers
using C++ or QML, a CSS/JavaScript-like language.

With Qt, code can be reused efficiently to target multiple platforms
with one code base. The modular C++ class library and developer tools
easily enables developers to create applications for one platform and
easily build and run to deploy on another platform.

WWW: http://qt-project.org
SVNWeb : Homepage : PortsMon
    Pseudo-pkg-plist information, but much better, from make generate-plist
    Expand this list (14112 items)
  1. share/doc/qt5/qt3d/qml-qt3d-render-blitframebuffer-members.html
  2. share/doc/qt5/qt3d/qml-qt3d-render-blitframebuffer.html
  3. share/doc/qt5/qt3d/qml-qt3d-render-camera-obsolete.html
  4. share/doc/qt5/qt3d/qt3drender-qcamera-obsolete.html
  5. share/doc/qt5/qtquick/qml-qt-labs-handlers-pointhandler-members.html
  6. share/doc/qt5/qtquick/qml-qt-labs-handlers-pointhandler.html
  7. share/doc/qt5/qtquick/qml-qtquick-gestureevent-members.html
  8. share/doc/qt5/qtquick/qml-qtquick-gestureevent.html
  9. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-attribution-shadow-angular-material.html
  10. share/doc/qt5/qtwidgets/images/notepad1.png
  11. share/doc/qt5/qtwidgets/images/notepad2.png
  12. share/doc/qt5/qtwidgets/images/notepad3.png
  13. share/doc/qt5/qtwidgets/images/notepad4.png
  14. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/copy.png
  15. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/create.png
  16. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/cut.png
  17. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/edit_redo.png
  18. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/edit_undo.png
  19. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/exit.png
  20. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/font.png
  21. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/info.png
  22. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/new.png
  23. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/open.png
  24. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/paste.png
  25. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/pencil.png
  26. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/print.png
  27. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/save.png
  28. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/save_as.png
  29. share/doc/qt5/qtwidgets/images/validators.png
  30. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-example.html
  31. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-main-cpp.html
  32. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-notepad-cpp.html
  33. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-notepad-h.html
  34. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-notepad-pro.html
  35. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-notepad-qrc.html
  36. share/doc/qt5/qtwidgets/qtwidgets-tutorials-notepad-notepad-ui.html
  37. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-attribution-xml-xsd.html
  38. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-webbrowser-qrc.html
  39. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/back.png
  40. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/forward.png
  41. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/go.png
  42. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/home.png
  43. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/refresh.png
  44. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/search.png
  45. share/doc/qt5/activeqt/images/used-in-examples/activeqt/webbrowser/images/stop.png
  46. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterDiffuse.jpg
  47. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterNormal.jpg
  48. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterSpecular.jpg
  49. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/Waterwave.jpg
  50. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/foam.jpg
  51. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/sky.jpg
  52. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/android/res/drawable-hdpi/icon.png
  53. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/android/res/drawable-ldpi/icon.png
  54. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/android/res/drawable-mdpi/icon.png
  55. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient WatchKit App/Assets.xcassets/AppIcon.appiconset/home_icon.png
  56. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/icon120.png
  57. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/icon180.png
  58. share/doc/qt5/qt3d/qml-qt3d-core-abstractskeleton-members.html
  59. share/doc/qt5/qt3d/qml-qt3d-core-abstractskeleton.html
  60. share/doc/qt5/qt3d/qml-qt3d-core-armature-members.html
  61. share/doc/qt5/qt3d/qml-qt3d-core-armature.html
  62. share/doc/qt5/qt3d/qml-qt3d-core-joint-members.html
  63. share/doc/qt5/qt3d/qml-qt3d-core-joint.html
  64. share/doc/qt5/qt3d/qml-qt3d-core-skeleton-members.html
  65. share/doc/qt5/qt3d/qml-qt3d-core-skeleton.html
  66. share/doc/qt5/qt3d/qml-qt3d-core-skeletonloader-members.html
  67. share/doc/qt5/qt3d/qml-qt3d-core-skeletonloader.html
  68. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmaterial-members.html
  69. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmaterial.html
  70. share/doc/qt5/qt3d/qml-qt3d-render-buffer-obsolete.html
  71. share/doc/qt5/qt3d/qml-qt3d-render-linewidth-members.html
  72. share/doc/qt5/qt3d/qml-qt3d-render-linewidth.html
  73. share/doc/qt5/qt3d/qml-qt3d-render-picklineevent-members.html
  74. share/doc/qt5/qt3d/qml-qt3d-render-picklineevent.html
  75. share/doc/qt5/qt3d/qml-qt3d-render-pickpointevent-members.html
  76. share/doc/qt5/qt3d/qml-qt3d-render-pickpointevent.html
  77. share/doc/qt5/qt3d/qml-qt3d-render-proximityfilter-members.html
  78. share/doc/qt5/qt3d/qml-qt3d-render-proximityfilter.html
  79. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogrambuilder-members.html
  80. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogrambuilder.html
  81. share/doc/qt5/qt3d/qt3danimation-qabstractchannelmapping-members.html
  82. share/doc/qt5/qt3d/qt3danimation-qabstractchannelmapping.html
  83. share/doc/qt5/qt3d/qt3danimation-qanimationcallback-members.html
  84. share/doc/qt5/qt3d/qt3danimation-qanimationcallback.html
  85. share/doc/qt5/qt3d/qt3danimation-qcallbackmapping-members.html
  86. share/doc/qt5/qt3d/qt3danimation-qcallbackmapping.html
  87. share/doc/qt5/qt3d/qt3danimation-qclock-members.html
  88. share/doc/qt5/qt3d/qt3danimation-qclock.html
  89. share/doc/qt5/qt3d/qt3danimation-qskeletonmapping-members.html
  90. share/doc/qt5/qt3d/qt3danimation-qskeletonmapping.html
  91. share/doc/qt5/qt3d/qt3dcore-qabstractskeleton-members.html
  92. share/doc/qt5/qt3d/qt3dcore-qabstractskeleton.html
  93. share/doc/qt5/qt3d/qt3dcore-qarmature-members.html
  94. share/doc/qt5/qt3d/qt3dcore-qarmature.html
  95. share/doc/qt5/qt3d/qt3dcore-qjoint-members.html
  96. share/doc/qt5/qt3d/qt3dcore-qjoint.html
  97. share/doc/qt5/qt3d/qt3dcore-qnodecommand-members.html
  98. share/doc/qt5/qt3d/qt3dcore-qnodecommand.html
  99. share/doc/qt5/qt3d/qt3dcore-qskeleton-members.html
  100. share/doc/qt5/qt3d/qt3dcore-qskeleton.html
  101. share/doc/qt5/qt3d/qt3dcore-qskeletonloader-members.html
  102. share/doc/qt5/qt3d/qt3dcore-qskeletonloader.html
  103. share/doc/qt5/qt3d/qt3dextras-obsolete.html
  104. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-inputstate-members.html
  105. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-inputstate.html
  106. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-members.html
  107. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller.html
  108. share/doc/qt5/qt3d/qt3dextras-qabstractspritesheet-members.html
  109. share/doc/qt5/qt3d/qt3dextras-qabstractspritesheet.html
  110. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmaterial-members.html
  111. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmaterial.html
  112. share/doc/qt5/qt3d/qt3dextras-qspritegrid-members.html
  113. share/doc/qt5/qt3d/qt3dextras-qspritegrid.html
  114. share/doc/qt5/qt3d/qt3dextras-qspritesheet-members.html
  115. share/doc/qt5/qt3d/qt3dextras-qspritesheet.html
  116. share/doc/qt5/qt3d/qt3dextras-qspritesheetitem-members.html
  117. share/doc/qt5/qt3d/qt3dextras-qspritesheetitem.html
  118. share/doc/qt5/qt3d/qt3drender-qblitframebuffer-members.html
  119. share/doc/qt5/qt3d/qt3drender-qblitframebuffer.html
  120. share/doc/qt5/qt3d/qt3drender-qbuffer-obsolete.html
  121. share/doc/qt5/qt3d/qt3drender-qlinewidth-members.html
  122. share/doc/qt5/qt3d/qt3drender-qlinewidth.html
  123. share/doc/qt5/qt3d/qt3drender-qpicklineevent-members.html
  124. share/doc/qt5/qt3d/qt3drender-qpicklineevent.html
  125. share/doc/qt5/qt3d/qt3drender-qpickpointevent-members.html
  126. share/doc/qt5/qt3d/qt3drender-qpickpointevent.html
  127. share/doc/qt5/qt3d/qt3drender-qproximityfilter-members.html
  128. share/doc/qt5/qt3d/qt3drender-qproximityfilter.html
  129. share/doc/qt5/qt3d/qt3drender-qshaderprogrambuilder-members.html
  130. share/doc/qt5/qt3d/qt3drender-qshaderprogrambuilder.html
  131. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/android-sources/res/drawable/icon.png
  132. share/doc/qt5/qtandroidextras/qandroidbinder-members.html
  133. share/doc/qt5/qtandroidextras/qandroidbinder.html
  134. share/doc/qt5/qtandroidextras/qandroidintent-members.html
  135. share/doc/qt5/qtandroidextras/qandroidintent.html
  136. share/doc/qt5/qtandroidextras/qandroidjniexceptioncleaner-members.html
  137. share/doc/qt5/qtandroidextras/qandroidjniexceptioncleaner.html
  138. share/doc/qt5/qtandroidextras/qandroidparcel-members.html
  139. share/doc/qt5/qtandroidextras/qandroidparcel.html
  140. share/doc/qt5/qtandroidextras/qandroidservice-members.html
  141. share/doc/qt5/qtandroidextras/qandroidservice.html
  142. share/doc/qt5/qtandroidextras/qandroidserviceconnection-members.html
  143. share/doc/qt5/qtandroidextras/qandroidserviceconnection.html
  144. share/doc/qt5/qtassistant/images/used-in-examples/remotecontrol/enter.png
  145. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/browse.png
  146. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/fadedfilemenu.png
  147. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/filedialog.png
  148. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/handbook.png
  149. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/icon.png
  150. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/mainwindow.png
  151. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/open.png
  152. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/wildcard.png
  153. share/doc/qt5/qtbluetooth/images/used-in-examples/btfiletransfer/busy.gif
  154. share/doc/qt5/qtbluetooth/images/used-in-examples/btfiletransfer/pairing.gif
  155. share/doc/qt5/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/bt_off_to_on.png
  156. share/doc/qt5/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/heart.png
  157. share/doc/qt5/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/logo.png
  158. share/doc/qt5/qtbluetooth/images/used-in-examples/lowenergyscanner/assets/busy_dark.png
  159. share/doc/qt5/qtbluetooth/images/used-in-examples/picturetransfer/background.png
  160. share/doc/qt5/qtbluetooth/images/used-in-examples/picturetransfer/icon.png
  161. share/doc/qt5/qtbluetooth/images/used-in-examples/scanner/default.png
  162. share/doc/qt5/qtcanvas3d/images/used-in-examples/framebuffer/qml/framebuffer/qtlogo.png
  163. share/doc/qt5/qtcanvas3d/images/used-in-examples/interaction/qml/interaction/barrel.jpg
  164. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/bush.png
  165. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/gold.jpg
  166. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/pallet.jpg
  167. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/rock.jpg
  168. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/woodbox.jpg
  169. share/doc/qt5/qtcanvas3d/images/used-in-examples/textureandlight/qml/textureandlight/qtlogo.png
  170. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29.png
  171. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29@2x.png
  172. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29@2x~ipad.png
  173. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29~ipad.png
  174. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40@2x.png
  175. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40@2x~ipad.png
  176. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40~ipad.png
  177. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon50x50@2x~ipad.png
  178. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon50x50~ipad.png
  179. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon57x57.png
  180. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon57x57@2x.png
  181. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon60x60@2x.png
  182. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon72x72@2x~ipad.png
  183. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon72x72~ipad.png
  184. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon76x76@2x~ipad.png
  185. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon76x76~ipad.png
  186. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/dataviz.jpg
  187. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/devices.png
  188. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/embedded.png
  189. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/iot.png
  190. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/multiscreen.png
  191. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/puzzle-pieces.png
  192. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/qtlogo.png
  193. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/qtlogosmall.png
  194. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29.png
  195. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29@2x.png
  196. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29@2x~ipad.png
  197. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29~ipad.png
  198. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40@2x.png
  199. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40@2x~ipad.png
  200. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40~ipad.png
  201. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon50x50@2x~ipad.png
  202. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon50x50~ipad.png
  203. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon57x57.png
  204. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon57x57@2x.png
  205. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon60x60@2x.png
  206. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon72x72@2x~ipad.png
  207. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon72x72~ipad.png
  208. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon76x76@2x~ipad.png
  209. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon76x76~ipad.png
  210. share/doc/qt5/qtcore/images/used-in-examples/ipc/sharedmemory/image.png
  211. share/doc/qt5/qtcore/images/used-in-examples/ipc/sharedmemory/qt.png
  212. share/doc/qt5/qtcore/qbeinteger-members.html
  213. share/doc/qt5/qtcore/qbeinteger.html
  214. share/doc/qt5/qtcore/qkeyvalueiterator-members.html
  215. share/doc/qt5/qtcore/qkeyvalueiterator.html
  216. share/doc/qt5/qtcore/qleinteger-members.html
  217. share/doc/qt5/qtcore/qleinteger.html
  218. share/doc/qt5/qtcore/qrandomgenerator-members.html
  219. share/doc/qt5/qtcore/qrandomgenerator.html
  220. share/doc/qt5/qtcore/qrandomgenerator64-members.html
  221. share/doc/qt5/qtcore/qrandomgenerator64.html
  222. share/doc/qt5/qtcore/qsemaphorereleaser-members.html
  223. share/doc/qt5/qtcore/qsemaphorereleaser.html
  224. share/doc/qt5/qtcore/qstringview-members.html
  225. share/doc/qt5/qtcore/qstringview.html
  226. share/doc/qt5/qtdoc/newclasses510.html
  227. share/doc/qt5/qtdoc/whatsnew510.html
  228. share/doc/qt5/qtgamepad/images/used-in-examples/keyNavigation/keyNavigation64.png
  229. share/doc/qt5/qtgamepad/images/used-in-examples/keyNavigation/keyNavigation80.png
  230. share/doc/qt5/qtgamepad/images/used-in-examples/mouseItem/mouseItem64.png
  231. share/doc/qt5/qtgamepad/images/used-in-examples/mouseItem/mouseItem80.png
  232. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerBack.png
  233. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonA.png
  234. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonB.png
  235. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonGuide.png
  236. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonX.png
  237. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonY.png
  238. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerDPad.png
  239. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftShoulder.png
  240. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftThumbstick.png
  241. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftTrigger.png
  242. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightShoulder.png
  243. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightThumbstick.png
  244. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightTrigger.png
  245. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerStart.png
  246. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/quickGamepad64.png
  247. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/quickGamepad80.png
  248. share/doc/qt5/qtgui/images/hellovulkancubes.png
  249. share/doc/qt5/qtgui/images/hellovulkantexture.png
  250. share/doc/qt5/qtgui/images/hellovulkantriangle.png
  251. share/doc/qt5/qtgui/images/hellovulkanwidget.png
  252. share/doc/qt5/qtgui/images/hellovulkanwindow.png
  253. share/doc/qt5/qtgui/images/used-in-examples/hellovulkantexture/qt256.png
  254. share/doc/qt5/qtgui/qnativegestureevent-obsolete.html
  255. share/doc/qt5/qtgui/qtextoption-obsolete.html
  256. share/doc/qt5/qtgui/qtgui-attribution-icc-srgb-color-profile.html
  257. share/doc/qt5/qtgui/qtgui-attribution-vulkan-xml-spec.html
  258. share/doc/qt5/qtgui/qtgui-hellovulkancubes-camera-cpp.html
  259. share/doc/qt5/qtgui/qtgui-hellovulkancubes-camera-h.html
  260. share/doc/qt5/qtgui/qtgui-hellovulkancubes-example.html
  261. share/doc/qt5/qtgui/qtgui-hellovulkancubes-hellovulkancubes-pro.html
  262. share/doc/qt5/qtgui/qtgui-hellovulkancubes-hellovulkancubes-qrc.html
  263. share/doc/qt5/qtgui/qtgui-hellovulkancubes-main-cpp.html
  264. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mainwindow-cpp.html
  265. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mainwindow-h.html
  266. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mesh-cpp.html
  267. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mesh-h.html
  268. share/doc/qt5/qtgui/qtgui-hellovulkancubes-renderer-cpp.html
  269. share/doc/qt5/qtgui/qtgui-hellovulkancubes-renderer-h.html
  270. share/doc/qt5/qtgui/qtgui-hellovulkancubes-shader-cpp.html
  271. share/doc/qt5/qtgui/qtgui-hellovulkancubes-shader-h.html
  272. share/doc/qt5/qtgui/qtgui-hellovulkancubes-vulkanwindow-cpp.html
  273. share/doc/qt5/qtgui/qtgui-hellovulkancubes-vulkanwindow-h.html
  274. share/doc/qt5/qtgui/qtgui-hellovulkantexture-example.html
  275. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-cpp.html
  276. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-h.html
  277. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-pro.html
  278. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-qrc.html
  279. share/doc/qt5/qtgui/qtgui-hellovulkantexture-main-cpp.html
  280. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-example.html
  281. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-hellovulkantriangle-pro.html
  282. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-hellovulkantriangle-qrc.html
  283. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-main-cpp.html
  284. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-example.html
  285. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-cpp.html
  286. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-h.html
  287. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-pro.html
  288. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-qrc.html
  289. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-main-cpp.html
  290. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-example.html
  291. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-cpp.html
  292. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-h.html
  293. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-pro.html
  294. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-main-cpp.html
  295. share/doc/qt5/qtgui/qvulkanextension-members.html
  296. share/doc/qt5/qtgui/qvulkanextension.html
  297. share/doc/qt5/qtgui/qvulkaninfovector-members.html
  298. share/doc/qt5/qtgui/qvulkaninfovector.html
  299. share/doc/qt5/qtgui/qvulkaninstance-members.html
  300. share/doc/qt5/qtgui/qvulkaninstance.html
  301. share/doc/qt5/qtgui/qvulkanlayer-members.html
  302. share/doc/qt5/qtgui/qvulkanlayer.html
  303. share/doc/qt5/qtgui/qvulkanwindow-members.html
  304. share/doc/qt5/qtgui/qvulkanwindow.html
  305. share/doc/qt5/qtgui/qvulkanwindowrenderer-members.html
  306. share/doc/qt5/qtgui/qvulkanwindowrenderer.html
  307. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/icon.png
  308. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/marker.png
  309. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/scale.png
  310. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/scale_end.png
  311. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/categories.png
  312. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/left.png
  313. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/marker.png
  314. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/right.png
  315. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/scale.png
  316. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/scale_end.png
  317. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/search.png
  318. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/star.png
  319. share/doc/qt5/qtlocation/images/used-in-examples/places_list/marker.png
  320. share/doc/qt5/qtlocation/images/used-in-examples/places_map/marker.png
  321. share/doc/qt5/qtlocation/images/used-in-examples/planespotter/airplane.png
  322. share/doc/qt5/qtlocation/qml-qtlocation-cameracapabilities-members.html
  323. share/doc/qt5/qtlocation/qml-qtlocation-cameracapabilities.html
  324. share/doc/qt5/qtmacextras/images/used-in-examples/macfunctions/qtlogo.png
  325. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/record.png
  326. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/settings.png
  327. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/qmlvideo.png
  328. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/qmlvideofx.png
  329. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiolevel-cpp.html
  330. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiolevel-h.html
  331. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-button-qml.html
  332. share/doc/qt5/qtnetwork/images/used-in-examples/securesocketclient/encrypted.png
  333. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/1downarrow.png
  334. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/1uparrow.png
  335. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/bottom.png
  336. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/edit_add.png
  337. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/edit_remove.png
  338. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/exit.png
  339. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/peertopeer.png
  340. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/player_pause.png
  341. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/player_play.png
  342. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/player_stop.png
  343. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/stop.png
  344. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/NfcFlag.png
  345. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/cork.jpg
  346. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/icon.png
  347. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/note-yellow.png
  348. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/tack.png
  349. share/doc/qt5/qtopengl/images/used-in-examples/cube/cube.png
  350. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/gloss.png
  351. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/lineedit.png
  352. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/moon.png
  353. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/quit.png
  354. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/star.png
  355. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/stripes.png
  356. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/sun.png
  357. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/titlebar.png
  358. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/toolbutton.png
  359. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-few-clouds.png
  360. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-fog.png
  361. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-haze.png
  362. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-icy.png
  363. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-overcast.png
  364. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-showers.png
  365. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sleet.png
  366. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-snow.png
  367. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-storm.png
  368. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sunny-very-few-clouds.png
  369. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sunny.png
  370. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-thundershower.png
  371. share/doc/qt5/qtpositioning/qgeopolygon-members.html
  372. share/doc/qt5/qtpositioning/qgeopolygon.html
  373. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/face-smile.png
  374. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/moon.png
  375. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/rabbit_brown.png
  376. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/rabbit_bw.png
  377. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/star.png
  378. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/sun.png
  379. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/tree_s.png
  380. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/center.png
  381. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/clock.png
  382. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/hour.png
  383. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/minute.png
  384. share/doc/qt5/qtquick/images/declarative-arcrotation.png
  385. share/doc/qt5/qtquick/images/pathitem-code-example.png
  386. share/doc/qt5/qtquick/images/pointDistanceThreshold.png
  387. share/doc/qt5/qtquick/images/qml-shapes-example.png
  388. share/doc/qt5/qtquick/images/shape-radial-gradient.png
  389. share/doc/qt5/qtquick/images/touchpoints-pinchhandler.png
  390. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/face-smile.png
  391. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/moon.png
  392. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/shadow.png
  393. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/star.png
  394. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/sun.png
  395. share/doc/qt5/qtquick/images/used-in-examples/animation/states/qt-logo.png
  396. share/doc/qt5/qtquick/images/used-in-examples/canvas/contents/qt-logo.png
  397. share/doc/qt5/qtquick/images/used-in-examples/canvas/squircle/squircle.png
  398. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/background.png
  399. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/needle.png
  400. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/needle_shadow.png
  401. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/overlay.png
  402. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/quit.png
  403. share/doc/qt5/qtquick/images/used-in-examples/customitems/flipable/content/5_heart.png
  404. share/doc/qt5/qtquick/images/used-in-examples/customitems/flipable/content/9_club.png
  405. share/doc/qt5/qtquick/images/used-in-examples/customitems/flipable/content/back.png
  406. share/doc/qt5/qtquick/images/used-in-examples/customitems/scrollbar/pics/niagara_falls.jpg
  407. share/doc/qt5/qtquick/images/used-in-examples/demos/calqlatr/content/images/paper-edge-left.png
  408. share/doc/qt5/qtquick/images/used-in-examples/demos/calqlatr/content/images/paper-edge-right.png
  409. share/doc/qt5/qtquick/images/used-in-examples/demos/calqlatr/content/images/paper-grip.png
  410. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/arrow.png
  411. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/background.png
  412. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/center.png
  413. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/clock-night.png
  414. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/clock.png
  415. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/hour.png
  416. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/minute.png
  417. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/quit.png
  418. share/doc/qt5/qtquick/images/used-in-examples/demos/clocks/content/second.png
  419. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/background.png
  420. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/bomb-action.png
  421. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/bomb-idle.png
  422. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/bomb.png
  423. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/button-help.png
  424. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/button-play.png
  425. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/catch-action.png
  426. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/catch.png
  427. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/cloud.png
  428. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/currency.png
  429. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/dialog-bomb.png
  430. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/dialog-factory.png
  431. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/dialog-melee.png
  432. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/dialog-pointer.png
  433. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/dialog-shooter.png
  434. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/dialog.png
  435. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/factory-action.png
  436. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/factory-idle.png
  437. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/factory.png
  438. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/grid.png
  439. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/help.png
  440. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/lifes.png
  441. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/logo-bubble.png
  442. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/logo-fish.png
  443. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/logo.png
  444. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/melee-action.png
  445. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/melee-idle.png
  446. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/melee.png
  447. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/mob-idle.png
  448. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/mob.png
  449. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/points.png
  450. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/projectile-action.png
  451. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/projectile.png
  452. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/scores.png
  453. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/shooter-action.png
  454. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/shooter-idle.png
  455. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/shooter.png
  456. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/sunlight.png
  457. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/text-1.png
  458. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/text-2.png
  459. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/text-3.png
  460. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/text-blank.png
  461. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/text-gameover.png
  462. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/text-go.png
  463. share/doc/qt5/qtquick/images/used-in-examples/demos/maroon/content/gfx/wave.png
  464. share/doc/qt5/qtquick/images/used-in-examples/demos/photosurface/resources/folder.png
  465. share/doc/qt5/qtquick/images/used-in-examples/demos/photosurface/resources/icon.png
  466. share/doc/qt5/qtquick/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/box-shadow.png
  467. share/doc/qt5/qtquick/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/busy.png
  468. share/doc/qt5/qtquick/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/cardboard.png
  469. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Asia.jpg
  470. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Business.jpg
  471. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Entertainment.jpg
  472. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Europe.jpg
  473. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Health.jpg
  474. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Politics.jpg
  475. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Science.jpg
  476. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Sports.jpg
  477. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/Technology.jpg
  478. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/TopStories.jpg
  479. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/USNational.jpg
  480. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/World.jpg
  481. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/btn_close.png
  482. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/busy.png
  483. share/doc/qt5/qtquick/images/used-in-examples/demos/rssnews/content/images/scrollbar.png
  484. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/background-puzzle.png
  485. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/background.png
  486. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/bar.png
  487. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/blue-puzzle.png
  488. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/blue.png
  489. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/bubble-highscore.png
  490. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/bubble-puzzle.png
  491. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-game-1.png
  492. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-game-2.png
  493. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-game-3.png
  494. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-game-4.png
  495. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-game-new.png
  496. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-menu.png
  497. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-puzzle-next.png
  498. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/but-quit.png
  499. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/green-puzzle.png
  500. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/green.png
  501. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/icon-fail.png
  502. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/icon-ok.png
  503. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/icon-time.png
  504. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/logo-a.png
  505. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/logo-e.png
  506. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/logo-g.png
  507. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/logo-m.png
  508. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/logo-s.png
  509. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/logo.png
  510. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/particle-brick.png
  511. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/particle-paint.png
  512. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/particle-smoke.png
  513. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/red-puzzle.png
  514. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/red.png
  515. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-highscore-new.png
  516. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-highscore.png
  517. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-no-winner.png
  518. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-p1-go.png
  519. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-p1-won.png
  520. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-p1.png
  521. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-p2-go.png
  522. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-p2-won.png
  523. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/text-p2.png
  524. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/yellow-puzzle.png
  525. share/doc/qt5/qtquick/images/used-in-examples/demos/samegame/content/gfx/yellow.png
  526. share/doc/qt5/qtquick/images/used-in-examples/demos/stocqt/content/images/icon-left-arrow.png
  527. share/doc/qt5/qtquick/images/used-in-examples/demos/stocqt/content/images/wheel-touch.png
  528. share/doc/qt5/qtquick/images/used-in-examples/demos/stocqt/content/images/wheel.png
  529. share/doc/qt5/qtquick/images/used-in-examples/demos/tweetsearch/content/resources/anonymous.png
  530. share/doc/qt5/qtquick/images/used-in-examples/demos/tweetsearch/content/resources/bird-anim-sprites.png
  531. share/doc/qt5/qtquick/images/used-in-examples/demos/tweetsearch/content/resources/icon-clear.png
  532. share/doc/qt5/qtquick/images/used-in-examples/demos/tweetsearch/content/resources/icon-loading.png
  533. share/doc/qt5/qtquick/images/used-in-examples/demos/tweetsearch/content/resources/icon-refresh.png
  534. share/doc/qt5/qtquick/images/used-in-examples/demos/tweetsearch/content/resources/icon-search.png
  535. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/BearSheet.png
  536. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/arrow.png
  537. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/bw.png
  538. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/colors.png
  539. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/qt-logo.png
  540. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/shadow.png
  541. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/speaker.png
  542. share/doc/qt5/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/arrow.png
  543. share/doc/qt5/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/qt-logo.png
  544. share/doc/qt5/qtquick/images/used-in-examples/shadereffects/content/face-smile.png
  545. share/doc/qt5/qtquick/images/used-in-examples/shadereffects/content/qt-logo.png
  546. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/face-sad.png
  547. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/face-smile-big.png
  548. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/face-smile.png
  549. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/heart200.png
  550. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/qtlogo.png
  551. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/starfish_2.png
  552. share/doc/qt5/qtquick/images/used-in-examples/text/textselection/pics/endHandle.png
  553. share/doc/qt5/qtquick/images/used-in-examples/text/textselection/pics/startHandle.png
  554. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/flickable/content/cork.jpg
  555. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/flickable/content/note-yellow.png
  556. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/flickable/content/tack.png
  557. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear0.png
  558. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear1.png
  559. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear2.png
  560. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear3.png
  561. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/BearB.png
  562. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/blur-circle.png
  563. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/blur-circle3.png
  564. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/heart-blur.png
  565. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/title.png
  566. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/pincharea/qt-logo.jpg
  567. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/AddressBook_48.png
  568. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/AudioPlayer_48.png
  569. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/Camera_48.png
  570. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/DateBook_48.png
  571. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/EMail_48.png
  572. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/TodoList_48.png
  573. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/VideoPlayer_48.png
  574. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/arrow-down.png
  575. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/arrow-up.png
  576. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/fruit-salad.jpg
  577. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/hamburger.jpg
  578. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/lemonade.jpg
  579. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/list-delete.png
  580. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/minus-sign.png
  581. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/moreDown.png
  582. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/moreUp.png
  583. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/pancakes.jpg
  584. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/plus-sign.png
  585. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/vegetable-soup.jpg
  586. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/background.png
  587. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/center.png
  588. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/clock-night.png
  589. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/clock.png
  590. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/hour.png
  591. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/minute.png
  592. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/pics/background.jpg
  593. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/pics/face-smile.png
  594. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/pics/home-page.png
  595. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/pics/shadow.png
  596. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/pics/yast-joystick.png
  597. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/pics/yast-wol.png
  598. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/quit.png
  599. share/doc/qt5/qtquick/images/used-in-examples/views/parallax/content/second.png
  600. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/AddressBook_48.png
  601. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/AudioPlayer_48.png
  602. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/Camera_48.png
  603. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/DateBook_48.png
  604. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/EMail_48.png
  605. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/TodoList_48.png
  606. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/VideoPlayer_48.png
  607. share/doc/qt5/qtquick/images/used-in-examples/window/resources/icon64.png
  608. share/doc/qt5/qtquick/images/visualpath-code-example.png
  609. share/doc/qt5/qtquick/qml-qt-labs-handlers-draghandler-members.html
  610. share/doc/qt5/qtquick/qml-qt-labs-handlers-draghandler.html
  611. share/doc/qt5/qtquick/qml-qt-labs-handlers-handlerpoint-members.html
  612. share/doc/qt5/qtquick/qml-qt-labs-handlers-handlerpoint.html
  613. share/doc/qt5/qtquick/qml-qt-labs-handlers-multipointhandler-members.html
  614. share/doc/qt5/qtquick/qml-qt-labs-handlers-multipointhandler.html
  615. share/doc/qt5/qtquick/qml-qt-labs-handlers-pinchhandler-members.html
  616. share/doc/qt5/qtquick/qml-qt-labs-handlers-pinchhandler.html
  617. share/doc/qt5/qtquick/qml-qt-labs-handlers-pointerdevicehandler-members.html
  618. share/doc/qt5/qtquick/qml-qt-labs-handlers-pointerdevicehandler.html
  619. share/doc/qt5/qtquick/qml-qt-labs-handlers-pointerhandler-members.html
  620. share/doc/qt5/qtquick/qml-qt-labs-handlers-pointerhandler.html
  621. share/doc/qt5/qtquick/qml-qt-labs-handlers-singlepointhandler-members.html
  622. share/doc/qt5/qtquick/qml-qt-labs-handlers-singlepointhandler.html
  623. share/doc/qt5/qtquick/qml-qt-labs-handlers-taphandler-members.html
  624. share/doc/qt5/qtquick/qml-qt-labs-handlers-taphandler.html
  625. share/doc/qt5/qtquick/qml-qtquick-eventpoint-members.html
  626. share/doc/qt5/qtquick/qml-qtquick-eventpoint.html
  627. share/doc/qt5/qtquick/qml-qtquick-eventtouchpoint-members.html
  628. share/doc/qt5/qtquick/qml-qtquick-eventtouchpoint.html
  629. share/doc/qt5/qtquick/qml-qtquick-pathmove-members.html
  630. share/doc/qt5/qtquick/qml-qtquick-pathmove.html
  631. share/doc/qt5/qtquick/qml-qtquick-pointerdevice-members.html
  632. share/doc/qt5/qtquick/qml-qtquick-pointerdevice.html
  633. share/doc/qt5/qtquick/qml-qtquick-pointerevent-members.html
  634. share/doc/qt5/qtquick/qml-qtquick-pointerevent.html
  635. share/doc/qt5/qtquick/qml-qtquick-shapes-conicalgradient-members.html
  636. share/doc/qt5/qtquick/qml-qtquick-shapes-conicalgradient.html
  637. share/doc/qt5/qtquick/qml-qtquick-shapes-lineargradient-members.html
  638. share/doc/qt5/qtquick/qml-qtquick-shapes-lineargradient.html
  639. share/doc/qt5/qtquick/qml-qtquick-shapes-radialgradient-members.html
  640. share/doc/qt5/qtquick/qml-qtquick-shapes-radialgradient.html
  641. share/doc/qt5/qtquick/qml-qtquick-shapes-shape-members.html
  642. share/doc/qt5/qtquick/qml-qtquick-shapes-shape.html
  643. share/doc/qt5/qtquick/qml-qtquick-shapes-shapegradient-members.html
  644. share/doc/qt5/qtquick/qml-qtquick-shapes-shapegradient.html
  645. share/doc/qt5/qtquick/qml-qtquick-shapes-shapepath-members.html
  646. share/doc/qt5/qtquick/qml-qtquick-shapes-shapepath.html
  647. share/doc/qt5/qtquick/qt-labs-handlers-qmlmodule.html
  648. share/doc/qt5/qtquick/qtquick-shapes-content-clippedtigers-qml.html
  649. share/doc/qt5/qtquick/qtquick-shapes-content-interactive-qml.html
  650. share/doc/qt5/qtquick/qtquick-shapes-content-item1-qml.html
  651. share/doc/qt5/qtquick/qtquick-shapes-content-item10-qml.html
  652. share/doc/qt5/qtquick/qtquick-shapes-content-item11-qml.html
  653. share/doc/qt5/qtquick/qtquick-shapes-content-item12-qml.html
  654. share/doc/qt5/qtquick/qtquick-shapes-content-item13-qml.html
  655. share/doc/qt5/qtquick/qtquick-shapes-content-item14-qml.html
  656. share/doc/qt5/qtquick/qtquick-shapes-content-item15-qml.html
  657. share/doc/qt5/qtquick/qtquick-shapes-content-item17-qml.html
  658. share/doc/qt5/qtquick/qtquick-shapes-content-item2-qml.html
  659. share/doc/qt5/qtquick/qtquick-shapes-content-item3-qml.html
  660. share/doc/qt5/qtquick/qtquick-shapes-content-item4-qml.html
  661. share/doc/qt5/qtquick/qtquick-shapes-content-item5-qml.html
  662. share/doc/qt5/qtquick/qtquick-shapes-content-item6-qml.html
  663. share/doc/qt5/qtquick/qtquick-shapes-content-item7-qml.html
  664. share/doc/qt5/qtquick/qtquick-shapes-content-item8-qml.html
  665. share/doc/qt5/qtquick/qtquick-shapes-content-item9-qml.html
  666. share/doc/qt5/qtquick/qtquick-shapes-content-main-qml.html
  667. share/doc/qt5/qtquick/qtquick-shapes-content-sampling-qml.html
  668. share/doc/qt5/qtquick/qtquick-shapes-content-shapegallery-qml.html
  669. share/doc/qt5/qtquick/qtquick-shapes-content-tiger-qml.html
  670. share/doc/qt5/qtquick/qtquick-shapes-example.html
  671. share/doc/qt5/qtquick/qtquick-shapes-main-cpp.html
  672. share/doc/qt5/qtquick/qtquick-shapes-qmlmodule.html
  673. share/doc/qt5/qtquick/qtquick-shapes-shapes-pro.html
  674. share/doc/qt5/qtquick/qtquick-shapes-shapes-qrc.html
  675. share/doc/qt5/qtquick/qtquickhandlers-index.html
  676. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/editcopy.png
  677. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/editcut.png
  678. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/editpaste.png
  679. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/editredo.png
  680. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/editundo.png
  681. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/exportpdf.png
  682. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/filenew.png
  683. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/fileopen.png
  684. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/fileprint.png
  685. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/filesave.png
  686. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/qt-logo.png
  687. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textbold.png
  688. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textcenter.png
  689. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textitalic.png
  690. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textjustify.png
  691. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textleft.png
  692. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textright.png
  693. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/textunder.png
  694. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/zoomin.png
  695. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/qml/images/zoomout.png
  696. share/doc/qt5/qtquickcontrols2/images/applicationwindow-background.png
  697. share/doc/qt5/qtquickcontrols2/images/applicationwindow-overlay-modal.png
  698. share/doc/qt5/qtquickcontrols2/images/applicationwindow-overlay.png
  699. share/doc/qt5/qtquickcontrols2/images/button-background-checked-disabled.9.png
  700. share/doc/qt5/qtquickcontrols2/images/button-background-checked-focused.9.png
  701. share/doc/qt5/qtquickcontrols2/images/button-background-checked-hovered.9.png
  702. share/doc/qt5/qtquickcontrols2/images/button-background-checked.9.png
  703. share/doc/qt5/qtquickcontrols2/images/button-background-disabled.9.png
  704. share/doc/qt5/qtquickcontrols2/images/button-background-flat-checked.9.png
  705. share/doc/qt5/qtquickcontrols2/images/button-background-flat-disabled.9.png
  706. share/doc/qt5/qtquickcontrols2/images/button-background-flat-hovered.9.png
  707. share/doc/qt5/qtquickcontrols2/images/button-background-flat-pressed.9.png
  708. share/doc/qt5/qtquickcontrols2/images/button-background-flat.9.png
  709. share/doc/qt5/qtquickcontrols2/images/button-background-focused.9.png
  710. share/doc/qt5/qtquickcontrols2/images/button-background-highlighted-checked.9.png
  711. share/doc/qt5/qtquickcontrols2/images/button-background-highlighted-disabled.9.png
  712. share/doc/qt5/qtquickcontrols2/images/button-background-highlighted-focused.9.png
  713. share/doc/qt5/qtquickcontrols2/images/button-background-highlighted-hovered.9.png
  714. share/doc/qt5/qtquickcontrols2/images/button-background-highlighted-pressed.9.png
  715. share/doc/qt5/qtquickcontrols2/images/button-background-highlighted.9.png
  716. share/doc/qt5/qtquickcontrols2/images/button-background-hovered.9.png
  717. share/doc/qt5/qtquickcontrols2/images/button-background-pressed.9.png
  718. share/doc/qt5/qtquickcontrols2/images/button-background.9.png
  719. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-checked-focused.png
  720. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-checked-hovered.png
  721. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-checked-pressed.png
  722. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-checked.png
  723. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-disabled.png
  724. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-focused.png
  725. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-hovered.png
  726. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-partially-checked-focused.png
  727. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-partially-checked-hovered.png
  728. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-partially-checked-pressed.png
  729. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-partially-checked.png
  730. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator-pressed.png
  731. share/doc/qt5/qtquickcontrols2/images/checkbox-indicator.png
  732. share/doc/qt5/qtquickcontrols2/images/checkdelegate-background-disabled.9.png
  733. share/doc/qt5/qtquickcontrols2/images/checkdelegate-background-focused.9.png
  734. share/doc/qt5/qtquickcontrols2/images/checkdelegate-background-hovered.9.png
  735. share/doc/qt5/qtquickcontrols2/images/checkdelegate-background-pressed.9.png
  736. share/doc/qt5/qtquickcontrols2/images/checkdelegate-background.9.png
  737. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-checked-focused.png
  738. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-checked-hovered.png
  739. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-checked-pressed.png
  740. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-checked.png
  741. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-disabled.png
  742. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-focused.png
  743. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-hovered.png
  744. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-partially-checked-focused.png
  745. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-partially-checked-hovered.png
  746. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-partially-checked-pressed.png
  747. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-partially-checked.png
  748. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator-pressed.png
  749. share/doc/qt5/qtquickcontrols2/images/checkdelegate-indicator.png
  750. share/doc/qt5/qtquickcontrols2/images/combobox-background-disabled.9.png
  751. share/doc/qt5/qtquickcontrols2/images/combobox-background-editable-disabled.9.png
  752. share/doc/qt5/qtquickcontrols2/images/combobox-background-editable-focused.9.png
  753. share/doc/qt5/qtquickcontrols2/images/combobox-background-editable.9.png
  754. share/doc/qt5/qtquickcontrols2/images/combobox-background-focused.9.png
  755. share/doc/qt5/qtquickcontrols2/images/combobox-background-hovered.9.png
  756. share/doc/qt5/qtquickcontrols2/images/combobox-background-open.9.png
  757. share/doc/qt5/qtquickcontrols2/images/combobox-background-pressed.9.png
  758. share/doc/qt5/qtquickcontrols2/images/combobox-background.9.png
  759. share/doc/qt5/qtquickcontrols2/images/combobox-indicator-disabled.png
  760. share/doc/qt5/qtquickcontrols2/images/combobox-indicator-editable-disabled.png
  761. share/doc/qt5/qtquickcontrols2/images/combobox-indicator-editable-mirrored-disabled.png
  762. share/doc/qt5/qtquickcontrols2/images/combobox-indicator-editable-mirrored.png
  763. share/doc/qt5/qtquickcontrols2/images/combobox-indicator-editable.png
  764. share/doc/qt5/qtquickcontrols2/images/combobox-indicator.png
  765. share/doc/qt5/qtquickcontrols2/images/combobox-popup.9.png
  766. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-checked-focused.9.png
  767. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-checked-hovered.9.png
  768. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-checked.9.png
  769. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-disabled-checked.9.png
  770. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-disabled.9.png
  771. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-focused.9.png
  772. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-hovered.9.png
  773. share/doc/qt5/qtquickcontrols2/images/delaybutton-background-pressed.9.png
  774. share/doc/qt5/qtquickcontrols2/images/delaybutton-background.9.png
  775. share/doc/qt5/qtquickcontrols2/images/delaybutton-mask.9.png
  776. share/doc/qt5/qtquickcontrols2/images/delaybutton-progress-disabled.9.png
  777. share/doc/qt5/qtquickcontrols2/images/delaybutton-progress.9.png
  778. share/doc/qt5/qtquickcontrols2/images/dial-background-disabled.png
  779. share/doc/qt5/qtquickcontrols2/images/dial-background-focused.png
  780. share/doc/qt5/qtquickcontrols2/images/dial-background.png
  781. share/doc/qt5/qtquickcontrols2/images/dial-handle-disabled.png
  782. share/doc/qt5/qtquickcontrols2/images/dial-handle-focused-hovered.png
  783. share/doc/qt5/qtquickcontrols2/images/dial-handle-focused-pressed.png
  784. share/doc/qt5/qtquickcontrols2/images/dial-handle-focused.png
  785. share/doc/qt5/qtquickcontrols2/images/dial-handle-hovered.png
  786. share/doc/qt5/qtquickcontrols2/images/dial-handle-pressed.png
  787. share/doc/qt5/qtquickcontrols2/images/dial-handle.png
  788. share/doc/qt5/qtquickcontrols2/images/dialog-background.9.png
  789. share/doc/qt5/qtquickcontrols2/images/dialog-overlay-modal.png
  790. share/doc/qt5/qtquickcontrols2/images/dialog-overlay.png
  791. share/doc/qt5/qtquickcontrols2/images/dialogbuttonbox-background.9.png
  792. share/doc/qt5/qtquickcontrols2/images/drawer-background-bottom.9.png
  793. share/doc/qt5/qtquickcontrols2/images/drawer-background-left.9.png
  794. share/doc/qt5/qtquickcontrols2/images/drawer-background-right.9.png
  795. share/doc/qt5/qtquickcontrols2/images/drawer-background-top.9.png
  796. share/doc/qt5/qtquickcontrols2/images/drawer-overlay-modal.png
  797. share/doc/qt5/qtquickcontrols2/images/drawer-overlay.png
  798. share/doc/qt5/qtquickcontrols2/images/frame-background.9.png
  799. share/doc/qt5/qtquickcontrols2/images/groupbox-background.9.png
  800. share/doc/qt5/qtquickcontrols2/images/groupbox-title.9.png
  801. share/doc/qt5/qtquickcontrols2/images/itemdelegate-background-disabled.9.png
  802. share/doc/qt5/qtquickcontrols2/images/itemdelegate-background-focused.9.png
  803. share/doc/qt5/qtquickcontrols2/images/itemdelegate-background-highlighted.9.png
  804. share/doc/qt5/qtquickcontrols2/images/itemdelegate-background-hovered.9.png
  805. share/doc/qt5/qtquickcontrols2/images/itemdelegate-background-pressed.9.png
  806. share/doc/qt5/qtquickcontrols2/images/itemdelegate-background.9.png
  807. share/doc/qt5/qtquickcontrols2/images/menu-background.9.png
  808. share/doc/qt5/qtquickcontrols2/images/menuitem-arrow-disabled.png
  809. share/doc/qt5/qtquickcontrols2/images/menuitem-arrow-mirrored-disabled.png
  810. share/doc/qt5/qtquickcontrols2/images/menuitem-arrow-mirrored.png
  811. share/doc/qt5/qtquickcontrols2/images/menuitem-arrow.png
  812. share/doc/qt5/qtquickcontrols2/images/menuitem-background-highlighted.9.png
  813. share/doc/qt5/qtquickcontrols2/images/menuitem-background.9.png
  814. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-checked-focused.png
  815. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-checked-hovered.png
  816. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-checked-pressed.png
  817. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-checked.png
  818. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-disabled.png
  819. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-focused.png
  820. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-hovered.png
  821. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator-pressed.png
  822. share/doc/qt5/qtquickcontrols2/images/menuitem-indicator.png
  823. share/doc/qt5/qtquickcontrols2/images/menuseparator-separator.9.png
  824. share/doc/qt5/qtquickcontrols2/images/page-background.png
  825. share/doc/qt5/qtquickcontrols2/images/pageindicator-delegate-current.png
  826. share/doc/qt5/qtquickcontrols2/images/pageindicator-delegate-disabled-current.png
  827. share/doc/qt5/qtquickcontrols2/images/pageindicator-delegate-disabled.png
  828. share/doc/qt5/qtquickcontrols2/images/pageindicator-delegate-pressed.png
  829. share/doc/qt5/qtquickcontrols2/images/pageindicator-delegate.png
  830. share/doc/qt5/qtquickcontrols2/images/pane-background.9.png
  831. share/doc/qt5/qtquickcontrols2/images/popup-background.9.png
  832. share/doc/qt5/qtquickcontrols2/images/popup-overlay-modal.png
  833. share/doc/qt5/qtquickcontrols2/images/popup-overlay.png
  834. share/doc/qt5/qtquickcontrols2/images/progressbar-background.9.png
  835. share/doc/qt5/qtquickcontrols2/images/progressbar-mask.9.png
  836. share/doc/qt5/qtquickcontrols2/images/progressbar-progress.png
  837. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-automotive.png
  838. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-icononly.png
  839. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-textbesideicon.png
  840. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-textonly.png
  841. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-fusion-palettes.png
  842. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-fusion-thumbnail.png
  843. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-fusion-violet.png
  844. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-fusion.png
  845. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-9-patch-4x.png
  846. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-9-patch-inset-boundaries.png
  847. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-9-patch-inset.png
  848. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-9-patch-resized-padding.png
  849. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-9-patch-resized-stretchable.png
  850. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-9-patch-size.png
  851. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-customization-dark.png
  852. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine-thumbnail.png
  853. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-imagine.png
  854. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menu-custom.png
  855. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menubar-custom.png
  856. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menubar.png
  857. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-musicplayer.png
  858. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-checked-focused.png
  859. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-checked-hovered.png
  860. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-checked-pressed.png
  861. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-checked.png
  862. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-disabled.png
  863. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-focused.png
  864. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-hovered.png
  865. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator-pressed.png
  866. share/doc/qt5/qtquickcontrols2/images/radiobutton-indicator.png
  867. share/doc/qt5/qtquickcontrols2/images/radiodelegate-background-disabled.9.png
  868. share/doc/qt5/qtquickcontrols2/images/radiodelegate-background-focused.9.png
  869. share/doc/qt5/qtquickcontrols2/images/radiodelegate-background-hovered.9.png
  870. share/doc/qt5/qtquickcontrols2/images/radiodelegate-background-pressed.9.png
  871. share/doc/qt5/qtquickcontrols2/images/radiodelegate-background.9.png
  872. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-checked-focused.png
  873. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-checked-hovered.png
  874. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-checked-pressed.png
  875. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-checked.png
  876. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-disabled.png
  877. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-focused.png
  878. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-hovered.png
  879. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator-pressed.png
  880. share/doc/qt5/qtquickcontrols2/images/radiodelegate-indicator.png
  881. share/doc/qt5/qtquickcontrols2/images/rangeslider-background-horizontal.9.png
  882. share/doc/qt5/qtquickcontrols2/images/rangeslider-background-vertical.9.png
  883. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle-disabled.png
  884. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle-focused-hovered.png
  885. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle-focused-pressed.png
  886. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle-focused.png
  887. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle-hovered.png
  888. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle-pressed.png
  889. share/doc/qt5/qtquickcontrols2/images/rangeslider-handle.png
  890. share/doc/qt5/qtquickcontrols2/images/rangeslider-progress-horizontal-disabled.9.png
  891. share/doc/qt5/qtquickcontrols2/images/rangeslider-progress-horizontal.9.png
  892. share/doc/qt5/qtquickcontrols2/images/rangeslider-progress-vertical-disabled.9.png
  893. share/doc/qt5/qtquickcontrols2/images/rangeslider-progress-vertical.9.png
  894. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-checked-focused.png
  895. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-checked-hovered.png
  896. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-checked.png
  897. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-disabled-checked.png
  898. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-disabled.png
  899. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-focused.png
  900. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-highlighted-focused.png
  901. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-highlighted-hovered.png
  902. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-highlighted-pressed.png
  903. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-highlighted.png
  904. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-hovered.png
  905. share/doc/qt5/qtquickcontrols2/images/roundbutton-background-pressed.png
  906. share/doc/qt5/qtquickcontrols2/images/roundbutton-background.png
  907. share/doc/qt5/qtquickcontrols2/images/scrollbar-handle-disabled.png
  908. share/doc/qt5/qtquickcontrols2/images/scrollbar-handle-interactive-disabled.png
  909. share/doc/qt5/qtquickcontrols2/images/scrollbar-handle-interactive-hovered.png
  910. share/doc/qt5/qtquickcontrols2/images/scrollbar-handle-interactive-pressed.png
  911. share/doc/qt5/qtquickcontrols2/images/scrollbar-handle-interactive.png
  912. share/doc/qt5/qtquickcontrols2/images/scrollbar-handle.png
  913. share/doc/qt5/qtquickcontrols2/images/scrollindicator-handle.png
  914. share/doc/qt5/qtquickcontrols2/images/slider-background-horizontal.9.png
  915. share/doc/qt5/qtquickcontrols2/images/slider-background-vertical.9.png
  916. share/doc/qt5/qtquickcontrols2/images/slider-handle-disabled.png
  917. share/doc/qt5/qtquickcontrols2/images/slider-handle-focused-hovered.png
  918. share/doc/qt5/qtquickcontrols2/images/slider-handle-focused-pressed.png
  919. share/doc/qt5/qtquickcontrols2/images/slider-handle-focused.png
  920. share/doc/qt5/qtquickcontrols2/images/slider-handle-hovered.png
  921. share/doc/qt5/qtquickcontrols2/images/slider-handle-pressed.png
  922. share/doc/qt5/qtquickcontrols2/images/slider-handle.png
  923. share/doc/qt5/qtquickcontrols2/images/slider-progress-horizontal-disabled.9.png
  924. share/doc/qt5/qtquickcontrols2/images/slider-progress-horizontal.9.png
  925. share/doc/qt5/qtquickcontrols2/images/slider-progress-vertical-disabled.9.png
  926. share/doc/qt5/qtquickcontrols2/images/slider-progress-vertical.9.png
  927. share/doc/qt5/qtquickcontrols2/images/spinbox-background-disabled.9.png
  928. share/doc/qt5/qtquickcontrols2/images/spinbox-background-editable.9.png
  929. share/doc/qt5/qtquickcontrols2/images/spinbox-background-focused.9.png
  930. share/doc/qt5/qtquickcontrols2/images/spinbox-background.9.png
  931. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-disabled.9.png
  932. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-editable-focused.9.png
  933. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-editable-hovered.9.png
  934. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-editable-mirrored.9.png
  935. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-editable-pressed.9.png
  936. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-editable.9.png
  937. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-focused.9.png
  938. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-hovered.9.png
  939. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-mirrored.9.png
  940. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down-pressed.9.png
  941. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-down.9.png
  942. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-disabled.9.png
  943. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-editable-focused.9.png
  944. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-editable-hovered.9.png
  945. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-editable-mirrored.9.png
  946. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-editable-pressed.9.png
  947. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-editable.9.png
  948. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-focused.9.png
  949. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-hovered.9.png
  950. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-mirrored.9.png
  951. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up-pressed.9.png
  952. share/doc/qt5/qtquickcontrols2/images/spinbox-indicator-up.9.png
  953. share/doc/qt5/qtquickcontrols2/images/swipedelegate-background-disabled.9.png
  954. share/doc/qt5/qtquickcontrols2/images/swipedelegate-background-focused.9.png
  955. share/doc/qt5/qtquickcontrols2/images/swipedelegate-background-hovered.9.png
  956. share/doc/qt5/qtquickcontrols2/images/swipedelegate-background-pressed.9.png
  957. share/doc/qt5/qtquickcontrols2/images/swipedelegate-background.9.png
  958. share/doc/qt5/qtquickcontrols2/images/switch-handle-disabled.png
  959. share/doc/qt5/qtquickcontrols2/images/switch-handle-pressed.png
  960. share/doc/qt5/qtquickcontrols2/images/switch-handle.png
  961. share/doc/qt5/qtquickcontrols2/images/switch-indicator-checked-focused.png
  962. share/doc/qt5/qtquickcontrols2/images/switch-indicator-checked-hovered.png
  963. share/doc/qt5/qtquickcontrols2/images/switch-indicator-checked-pressed.png
  964. share/doc/qt5/qtquickcontrols2/images/switch-indicator-checked.png
  965. share/doc/qt5/qtquickcontrols2/images/switch-indicator-disabled.png
  966. share/doc/qt5/qtquickcontrols2/images/switch-indicator-focused.png
  967. share/doc/qt5/qtquickcontrols2/images/switch-indicator-hovered.png
  968. share/doc/qt5/qtquickcontrols2/images/switch-indicator-pressed.png
  969. share/doc/qt5/qtquickcontrols2/images/switch-indicator.png
  970. share/doc/qt5/qtquickcontrols2/images/switchdelegate-background-disabled.9.png
  971. share/doc/qt5/qtquickcontrols2/images/switchdelegate-background-focused.9.png
  972. share/doc/qt5/qtquickcontrols2/images/switchdelegate-background-hovered.9.png
  973. share/doc/qt5/qtquickcontrols2/images/switchdelegate-background-pressed.9.png
  974. share/doc/qt5/qtquickcontrols2/images/switchdelegate-background.9.png
  975. share/doc/qt5/qtquickcontrols2/images/switchdelegate-handle-disabled.png
  976. share/doc/qt5/qtquickcontrols2/images/switchdelegate-handle.png
  977. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-checked-focused.png
  978. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-checked-hovered.png
  979. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-checked-pressed.png
  980. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-checked.png
  981. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-disabled.png
  982. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-focused.png
  983. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-hovered.png
  984. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator-pressed.png
  985. share/doc/qt5/qtquickcontrols2/images/switchdelegate-indicator.png
  986. share/doc/qt5/qtquickcontrols2/images/tabbar-background.png
  987. share/doc/qt5/qtquickcontrols2/images/tabbutton-background-checked.9.png
  988. share/doc/qt5/qtquickcontrols2/images/tabbutton-background-disabled-checked.9.png
  989. share/doc/qt5/qtquickcontrols2/images/tabbutton-background-disabled.9.png
  990. share/doc/qt5/qtquickcontrols2/images/tabbutton-background-hovered.9.png
  991. share/doc/qt5/qtquickcontrols2/images/tabbutton-background-pressed.9.png
  992. share/doc/qt5/qtquickcontrols2/images/tabbutton-background.9.png
  993. share/doc/qt5/qtquickcontrols2/images/textarea-background-disabled.9.png
  994. share/doc/qt5/qtquickcontrols2/images/textarea-background-focused.9.png
  995. share/doc/qt5/qtquickcontrols2/images/textarea-background.9.png
  996. share/doc/qt5/qtquickcontrols2/images/textfield-background-disabled.9.png
  997. share/doc/qt5/qtquickcontrols2/images/textfield-background-focused.9.png
  998. share/doc/qt5/qtquickcontrols2/images/textfield-background.9.png
  999. share/doc/qt5/qtquickcontrols2/images/toolbar-background.png
  1000. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-checked-focused.9.png
  1001. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-checked-hovered.9.png
  1002. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-checked.9.png
  1003. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-disabled-checked.9.png
  1004. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-focused.9.png
  1005. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-hovered.9.png
  1006. share/doc/qt5/qtquickcontrols2/images/toolbutton-background-pressed.9.png
  1007. share/doc/qt5/qtquickcontrols2/images/toolbutton-background.9.png
  1008. share/doc/qt5/qtquickcontrols2/images/toolseparator-separator-horizontal.9.png
  1009. share/doc/qt5/qtquickcontrols2/images/toolseparator-separator-vertical.9.png
  1010. share/doc/qt5/qtquickcontrols2/images/tooltip-background.9.png
  1011. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Albert_Einstein.png
  1012. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Albert_Einstein@2x.png
  1013. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Albert_Einstein@3x.png
  1014. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Albert_Einstein@4x.png
  1015. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Ernest_Hemingway.png
  1016. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@2x.png
  1017. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@3x.png
  1018. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@4x.png
  1019. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Hans_Gude.png
  1020. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Hans_Gude@2x.png
  1021. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Hans_Gude@3x.png
  1022. share/doc/qt5/qtquickcontrols2/images/used-in-examples/chattutorial/shared/Hans_Gude@4x.png
  1023. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20/back.png
  1024. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20/drawer.png
  1025. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20/menu.png
  1026. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@2/back.png
  1027. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@2/drawer.png
  1028. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@2/menu.png
  1029. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@3/back.png
  1030. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@3/drawer.png
  1031. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@3/menu.png
  1032. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@4/back.png
  1033. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@4/drawer.png
  1034. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/icons/gallery/20x20@4/menu.png
  1035. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/alarms.png
  1036. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/fitness.png
  1037. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/navigation.png
  1038. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/notifications.png
  1039. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/settings.png
  1040. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/weather.png
  1041. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36/worldclock.png
  1042. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/alarms.png
  1043. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/fitness.png
  1044. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/navigation.png
  1045. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/notifications.png
  1046. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/settings.png
  1047. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/weather.png
  1048. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/icons/wearable/36x36@2/worldclock.png
  1049. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Fitness/images/man-running.png
  1050. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Fitness/images/man-running@2x.png
  1051. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Fitness/images/man-walking.png
  1052. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Fitness/images/man-walking@2x.png
  1053. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/end.png
  1054. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/end@2x.png
  1055. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/leftturn.png
  1056. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/leftturn@2x.png
  1057. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/marker.png
  1058. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/navigation.png
  1059. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/navigation@2x.png
  1060. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/rightturn.png
  1061. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/rightturn@2x.png
  1062. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/start.png
  1063. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/start@2x.png
  1064. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/straight.png
  1065. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/straight@2x.png
  1066. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/uturn.png
  1067. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Navigation/images/uturn@2x.png
  1068. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Notifications/images/avatarf.png
  1069. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Notifications/images/avatarf@2x.png
  1070. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Notifications/images/avatarm.png
  1071. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Notifications/images/avatarm@2x.png
  1072. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Notifications/images/missedcall.png
  1073. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Notifications/images/missedcall@2x.png
  1074. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/bluetooth.png
  1075. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/bluetooth@2x.png
  1076. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/brightness.png
  1077. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/brightness@2x.png
  1078. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/contrast.png
  1079. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/contrast@2x.png
  1080. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/wifi.png
  1081. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Settings/images/wifi@2x.png
  1082. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/humidity.png
  1083. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/humidity@2x.png
  1084. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/pressure.png
  1085. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/pressure@2x.png
  1086. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/sunrise.png
  1087. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/sunrise@2x.png
  1088. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/sunset.png
  1089. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/sunset@2x.png
  1090. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/temperature.png
  1091. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/temperature@2x.png
  1092. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/wind.png
  1093. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/Weather/images/wind@2x.png
  1094. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/center.png
  1095. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/center@2x.png
  1096. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/clock-night.png
  1097. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/clock-night@2x.png
  1098. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/clock.png
  1099. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/second.png
  1100. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/second@2x.png
  1101. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissdaydial.png
  1102. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissdaydial@2x.png
  1103. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissdayhour.png
  1104. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissdayhour@2x.png
  1105. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissdayminute.png
  1106. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissdayminute@2x.png
  1107. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissnightdial.png
  1108. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissnightdial@2x.png
  1109. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissnighthour.png
  1110. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissnighthour@2x.png
  1111. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissnightminute.png
  1112. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissnightminute@2x.png
  1113. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/qml/WorldClock/images/swissseconds.png
  1114. share/doc/qt5/qtquickcontrols2/qml-palette.html
  1115. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-action-members.html
  1116. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-action.html
  1117. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-actiongroup-members.html
  1118. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-actiongroup.html
  1119. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-applicationwindow-obsolete.html
  1120. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-container-obsolete.html
  1121. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menu-obsolete.html
  1122. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menubar-members.html
  1123. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menubar.html
  1124. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menubaritem-members.html
  1125. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menubaritem.html
  1126. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-overlay-members.html
  1127. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-overlay.html
  1128. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-automotive-example.html
  1129. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-fusion.html
  1130. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-icons.html
  1131. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-imagine.html
  1132. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-musicplayer-example.html
  1133. share/doc/qt5/qtsensors/images/used-in-examples/grue/grue.png
  1134. share/doc/qt5/qtsensors/images/used-in-examples/maze/components/images/button_background_disabled.png
  1135. share/doc/qt5/qtsensors/images/used-in-examples/maze/components/images/button_background_normal.png
  1136. share/doc/qt5/qtsensors/images/used-in-examples/maze/components/images/button_background_pressed.png
  1137. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/00.png
  1138. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/01.png
  1139. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/cheese.png
  1140. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/cheeseeating.gif
  1141. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/congratulations.gif
  1142. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/mouse_down.gif
  1143. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/start.png
  1144. share/doc/qt5/qtsensors/images/used-in-examples/qmlqtsensors/components/images/button_background_disabled.png
  1145. share/doc/qt5/qtsensors/images/used-in-examples/qmlqtsensors/components/images/button_background_normal.png
  1146. share/doc/qt5/qtsensors/images/used-in-examples/qmlqtsensors/components/images/button_background_pressed.png
  1147. share/doc/qt5/qtsensors/images/used-in-examples/shakeit/content/triangle.png
  1148. share/doc/qt5/qtsensors/images/used-in-examples/shakeit/content/triangle2.png
  1149. share/doc/qt5/qtsensors/images/used-in-examples/shakeit/content/triangle3.png
  1150. share/doc/qt5/qtserialbus/qtserialbus-can-sendframebox-cpp.html
  1151. share/doc/qt5/qtserialbus/qtserialbus-can-sendframebox-h.html
  1152. share/doc/qt5/qtserialbus/qtserialbus-can-sendframebox-ui.html
  1153. share/doc/qt5/qtspeech.qch
  1154. share/doc/qt5/qtspeech/examples-manifest.xml
  1155. share/doc/qt5/qtspeech/images/arrow_bc.png
  1156. share/doc/qt5/qtspeech/images/bgrContent.png
  1157. share/doc/qt5/qtspeech/images/btn_next.png
  1158. share/doc/qt5/qtspeech/images/btn_prev.png
  1159. share/doc/qt5/qtspeech/images/bullet_dn.png
  1160. share/doc/qt5/qtspeech/images/bullet_sq.png
  1161. share/doc/qt5/qtspeech/images/hellospeak-example.png
  1162. share/doc/qt5/qtspeech/images/home.png
  1163. share/doc/qt5/qtspeech/images/ico_note.png
  1164. share/doc/qt5/qtspeech/images/ico_note_attention.png
  1165. share/doc/qt5/qtspeech/images/ico_out.png
  1166. share/doc/qt5/qtspeech/images/logo.png
  1167. share/doc/qt5/qtspeech/legal-flite.html
  1168. share/doc/qt5/qtspeech/qtexttospeech-members.html
  1169. share/doc/qt5/qtspeech/qtexttospeech.html
  1170. share/doc/qt5/qtspeech/qtexttospeechplugin-members.html
  1171. share/doc/qt5/qtspeech/qtexttospeechplugin.html
  1172. share/doc/qt5/qtspeech/qtspeech-hello-speak-example.html
  1173. share/doc/qt5/qtspeech/qtspeech-hello-speak-hello-speak-pro.html
  1174. share/doc/qt5/qtspeech/qtspeech-hello-speak-main-cpp.html
  1175. share/doc/qt5/qtspeech/qtspeech-hello-speak-mainwindow-cpp.html
  1176. share/doc/qt5/qtspeech/qtspeech-hello-speak-mainwindow-h.html
  1177. share/doc/qt5/qtspeech/qtspeech-hello-speak-mainwindow-ui.html
  1178. share/doc/qt5/qtspeech/qtspeech-index.html
  1179. share/doc/qt5/qtspeech/qtspeech-module.html
  1180. share/doc/qt5/qtspeech/qtspeech.index
  1181. share/doc/qt5/qtspeech/qtspeech.qhp
  1182. share/doc/qt5/qtspeech/qtspeech.qhp.sha1
  1183. share/doc/qt5/qtspeech/qtspeech.tags
  1184. share/doc/qt5/qtspeech/qvoice-members.html
  1185. share/doc/qt5/qtspeech/qvoice.html
  1186. share/doc/qt5/qtspeech/style/offline-simple.css
  1187. share/doc/qt5/qtspeech/style/offline.css
  1188. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv6-members.html
  1189. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv6.html
  1190. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv6-members.html
  1191. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv6.html
  1192. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev6-members.html
  1193. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev6.html
  1194. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevelv6-members.html
  1195. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevelv6.html
  1196. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv6-members.html
  1197. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv6.html
  1198. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv6-members.html
  1199. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv6.html
  1200. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev6-members.html
  1201. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev6.html
  1202. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevelv6-members.html
  1203. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevelv6.html
  1204. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/accessories-dictionary.png
  1205. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/akregator.png
  1206. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/digikam.png
  1207. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/help-browser.png
  1208. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/k3b.png
  1209. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/kchart.png
  1210. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/background.png
  1211. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/boat.png
  1212. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/bomb.png
  1213. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step1.png
  1214. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step2.png
  1215. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step3.png
  1216. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step4.png
  1217. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step1.png
  1218. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step2.png
  1219. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step3.png
  1220. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step4.png
  1221. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/submarine.png
  1222. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/surface.png
  1223. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/torpedo.png
  1224. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/background.png
  1225. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/boat.png
  1226. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/bomb.png
  1227. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/submarine.png
  1228. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/surface.png
  1229. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/torpedo.png
  1230. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-a.png
  1231. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-a2.png
  1232. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-b.png
  1233. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-dash.png
  1234. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-excl.png
  1235. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-q.png
  1236. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-s.png
  1237. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-t.png
  1238. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-t2.png
  1239. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-u.png
  1240. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/puzzle/example.jpg
  1241. share/doc/qt5/qtwidgets/images/used-in-examples/effects/fademessage/background.jpg
  1242. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_negx.jpg
  1243. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_negy.jpg
  1244. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_negz.jpg
  1245. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_posx.jpg
  1246. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_posy.jpg
  1247. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_posz.jpg
  1248. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/qt-logo.jpg
  1249. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/qt-logo.png
  1250. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/smiley.png
  1251. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/square.jpg
  1252. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/fileprint.png
  1253. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/qt4logo.png
  1254. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/rotateleft.png
  1255. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/rotateright.png
  1256. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/zoomin.png
  1257. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/zoomout.png
  1258. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/embeddeddialogs/No-Ones-Laughing-3.jpg
  1259. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/puzzle/example.jpg
  1260. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/qt.png
  1261. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/titlebarCenter.png
  1262. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/titlebarLeft.png
  1263. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/titlebarRight.png
  1264. share/doc/qt5/qtwidgets/images/used-in-examples/painting/affine/bg1.jpg
  1265. share/doc/qt5/qtwidgets/images/used-in-examples/painting/composition/flower.jpg
  1266. share/doc/qt5/qtwidgets/images/used-in-examples/painting/composition/flower_alpha.jpg
  1267. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/background.png
  1268. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/blue.png
  1269. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/circle.png
  1270. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/exit.png
  1271. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/fileclose.png
  1272. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/filenew.png
  1273. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/fileopen.png
  1274. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/filesave.png
  1275. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/green.png
  1276. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/ok.png
  1277. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/rectangle.png
  1278. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/red.png
  1279. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/redo.png
  1280. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/remove.png
  1281. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/triangle.png
  1282. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/undo.png
  1283. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/movie/animation.gif
  1284. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/validators/ledoff.png
  1285. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/validators/ledon.png
  1286. share/doc/qt5/qtwidgets/images/windows-pushbutton.png
  1287. share/doc/qt5/qtwidgets/images/windowsvista-tabwidget.png
  1288. share/doc/qt5/qtwidgets/qplaintextedit-obsolete.html
  1289. share/doc/qt5/qtwidgets/qtextedit-obsolete.html
  1290. share/doc/qt5/activeqt.qch
  1291. share/doc/qt5/activeqt/activeqt-activeqt-comapp-comapp-pro.html
  1292. share/doc/qt5/activeqt/activeqt-activeqt-comapp-example.html
  1293. share/doc/qt5/activeqt/activeqt-activeqt-comapp-main-cpp.html
  1294. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-example.html
  1295. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-hierarchy-pro.html
  1296. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-main-cpp.html
  1297. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-objects-cpp.html
  1298. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-objects-h.html
  1299. share/doc/qt5/activeqt/activeqt-activeqt-menus-example.html
  1300. share/doc/qt5/activeqt/activeqt-activeqt-menus-main-cpp.html
  1301. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-cpp.html
  1302. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-h.html
  1303. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-pro.html
  1304. share/doc/qt5/activeqt/activeqt-activeqt-multiple-ax1-h.html
  1305. share/doc/qt5/activeqt/activeqt-activeqt-multiple-ax2-h.html
  1306. share/doc/qt5/activeqt/activeqt-activeqt-multiple-example.html
  1307. share/doc/qt5/activeqt/activeqt-activeqt-multiple-main-cpp.html
  1308. share/doc/qt5/activeqt/activeqt-activeqt-multiple-multiple-pro.html
  1309. share/doc/qt5/activeqt/activeqt-activeqt-opengl-example.html
  1310. share/doc/qt5/activeqt/activeqt-activeqt-opengl-glbox-cpp.html
  1311. share/doc/qt5/activeqt/activeqt-activeqt-opengl-glbox-h.html
  1312. share/doc/qt5/activeqt/activeqt-activeqt-opengl-globjwin-cpp.html
  1313. share/doc/qt5/activeqt/activeqt-activeqt-opengl-globjwin-h.html
  1314. share/doc/qt5/activeqt/activeqt-activeqt-opengl-main-cpp.html
  1315. share/doc/qt5/activeqt/activeqt-activeqt-opengl-opengl-pro.html
  1316. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-addressview-cpp.html
  1317. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-addressview-h.html
  1318. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-example.html
  1319. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-main-cpp.html
  1320. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-qutlook-pro.html
  1321. share/doc/qt5/activeqt/activeqt-activeqt-simple-example.html
  1322. share/doc/qt5/activeqt/activeqt-activeqt-simple-main-cpp.html
  1323. share/doc/qt5/activeqt/activeqt-activeqt-simple-simple-pro.html
  1324. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-example.html
  1325. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-main-cpp.html
  1326. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-mainwindow-ui.html
  1327. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-webaxwidget-h.html
  1328. share/doc/qt5/activeqt/activeqt-activeqt-webbrowser-webbrowser-pro.html
  1329. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-example.html
  1330. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-main-cpp.html
  1331. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-wrapper-pro.html
  1332. share/doc/qt5/activeqt/activeqt-container.html
  1333. share/doc/qt5/activeqt/activeqt-dotnet.html
  1334. share/doc/qt5/activeqt/activeqt-dumpcpp.html
  1335. share/doc/qt5/activeqt/activeqt-dumpdoc.html
  1336. share/doc/qt5/activeqt/activeqt-index.html
  1337. share/doc/qt5/activeqt/activeqt-server.html
  1338. share/doc/qt5/activeqt/activeqt-tools.html
  1339. share/doc/qt5/activeqt/activeqt.index
  1340. share/doc/qt5/activeqt/activeqt.qhp
  1341. share/doc/qt5/activeqt/activeqt.qhp.sha1
  1342. share/doc/qt5/activeqt/activeqt.tags
  1343. share/doc/qt5/activeqt/examples-manifest.xml
  1344. share/doc/qt5/activeqt/images/activeqt-webbrowser-example.png
  1345. share/doc/qt5/activeqt/images/arrow_bc.png
  1346. share/doc/qt5/activeqt/images/bgrContent.png
  1347. share/doc/qt5/activeqt/images/btn_next.png
  1348. share/doc/qt5/activeqt/images/btn_prev.png
  1349. share/doc/qt5/activeqt/images/bullet_dn.png
  1350. share/doc/qt5/activeqt/images/bullet_sq.png
  1351. share/doc/qt5/activeqt/images/home.png
  1352. share/doc/qt5/activeqt/images/ico_note.png
  1353. share/doc/qt5/activeqt/images/ico_note_attention.png
  1354. share/doc/qt5/activeqt/images/ico_out.png
  1355. share/doc/qt5/activeqt/images/logo.png
  1356. share/doc/qt5/activeqt/qaxaggregated-members.html
  1357. share/doc/qt5/activeqt/qaxaggregated.html
  1358. share/doc/qt5/activeqt/qaxbase-members.html
  1359. share/doc/qt5/activeqt/qaxbase.html
  1360. share/doc/qt5/activeqt/qaxbindable-members.html
  1361. share/doc/qt5/activeqt/qaxbindable.html
  1362. share/doc/qt5/activeqt/qaxcontainer-module.html
  1363. share/doc/qt5/activeqt/qaxfactory-members.html
  1364. share/doc/qt5/activeqt/qaxfactory.html
  1365. share/doc/qt5/activeqt/qaxobject-members.html
  1366. share/doc/qt5/activeqt/qaxobject.html
  1367. share/doc/qt5/activeqt/qaxscript-members.html
  1368. share/doc/qt5/activeqt/qaxscript.html
  1369. share/doc/qt5/activeqt/qaxscriptengine-members.html
  1370. share/doc/qt5/activeqt/qaxscriptengine.html
  1371. share/doc/qt5/activeqt/qaxscriptmanager-members.html
  1372. share/doc/qt5/activeqt/qaxscriptmanager.html
  1373. share/doc/qt5/activeqt/qaxselect-members.html
  1374. share/doc/qt5/activeqt/qaxselect.html
  1375. share/doc/qt5/activeqt/qaxserver-demo-hierarchy.html
  1376. share/doc/qt5/activeqt/qaxserver-demo-menus.html
  1377. share/doc/qt5/activeqt/qaxserver-demo-multiple.html
  1378. share/doc/qt5/activeqt/qaxserver-demo-opengl.html
  1379. share/doc/qt5/activeqt/qaxserver-demo-simple.html
  1380. share/doc/qt5/activeqt/qaxserver-demo-wrapper.html
  1381. share/doc/qt5/activeqt/qaxserver-module.html
  1382. share/doc/qt5/activeqt/qaxwidget-members.html
  1383. share/doc/qt5/activeqt/qaxwidget.html
  1384. share/doc/qt5/activeqt/style/offline-simple.css
  1385. share/doc/qt5/activeqt/style/offline.css
  1386. share/doc/qt5/qdoc.qch
  1387. share/doc/qt5/qdoc/01-qdoc-manual.html
  1388. share/doc/qt5/qdoc/03-qdoc-commands-markup.html
  1389. share/doc/qt5/qdoc/04-qdoc-commands-textmarkup.html
  1390. share/doc/qt5/qdoc/05-qdoc-commands-documentstructure.html
  1391. share/doc/qt5/qdoc/06-qdoc-commands-includecodeinline.html
  1392. share/doc/qt5/qdoc/07-0-qdoc-commands-includingexternalcode.html
  1393. share/doc/qt5/qdoc/08-qdoc-commands-creatinglinks.html
  1394. share/doc/qt5/qdoc/09-qdoc-commands-includingimages.html
  1395. share/doc/qt5/qdoc/10-qdoc-commands-tablesandlists.html
  1396. share/doc/qt5/qdoc/11-qdoc-commands-specialcontent.html
  1397. share/doc/qt5/qdoc/12-0-qdoc-commands-miscellaneous.html
  1398. share/doc/qt5/qdoc/13-qdoc-commands-topics.html
  1399. share/doc/qt5/qdoc/14-qdoc-commands-contextcommands.html
  1400. share/doc/qt5/qdoc/15-qdoc-commands-navigation.html
  1401. share/doc/qt5/qdoc/16-qdoc-commands-status.html
  1402. share/doc/qt5/qdoc/17-qdoc-commands-thread.html
  1403. share/doc/qt5/qdoc/18-qdoc-commands-relating.html
  1404. share/doc/qt5/qdoc/19-qdoc-commands-grouping.html
  1405. share/doc/qt5/qdoc/20-qdoc-commands-namingthings.html
  1406. share/doc/qt5/qdoc/21-0-qdoc-configuration.html
  1407. share/doc/qt5/qdoc/21-0-qdoc-creating-dita-maps.html
  1408. share/doc/qt5/qdoc/21-1-minimum-qdocconf.html
  1409. share/doc/qt5/qdoc/21-2-qtgui-qdocconf.html
  1410. share/doc/qt5/qdoc/21-3-qt-dita-xml-output.html
  1411. share/doc/qt5/qdoc/22-creating-help-project-files.html
  1412. share/doc/qt5/qdoc/22-qdoc-configuration-generalvariables.html
  1413. share/doc/qt5/qdoc/23-qdoc-configuration-cppvariables.html
  1414. share/doc/qt5/qdoc/24-qdoc-configuration-htmlvariables.html
  1415. share/doc/qt5/qdoc/25-qdoc-configuration-derivedprojects.html
  1416. share/doc/qt5/qdoc/26-qdoc-configuration-example-manifest-files.html
  1417. share/doc/qt5/qdoc/27-qdoc-commands-alphabetical.html
  1418. share/doc/qt5/qdoc/28-qdoc-qa-pages.html
  1419. share/doc/qt5/qdoc/corefeatures.html
  1420. share/doc/qt5/qdoc/examples-manifest.xml
  1421. share/doc/qt5/qdoc/images/arrow_bc.png
  1422. share/doc/qt5/qdoc/images/bgrContent.png
  1423. share/doc/qt5/qdoc/images/btn_next.png
  1424. share/doc/qt5/qdoc/images/btn_prev.png
  1425. share/doc/qt5/qdoc/images/bullet_dn.png
  1426. share/doc/qt5/qdoc/images/bullet_sq.png
  1427. share/doc/qt5/qdoc/images/happy.gif
  1428. share/doc/qt5/qdoc/images/happyguy.jpg
  1429. share/doc/qt5/qdoc/images/home.png
  1430. share/doc/qt5/qdoc/images/ico_note.png
  1431. share/doc/qt5/qdoc/images/ico_note_attention.png
  1432. share/doc/qt5/qdoc/images/ico_out.png
  1433. share/doc/qt5/qdoc/images/link-to-qquickitem.png
  1434. share/doc/qt5/qdoc/images/links-to-links.png
  1435. share/doc/qt5/qdoc/images/logo.png
  1436. share/doc/qt5/qdoc/images/qa-table.png
  1437. share/doc/qt5/qdoc/images/training.jpg
  1438. share/doc/qt5/qdoc/images/windowsvista-pushbutton.png
  1439. share/doc/qt5/qdoc/qdoc-categories.html
  1440. share/doc/qt5/qdoc/qdoc-componentset-componentset-pro.html
  1441. share/doc/qt5/qdoc/qdoc-componentset-example.html
  1442. share/doc/qt5/qdoc/qdoc-componentset-progressbar-qml.html
  1443. share/doc/qt5/qdoc/qdoc-componentset-switch-qml.html
  1444. share/doc/qt5/qdoc/qdoc-componentset-tabwidget-qml.html
  1445. share/doc/qt5/qdoc/qdoc-componentset-uicomponents-qdoc-sample.html
  1446. share/doc/qt5/qdoc/qdoc-guide-conf.html
  1447. share/doc/qt5/qdoc/qdoc-guide-writing.html
  1448. share/doc/qt5/qdoc/qdoc-guide.html
  1449. share/doc/qt5/qdoc/qdoc-index.html
  1450. share/doc/qt5/qdoc/qdoc-minimum-qdocconf.html
  1451. share/doc/qt5/qdoc/qdoc.index
  1452. share/doc/qt5/qdoc/qdoc.qhp
  1453. share/doc/qt5/qdoc/qdoc.qhp.sha1
  1454. share/doc/qt5/qdoc/qdoc.tags
  1455. share/doc/qt5/qdoc/qml-uicomponents-progressbar-members.html
  1456. share/doc/qt5/qdoc/qml-uicomponents-progressbar.html
  1457. share/doc/qt5/qdoc/qml-uicomponents-switch-members.html
  1458. share/doc/qt5/qdoc/qml-uicomponents-switch.html
  1459. share/doc/qt5/qdoc/qml-uicomponents-tabwidget-members.html
  1460. share/doc/qt5/qdoc/qml-uicomponents-tabwidget.html
  1461. share/doc/qt5/qdoc/qtgui-qdocconf.html
  1462. share/doc/qt5/qdoc/qtwritingstyle-cpp.html
  1463. share/doc/qt5/qdoc/qtwritingstyle-qml.html
  1464. share/doc/qt5/qdoc/style/offline-simple.css
  1465. share/doc/qt5/qdoc/style/offline.css
  1466. share/doc/qt5/qdoc/uicomponents-qmlmodule.html
  1467. share/doc/qt5/qmake.qch
  1468. share/doc/qt5/qmake/images/arrow_bc.png
  1469. share/doc/qt5/qmake/images/bgrContent.png
  1470. share/doc/qt5/qmake/images/btn_next.png
  1471. share/doc/qt5/qmake/images/btn_prev.png
  1472. share/doc/qt5/qmake/images/bullet_dn.png
  1473. share/doc/qt5/qmake/images/bullet_sq.png
  1474. share/doc/qt5/qmake/images/home.png
  1475. share/doc/qt5/qmake/images/ico_note.png
  1476. share/doc/qt5/qmake/images/ico_note_attention.png
  1477. share/doc/qt5/qmake/images/ico_out.png
  1478. share/doc/qt5/qmake/images/logo.png
  1479. share/doc/qt5/qmake/images/qmake-precompile-ui.png
  1480. share/doc/qt5/qmake/qmake-advanced-usage.html
  1481. share/doc/qt5/qmake/qmake-common-projects.html
  1482. share/doc/qt5/qmake/qmake-environment-reference.html
  1483. share/doc/qt5/qmake/qmake-function-reference.html
  1484. share/doc/qt5/qmake/qmake-language.html
  1485. share/doc/qt5/qmake/qmake-manual.html
  1486. share/doc/qt5/qmake/qmake-overview.html
  1487. share/doc/qt5/qmake/qmake-platform-notes.html
  1488. share/doc/qt5/qmake/qmake-precompiledheaders.html
  1489. share/doc/qt5/qmake/qmake-project-files.html
  1490. share/doc/qt5/qmake/qmake-reference.html
  1491. share/doc/qt5/qmake/qmake-running.html
  1492. share/doc/qt5/qmake/qmake-test-function-reference.html
  1493. share/doc/qt5/qmake/qmake-tutorial.html
  1494. share/doc/qt5/qmake/qmake-variable-reference.html
  1495. share/doc/qt5/qmake/qmake.index
  1496. share/doc/qt5/qmake/qmake.qhp
  1497. share/doc/qt5/qmake/qmake.qhp.sha1
  1498. share/doc/qt5/qmake/style/offline-simple.css
  1499. share/doc/qt5/qmake/style/offline.css
  1500. share/doc/qt5/qt3d.qch
  1501. share/doc/qt5/qt3d/examples-manifest.xml
  1502. share/doc/qt5/qt3d/images/Space-invaders.jpg
  1503. share/doc/qt5/qt3d/images/advanced-custom-material.jpg
  1504. share/doc/qt5/qt3d/images/arrow_bc.png
  1505. share/doc/qt5/qt3d/images/audio-visualizer-qml-example.png
  1506. share/doc/qt5/qt3d/images/basicshapes-cpp-example.jpg
  1507. share/doc/qt5/qt3d/images/bgrContent.png
  1508. share/doc/qt5/qt3d/images/btn_next.png
  1509. share/doc/qt5/qt3d/images/btn_prev.png
  1510. share/doc/qt5/qt3d/images/bullet_dn.png
  1511. share/doc/qt5/qt3d/images/bullet_sq.png
  1512. share/doc/qt5/qt3d/images/deferred-framegraph.png
  1513. share/doc/qt5/qt3d/images/ecs-1.png
  1514. share/doc/qt5/qt3d/images/ecs-2.png
  1515. share/doc/qt5/qt3d/images/framegraph-parallel-build.png
  1516. share/doc/qt5/qt3d/images/home.png
  1517. share/doc/qt5/qt3d/images/ico_note.png
  1518. share/doc/qt5/qt3d/images/ico_note_attention.png
  1519. share/doc/qt5/qt3d/images/ico_out.png
  1520. share/doc/qt5/qt3d/images/logo.png
  1521. share/doc/qt5/qt3d/images/materials-cpp.png
  1522. share/doc/qt5/qt3d/images/materials.png
  1523. share/doc/qt5/qt3d/images/multiviewport-1.png
  1524. share/doc/qt5/qt3d/images/multiviewport-2.png
  1525. share/doc/qt5/qt3d/images/multiviewport-qml-example.jpg
  1526. share/doc/qt5/qt3d/images/multiviewport.png
  1527. share/doc/qt5/qt3d/images/planets-qml-example.jpg
  1528. share/doc/qt5/qt3d/images/qt3d-wireframe-rendering.png
  1529. share/doc/qt5/qt3d/images/scene2d.png
  1530. share/doc/qt5/qt3d/images/scene3d.png
  1531. share/doc/qt5/qt3d/images/shadowmapping-depth.png
  1532. share/doc/qt5/qt3d/images/shadowmapping-qt3d.png
  1533. share/doc/qt5/qt3d/images/simple-cpp.png
  1534. share/doc/qt5/qt3d/images/simple-custom-material.jpg
  1535. share/doc/qt5/qt3d/images/simple-framegraph.png
  1536. share/doc/qt5/qt3d/images/simple-qml.png
  1537. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/albumcover.png
  1538. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/demotitle.png
  1539. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/normalmap.png
  1540. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausehoverpressed.png
  1541. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausenormal.png
  1542. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/playhoverpressed.png
  1543. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/playnormal.png
  1544. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/songtitle.png
  1545. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopdisabled.png
  1546. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stophoverpressed.png
  1547. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopnormal.png
  1548. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/earth.png
  1549. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/jupiter.png
  1550. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/mars.png
  1551. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/mercury.png
  1552. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/nasa/uranusringcolortrans.png
  1553. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/neptune.png
  1554. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/saturn.png
  1555. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapcolortrans.png
  1556. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapspec.jpg
  1557. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthmap2k.jpg
  1558. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthnormal2k.jpg
  1559. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthspec2k.jpg
  1560. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/galaxy_starfield.jpg
  1561. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/jupitermap.jpg
  1562. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsmap2k.jpg
  1563. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsnormal2k.jpg
  1564. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurymap.jpg
  1565. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurynormal.jpg
  1566. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonmap2k.jpg
  1567. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonnormal2k.jpg
  1568. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/neptunemap.jpg
  1569. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnmap.jpg
  1570. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnringcolortrans.png
  1571. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/sunmap.jpg
  1572. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/uranusmap.jpg
  1573. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusmap.jpg
  1574. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusnormal.jpg
  1575. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/sun.png
  1576. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/uranus.png
  1577. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/venus.png
  1578. share/doc/qt5/qt3d/images/wave.png
  1579. share/doc/qt5/qt3d/images/widgets-scene3d.png
  1580. share/doc/qt5/qt3d/qml-computecommand-members.html
  1581. share/doc/qt5/qt3d/qml-computecommand.html
  1582. share/doc/qt5/qt3d/qml-qt3d-animation-abstractanimation-members.html
  1583. share/doc/qt5/qt3d/qml-qt3d-animation-abstractanimation.html
  1584. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipanimator-members.html
  1585. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipanimator.html
  1586. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipblendnode-members.html
  1587. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipblendnode.html
  1588. share/doc/qt5/qt3d/qml-qt3d-animation-additiveclipblend-members.html
  1589. share/doc/qt5/qt3d/qml-qt3d-animation-additiveclipblend.html
  1590. share/doc/qt5/qt3d/qml-qt3d-animation-animationcontroller-members.html
  1591. share/doc/qt5/qt3d/qml-qt3d-animation-animationcontroller.html
  1592. share/doc/qt5/qt3d/qml-qt3d-animation-animationgroup-members.html
  1593. share/doc/qt5/qt3d/qml-qt3d-animation-animationgroup.html
  1594. share/doc/qt5/qt3d/qml-qt3d-animation-blendedclipanimator-members.html
  1595. share/doc/qt5/qt3d/qml-qt3d-animation-blendedclipanimator.html
  1596. share/doc/qt5/qt3d/qml-qt3d-animation-clipanimator-members.html
  1597. share/doc/qt5/qt3d/qml-qt3d-animation-clipanimator.html
  1598. share/doc/qt5/qt3d/qml-qt3d-animation-keyframeanimation-members.html
  1599. share/doc/qt5/qt3d/qml-qt3d-animation-keyframeanimation.html
  1600. share/doc/qt5/qt3d/qml-qt3d-animation-lerpblend-members.html
  1601. share/doc/qt5/qt3d/qml-qt3d-animation-lerpblend.html
  1602. share/doc/qt5/qt3d/qml-qt3d-animation-morphinganimation-members.html
  1603. share/doc/qt5/qt3d/qml-qt3d-animation-morphinganimation.html
  1604. share/doc/qt5/qt3d/qml-qt3d-animation-morphtarget-members.html
  1605. share/doc/qt5/qt3d/qml-qt3d-animation-morphtarget.html
  1606. share/doc/qt5/qt3d/qml-qt3d-animation-vertexblendanimation-members.html
  1607. share/doc/qt5/qt3d/qml-qt3d-animation-vertexblendanimation.html
  1608. share/doc/qt5/qt3d/qml-qt3d-core-component3d-members.html
  1609. share/doc/qt5/qt3d/qml-qt3d-core-component3d.html
  1610. share/doc/qt5/qt3d/qml-qt3d-core-entity-members.html
  1611. share/doc/qt5/qt3d/qml-qt3d-core-entity.html
  1612. share/doc/qt5/qt3d/qml-qt3d-core-entityloader-members.html
  1613. share/doc/qt5/qt3d/qml-qt3d-core-entityloader.html
  1614. share/doc/qt5/qt3d/qml-qt3d-core-node-members.html
  1615. share/doc/qt5/qt3d/qml-qt3d-core-node.html
  1616. share/doc/qt5/qt3d/qml-qt3d-core-nodeinstantiator-members.html
  1617. share/doc/qt5/qt3d/qml-qt3d-core-nodeinstantiator.html
  1618. share/doc/qt5/qt3d/qml-qt3d-core-quaternionanimation-members.html
  1619. share/doc/qt5/qt3d/qml-qt3d-core-quaternionanimation.html
  1620. share/doc/qt5/qt3d/qml-qt3d-core-transform-members.html
  1621. share/doc/qt5/qt3d/qml-qt3d-core-transform.html
  1622. share/doc/qt5/qt3d/qml-qt3d-extras-conegeometry-members.html
  1623. share/doc/qt5/qt3d/qml-qt3d-extras-conegeometry.html
  1624. share/doc/qt5/qt3d/qml-qt3d-extras-conemesh-members.html
  1625. share/doc/qt5/qt3d/qml-qt3d-extras-conemesh.html
  1626. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
  1627. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidgeometry.html
  1628. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidmesh-members.html
  1629. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidmesh.html
  1630. share/doc/qt5/qt3d/qml-qt3d-extras-cylindergeometry-members.html
  1631. share/doc/qt5/qt3d/qml-qt3d-extras-cylindergeometry.html
  1632. share/doc/qt5/qt3d/qml-qt3d-extras-cylindermesh-members.html
  1633. share/doc/qt5/qt3d/qml-qt3d-extras-cylindermesh.html
  1634. share/doc/qt5/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
  1635. share/doc/qt5/qt3d/qml-qt3d-extras-diffusemapmaterial.html
  1636. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
  1637. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
  1638. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextgeometry-members.html
  1639. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextgeometry.html
  1640. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextmesh-members.html
  1641. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextmesh.html
  1642. share/doc/qt5/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
  1643. share/doc/qt5/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
  1644. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer-members.html
  1645. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer-obsolete.html
  1646. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer.html
  1647. share/doc/qt5/qt3d/qml-qt3d-extras-goochmaterial-members.html
  1648. share/doc/qt5/qt3d/qml-qt3d-extras-goochmaterial.html
  1649. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
  1650. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
  1651. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
  1652. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
  1653. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
  1654. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
  1655. share/doc/qt5/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
  1656. share/doc/qt5/qt3d/qml-qt3d-extras-orbitcameracontroller.html
  1657. share/doc/qt5/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
  1658. share/doc/qt5/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
  1659. share/doc/qt5/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
  1660. share/doc/qt5/qt3d/qml-qt3d-extras-phongalphamaterial.html
  1661. share/doc/qt5/qt3d/qml-qt3d-extras-phongmaterial-members.html
  1662. share/doc/qt5/qt3d/qml-qt3d-extras-phongmaterial.html
  1663. share/doc/qt5/qt3d/qml-qt3d-extras-planegeometry-members.html
  1664. share/doc/qt5/qt3d/qml-qt3d-extras-planegeometry.html
  1665. share/doc/qt5/qt3d/qml-qt3d-extras-planemesh-members.html
  1666. share/doc/qt5/qt3d/qml-qt3d-extras-planemesh.html
  1667. share/doc/qt5/qt3d/qml-qt3d-extras-spheregeometry-members.html
  1668. share/doc/qt5/qt3d/qml-qt3d-extras-spheregeometry.html
  1669. share/doc/qt5/qt3d/qml-qt3d-extras-spheremesh-members.html
  1670. share/doc/qt5/qt3d/qml-qt3d-extras-spheremesh.html
  1671. share/doc/qt5/qt3d/qml-qt3d-extras-torusgeometry-members.html
  1672. share/doc/qt5/qt3d/qml-qt3d-extras-torusgeometry.html
  1673. share/doc/qt5/qt3d/qml-qt3d-extras-torusmesh-members.html
  1674. share/doc/qt5/qt3d/qml-qt3d-extras-torusmesh.html
  1675. share/doc/qt5/qt3d/qml-qt3d-input-abstractactioninput-members.html
  1676. share/doc/qt5/qt3d/qml-qt3d-input-abstractactioninput.html
  1677. share/doc/qt5/qt3d/qml-qt3d-input-abstractaxisinput-members.html
  1678. share/doc/qt5/qt3d/qml-qt3d-input-abstractaxisinput.html
  1679. share/doc/qt5/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
  1680. share/doc/qt5/qt3d/qml-qt3d-input-abstractphysicaldevice.html
  1681. share/doc/qt5/qt3d/qml-qt3d-input-action-members.html
  1682. share/doc/qt5/qt3d/qml-qt3d-input-action.html
  1683. share/doc/qt5/qt3d/qml-qt3d-input-actioninput-members.html
  1684. share/doc/qt5/qt3d/qml-qt3d-input-actioninput.html
  1685. share/doc/qt5/qt3d/qml-qt3d-input-analogaxisinput-members.html
  1686. share/doc/qt5/qt3d/qml-qt3d-input-analogaxisinput.html
  1687. share/doc/qt5/qt3d/qml-qt3d-input-axis-members.html
  1688. share/doc/qt5/qt3d/qml-qt3d-input-axis.html
  1689. share/doc/qt5/qt3d/qml-qt3d-input-axisaccumulator-members.html
  1690. share/doc/qt5/qt3d/qml-qt3d-input-axisaccumulator.html
  1691. share/doc/qt5/qt3d/qml-qt3d-input-axissetting-members.html
  1692. share/doc/qt5/qt3d/qml-qt3d-input-axissetting.html
  1693. share/doc/qt5/qt3d/qml-qt3d-input-buttonaxisinput-members.html
  1694. share/doc/qt5/qt3d/qml-qt3d-input-buttonaxisinput.html
  1695. share/doc/qt5/qt3d/qml-qt3d-input-inputchord-members.html
  1696. share/doc/qt5/qt3d/qml-qt3d-input-inputchord.html
  1697. share/doc/qt5/qt3d/qml-qt3d-input-inputsequence-members.html
  1698. share/doc/qt5/qt3d/qml-qt3d-input-inputsequence.html
  1699. share/doc/qt5/qt3d/qml-qt3d-input-inputsettings-members.html
  1700. share/doc/qt5/qt3d/qml-qt3d-input-inputsettings.html
  1701. share/doc/qt5/qt3d/qml-qt3d-input-keyboarddevice-members.html
  1702. share/doc/qt5/qt3d/qml-qt3d-input-keyboarddevice.html
  1703. share/doc/qt5/qt3d/qml-qt3d-input-keyboardhandler-members.html
  1704. share/doc/qt5/qt3d/qml-qt3d-input-keyboardhandler.html
  1705. share/doc/qt5/qt3d/qml-qt3d-input-keyevent-members.html
  1706. share/doc/qt5/qt3d/qml-qt3d-input-keyevent.html
  1707. share/doc/qt5/qt3d/qml-qt3d-input-logicaldevice-members.html
  1708. share/doc/qt5/qt3d/qml-qt3d-input-logicaldevice.html
  1709. share/doc/qt5/qt3d/qml-qt3d-input-mousedevice-members.html
  1710. share/doc/qt5/qt3d/qml-qt3d-input-mousedevice.html
  1711. share/doc/qt5/qt3d/qml-qt3d-input-mouseevent-members.html
  1712. share/doc/qt5/qt3d/qml-qt3d-input-mouseevent.html
  1713. share/doc/qt5/qt3d/qml-qt3d-input-mousehandler-members.html
  1714. share/doc/qt5/qt3d/qml-qt3d-input-mousehandler.html
  1715. share/doc/qt5/qt3d/qml-qt3d-input-wheelevent-members.html
  1716. share/doc/qt5/qt3d/qml-qt3d-input-wheelevent.html
  1717. share/doc/qt5/qt3d/qml-qt3d-logic-frameaction-members.html
  1718. share/doc/qt5/qt3d/qml-qt3d-logic-frameaction.html
  1719. share/doc/qt5/qt3d/qml-qt3d-render-abstracttextureimage-members.html
  1720. share/doc/qt5/qt3d/qml-qt3d-render-abstracttextureimage.html
  1721. share/doc/qt5/qt3d/qml-qt3d-render-alphacoverage-members.html
  1722. share/doc/qt5/qt3d/qml-qt3d-render-alphacoverage.html
  1723. share/doc/qt5/qt3d/qml-qt3d-render-alphatest-members.html
  1724. share/doc/qt5/qt3d/qml-qt3d-render-alphatest.html
  1725. share/doc/qt5/qt3d/qml-qt3d-render-attribute-members.html
  1726. share/doc/qt5/qt3d/qml-qt3d-render-attribute.html
  1727. share/doc/qt5/qt3d/qml-qt3d-render-blendequation-members.html
  1728. share/doc/qt5/qt3d/qml-qt3d-render-blendequation.html
  1729. share/doc/qt5/qt3d/qml-qt3d-render-blendequationarguments-members.html
  1730. share/doc/qt5/qt3d/qml-qt3d-render-blendequationarguments.html
  1731. share/doc/qt5/qt3d/qml-qt3d-render-buffer-members.html
  1732. share/doc/qt5/qt3d/qml-qt3d-render-buffer.html
  1733. share/doc/qt5/qt3d/qml-qt3d-render-camera-members.html
  1734. share/doc/qt5/qt3d/qml-qt3d-render-camera.html
  1735. share/doc/qt5/qt3d/qml-qt3d-render-cameralens-members.html
  1736. share/doc/qt5/qt3d/qml-qt3d-render-cameralens.html
  1737. share/doc/qt5/qt3d/qml-qt3d-render-cameraselector-members.html
  1738. share/doc/qt5/qt3d/qml-qt3d-render-cameraselector.html
  1739. share/doc/qt5/qt3d/qml-qt3d-render-clearbuffers-members.html
  1740. share/doc/qt5/qt3d/qml-qt3d-render-clearbuffers.html
  1741. share/doc/qt5/qt3d/qml-qt3d-render-clipplane-members.html
  1742. share/doc/qt5/qt3d/qml-qt3d-render-clipplane.html
  1743. share/doc/qt5/qt3d/qml-qt3d-render-colormask-members.html
  1744. share/doc/qt5/qt3d/qml-qt3d-render-colormask.html
  1745. share/doc/qt5/qt3d/qml-qt3d-render-cullface-members.html
  1746. share/doc/qt5/qt3d/qml-qt3d-render-cullface.html
  1747. share/doc/qt5/qt3d/qml-qt3d-render-depthtest-members.html
  1748. share/doc/qt5/qt3d/qml-qt3d-render-depthtest.html
  1749. share/doc/qt5/qt3d/qml-qt3d-render-directionallight-members.html
  1750. share/doc/qt5/qt3d/qml-qt3d-render-directionallight.html
  1751. share/doc/qt5/qt3d/qml-qt3d-render-dispatchcompute-members.html
  1752. share/doc/qt5/qt3d/qml-qt3d-render-dispatchcompute.html
  1753. share/doc/qt5/qt3d/qml-qt3d-render-dithering-members.html
  1754. share/doc/qt5/qt3d/qml-qt3d-render-dithering.html
  1755. share/doc/qt5/qt3d/qml-qt3d-render-effect-members.html
  1756. share/doc/qt5/qt3d/qml-qt3d-render-effect.html
  1757. share/doc/qt5/qt3d/qml-qt3d-render-environmentlight-members.html
  1758. share/doc/qt5/qt3d/qml-qt3d-render-environmentlight.html
  1759. share/doc/qt5/qt3d/qml-qt3d-render-filterkey-members.html
  1760. share/doc/qt5/qt3d/qml-qt3d-render-filterkey.html
  1761. share/doc/qt5/qt3d/qml-qt3d-render-framegraphnode-members.html
  1762. share/doc/qt5/qt3d/qml-qt3d-render-framegraphnode.html
  1763. share/doc/qt5/qt3d/qml-qt3d-render-frontface-members.html
  1764. share/doc/qt5/qt3d/qml-qt3d-render-frontface.html
  1765. share/doc/qt5/qt3d/qml-qt3d-render-frustumculling-members.html
  1766. share/doc/qt5/qt3d/qml-qt3d-render-frustumculling.html
  1767. share/doc/qt5/qt3d/qml-qt3d-render-geometry-members.html
  1768. share/doc/qt5/qt3d/qml-qt3d-render-geometry.html
  1769. share/doc/qt5/qt3d/qml-qt3d-render-geometryrenderer-members.html
  1770. share/doc/qt5/qt3d/qml-qt3d-render-geometryrenderer.html
  1771. share/doc/qt5/qt3d/qml-qt3d-render-graphicsapifilter-members.html
  1772. share/doc/qt5/qt3d/qml-qt3d-render-graphicsapifilter.html
  1773. share/doc/qt5/qt3d/qml-qt3d-render-layer-members.html
  1774. share/doc/qt5/qt3d/qml-qt3d-render-layer.html
  1775. share/doc/qt5/qt3d/qml-qt3d-render-layerfilter-members.html
  1776. share/doc/qt5/qt3d/qml-qt3d-render-layerfilter.html
  1777. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetail-members.html
  1778. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetail.html
  1779. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailloader-members.html
  1780. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailloader.html
  1781. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailswitch-members.html
  1782. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailswitch.html
  1783. share/doc/qt5/qt3d/qml-qt3d-render-light-members.html
  1784. share/doc/qt5/qt3d/qml-qt3d-render-light.html
  1785. share/doc/qt5/qt3d/qml-qt3d-render-material-members.html
  1786. share/doc/qt5/qt3d/qml-qt3d-render-material.html
  1787. share/doc/qt5/qt3d/qml-qt3d-render-memorybarrier-members.html
  1788. share/doc/qt5/qt3d/qml-qt3d-render-memorybarrier.html
  1789. share/doc/qt5/qt3d/qml-qt3d-render-mesh-members.html
  1790. share/doc/qt5/qt3d/qml-qt3d-render-mesh.html
  1791. share/doc/qt5/qt3d/qml-qt3d-render-multisampleantialiasing-members.html
  1792. share/doc/qt5/qt3d/qml-qt3d-render-multisampleantialiasing.html
  1793. share/doc/qt5/qt3d/qml-qt3d-render-nodepthmask-members.html
  1794. share/doc/qt5/qt3d/qml-qt3d-render-nodepthmask.html
  1795. share/doc/qt5/qt3d/qml-qt3d-render-nodraw-members.html
  1796. share/doc/qt5/qt3d/qml-qt3d-render-nodraw.html
  1797. share/doc/qt5/qt3d/qml-qt3d-render-objectpicker-members.html
  1798. share/doc/qt5/qt3d/qml-qt3d-render-objectpicker.html
  1799. share/doc/qt5/qt3d/qml-qt3d-render-parameter-members.html
  1800. share/doc/qt5/qt3d/qml-qt3d-render-parameter.html
  1801. share/doc/qt5/qt3d/qml-qt3d-render-pickevent-members.html
  1802. share/doc/qt5/qt3d/qml-qt3d-render-pickevent.html
  1803. share/doc/qt5/qt3d/qml-qt3d-render-pickingsettings-members.html
  1804. share/doc/qt5/qt3d/qml-qt3d-render-pickingsettings.html
  1805. share/doc/qt5/qt3d/qml-qt3d-render-picktriangleevent-members.html
  1806. share/doc/qt5/qt3d/qml-qt3d-render-picktriangleevent.html
  1807. share/doc/qt5/qt3d/qml-qt3d-render-pointlight-members.html
  1808. share/doc/qt5/qt3d/qml-qt3d-render-pointlight.html
  1809. share/doc/qt5/qt3d/qml-qt3d-render-pointsize-members.html
  1810. share/doc/qt5/qt3d/qml-qt3d-render-pointsize.html
  1811. share/doc/qt5/qt3d/qml-qt3d-render-polygonoffset-members.html
  1812. share/doc/qt5/qt3d/qml-qt3d-render-polygonoffset.html
  1813. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture-members.html
  1814. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture-obsolete.html
  1815. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture.html
  1816. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply-members.html
  1817. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply-obsolete.html
  1818. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply.html
  1819. share/doc/qt5/qt3d/qml-qt3d-render-renderpass-members.html
  1820. share/doc/qt5/qt3d/qml-qt3d-render-renderpass.html
  1821. share/doc/qt5/qt3d/qml-qt3d-render-rendersettings-members.html
  1822. share/doc/qt5/qt3d/qml-qt3d-render-rendersettings.html
  1823. share/doc/qt5/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
  1824. share/doc/qt5/qt3d/qml-qt3d-render-rendersurfaceselector.html
  1825. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetselector-members.html
  1826. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetselector.html
  1827. share/doc/qt5/qt3d/qml-qt3d-render-sceneloader-members.html
  1828. share/doc/qt5/qt3d/qml-qt3d-render-sceneloader.html
  1829. share/doc/qt5/qt3d/qml-qt3d-render-scissortest-members.html
  1830. share/doc/qt5/qt3d/qml-qt3d-render-scissortest.html
  1831. share/doc/qt5/qt3d/qml-qt3d-render-seamlesscubemap-members.html
  1832. share/doc/qt5/qt3d/qml-qt3d-render-seamlesscubemap.html
  1833. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogram-members.html
  1834. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogram.html
  1835. share/doc/qt5/qt3d/qml-qt3d-render-sortpolicy-members.html
  1836. share/doc/qt5/qt3d/qml-qt3d-render-sortpolicy.html
  1837. share/doc/qt5/qt3d/qml-qt3d-render-spotlight-members.html
  1838. share/doc/qt5/qt3d/qml-qt3d-render-spotlight.html
  1839. share/doc/qt5/qt3d/qml-qt3d-render-stencilmask-members.html
  1840. share/doc/qt5/qt3d/qml-qt3d-render-stencilmask.html
  1841. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperation-members.html
  1842. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperation.html
  1843. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperationarguments-members.html
  1844. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperationarguments.html
  1845. share/doc/qt5/qt3d/qml-qt3d-render-stenciltest-members.html
  1846. share/doc/qt5/qt3d/qml-qt3d-render-stenciltest.html
  1847. share/doc/qt5/qt3d/qml-qt3d-render-stenciltestarguments-members.html
  1848. share/doc/qt5/qt3d/qml-qt3d-render-stenciltestarguments.html
  1849. share/doc/qt5/qt3d/qml-qt3d-render-technique-members.html
  1850. share/doc/qt5/qt3d/qml-qt3d-render-technique.html
  1851. share/doc/qt5/qt3d/qml-qt3d-render-textureimage-members.html
  1852. share/doc/qt5/qt3d/qml-qt3d-render-textureimage.html
  1853. share/doc/qt5/qt3d/qml-qt3d-render-viewport-members.html
  1854. share/doc/qt5/qt3d/qml-qt3d-render-viewport.html
  1855. share/doc/qt5/qt3d/qml-qt3d-scene2d-scene2d-members.html
  1856. share/doc/qt5/qt3d/qml-qt3d-scene2d-scene2d.html
  1857. share/doc/qt5/qt3d/qml-renderpassfilter-members.html
  1858. share/doc/qt5/qt3d/qml-renderpassfilter.html
  1859. share/doc/qt5/qt3d/qml-renderstate-members.html
  1860. share/doc/qt5/qt3d/qml-renderstate.html
  1861. share/doc/qt5/qt3d/qml-renderstateset-members.html
  1862. share/doc/qt5/qt3d/qml-renderstateset.html
  1863. share/doc/qt5/qt3d/qml-rendertarget-members.html
  1864. share/doc/qt5/qt3d/qml-rendertarget.html
  1865. share/doc/qt5/qt3d/qml-rendertargetoutput-members.html
  1866. share/doc/qt5/qt3d/qml-rendertargetoutput.html
  1867. share/doc/qt5/qt3d/qml-techniquefilter-members.html
  1868. share/doc/qt5/qt3d/qml-techniquefilter.html
  1869. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-advancedcustommaterial-pro.html
  1870. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-example.html
  1871. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-main-cpp.html
  1872. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-main-qml.html
  1873. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-models-qrc.html
  1874. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-qml-qrc.html
  1875. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-sceneroot-qml.html
  1876. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-es2-water-vert.html
  1877. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-gl3-water-vert.html
  1878. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-qrc.html
  1879. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-textures-qrc.html
  1880. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-water-qml.html
  1881. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-watermaterial-qml.html
  1882. share/doc/qt5/qt3d/qt3d-animation-qmlmodule.html
  1883. share/doc/qt5/qt3d/qt3d-attribution-assimp.html
  1884. share/doc/qt5/qt3d/qt3d-attribution-nasa-jpl.html
  1885. share/doc/qt5/qt3d/qt3d-attribution-solar-system-scope.html
  1886. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-pro.html
  1887. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-qrc.html
  1888. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-barentity-qml.html
  1889. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-example.html
  1890. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-main-cpp.html
  1891. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-main-qml.html
  1892. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-touchsettings-cpp.html
  1893. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-touchsettings-h.html
  1894. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-visualizer-qml.html
  1895. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-basicshapes-cpp-pro.html
  1896. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-example.html
  1897. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-main-cpp.html
  1898. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-scenemodifier-cpp.html
  1899. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-scenemodifier-h.html
  1900. share/doc/qt5/qt3d/qt3d-core-qmlmodule.html
  1901. share/doc/qt5/qt3d/qt3d-cpp.html
  1902. share/doc/qt5/qt3d/qt3d-examples.html
  1903. share/doc/qt5/qt3d/qt3d-extras-qmlmodule.html
  1904. share/doc/qt5/qt3d/qt3d-index.html
  1905. share/doc/qt5/qt3d/qt3d-input-qmlmodule.html
  1906. share/doc/qt5/qt3d/qt3d-logic-qmlmodule.html
  1907. share/doc/qt5/qt3d/qt3d-materials-barrel-qml.html
  1908. share/doc/qt5/qt3d/qt3d-materials-basiccamera-qml.html
  1909. share/doc/qt5/qt3d/qt3d-materials-chest-qml.html
  1910. share/doc/qt5/qt3d/qt3d-materials-cpp-barrel-cpp.html
  1911. share/doc/qt5/qt3d/qt3d-materials-cpp-barrel-h.html
  1912. share/doc/qt5/qt3d/qt3d-materials-cpp-example.html
  1913. share/doc/qt5/qt3d/qt3d-materials-cpp-houseplant-cpp.html
  1914. share/doc/qt5/qt3d/qt3d-materials-cpp-houseplant-h.html
  1915. share/doc/qt5/qt3d/qt3d-materials-cpp-main-cpp.html
  1916. share/doc/qt5/qt3d/qt3d-materials-cpp-materials-cpp-pro.html
  1917. share/doc/qt5/qt3d/qt3d-materials-cpp-planeentity-cpp.html
  1918. share/doc/qt5/qt3d/qt3d-materials-cpp-planeentity-h.html
  1919. share/doc/qt5/qt3d/qt3d-materials-cpp-renderableentity-cpp.html
  1920. share/doc/qt5/qt3d/qt3d-materials-cpp-renderableentity-h.html
  1921. share/doc/qt5/qt3d/qt3d-materials-cpp-rotatingtrefoilknot-cpp.html
  1922. share/doc/qt5/qt3d/qt3d-materials-cpp-rotatingtrefoilknot-h.html
  1923. share/doc/qt5/qt3d/qt3d-materials-cpp-trefoilknot-cpp.html
  1924. share/doc/qt5/qt3d/qt3d-materials-cpp-trefoilknot-h.html
  1925. share/doc/qt5/qt3d/qt3d-materials-example.html
  1926. share/doc/qt5/qt3d/qt3d-materials-houseplant-qml.html
  1927. share/doc/qt5/qt3d/qt3d-materials-lights-qml.html
  1928. share/doc/qt5/qt3d/qt3d-materials-main-cpp.html
  1929. share/doc/qt5/qt3d/qt3d-materials-main-qml.html
  1930. share/doc/qt5/qt3d/qt3d-materials-materials-pro.html
  1931. share/doc/qt5/qt3d/qt3d-materials-materials-qrc.html
  1932. share/doc/qt5/qt3d/qt3d-materials-planeentity-qml.html
  1933. share/doc/qt5/qt3d/qt3d-materials-renderableentity-qml.html
  1934. share/doc/qt5/qt3d/qt3d-materials-sortedforwardrenderer-qml.html
  1935. share/doc/qt5/qt3d/qt3d-materials-trefoilknot-qml.html
  1936. share/doc/qt5/qt3d/qt3d-multiviewport-example.html
  1937. share/doc/qt5/qt3d/qt3d-multiviewport-main-cpp.html
  1938. share/doc/qt5/qt3d/qt3d-multiviewport-main-qml.html
  1939. share/doc/qt5/qt3d/qt3d-multiviewport-multiviewport-pro.html
  1940. share/doc/qt5/qt3d/qt3d-multiviewport-multiviewport-qrc.html
  1941. share/doc/qt5/qt3d/qt3d-multiviewport-quadviewportframegraph-qml.html
  1942. share/doc/qt5/qt3d/qt3d-multiviewport-simplecamera-qml.html
  1943. share/doc/qt5/qt3d/qt3d-overview.html
  1944. share/doc/qt5/qt3d/qt3d-planets-qml-android-androidmanifest-xml.html
  1945. share/doc/qt5/qt3d/qt3d-planets-qml-appletvinput-qml.html
  1946. share/doc/qt5/qt3d/qt3d-planets-qml-example.html
  1947. share/doc/qt5/qt3d/qt3d-planets-qml-fpsdisplay-qml.html
  1948. share/doc/qt5/qt3d/qt3d-planets-qml-infosheet-qml.html
  1949. share/doc/qt5/qt3d/qt3d-planets-qml-main-cpp.html
  1950. share/doc/qt5/qt3d/qt3d-planets-qml-networkcontroller-cpp.html
  1951. share/doc/qt5/qt3d/qt3d-planets-qml-networkcontroller-h.html
  1952. share/doc/qt5/qt3d/qt3d-planets-qml-planet-qml.html
  1953. share/doc/qt5/qt3d/qt3d-planets-qml-planetbutton-qml.html
  1954. share/doc/qt5/qt3d/qt3d-planets-qml-planeteffect-qml.html
  1955. share/doc/qt5/qt3d/qt3d-planets-qml-planetframegraph-qml.html
  1956. share/doc/qt5/qt3d/qt3d-planets-qml-planetmaterial-qml.html
  1957. share/doc/qt5/qt3d/qt3d-planets-qml-planets-js.html
  1958. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-images-qrc.html
  1959. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-pro.html
  1960. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-qrc.html
  1961. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-appdelegate-h.html
  1962. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-viewcontroller-h.html
  1963. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-extensiondelegate-h.html
  1964. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-interfacecontroller-h.html
  1965. share/doc/qt5/qt3d/qt3d-planets-qml-planetslight-qml.html
  1966. share/doc/qt5/qt3d/qt3d-planets-qml-planetsmain-qml.html
  1967. share/doc/qt5/qt3d/qt3d-planets-qml-ring-qml.html
  1968. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-planetd-vert.html
  1969. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-planetdb-vert.html
  1970. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-sun-vert.html
  1971. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetd-vert.html
  1972. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetdb-vert.html
  1973. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetdshadow-vert.html
  1974. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-shadowmap-vert.html
  1975. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-sun-vert.html
  1976. share/doc/qt5/qt3d/qt3d-planets-qml-shadoweffect-qml.html
  1977. share/doc/qt5/qt3d/qt3d-planets-qml-solarsystem-qml.html
  1978. share/doc/qt5/qt3d/qt3d-planets-qml-styledslider-qml.html
  1979. share/doc/qt5/qt3d/qt3d-planets-qml-suneffect-qml.html
  1980. share/doc/qt5/qt3d/qt3d-render-qmlmodule.html
  1981. share/doc/qt5/qt3d/qt3d-scene2d-example.html
  1982. share/doc/qt5/qt3d/qt3d-scene2d-logocontrols-qml.html
  1983. share/doc/qt5/qt3d/qt3d-scene2d-main-cpp.html
  1984. share/doc/qt5/qt3d/qt3d-scene2d-main-qml.html
  1985. share/doc/qt5/qt3d/qt3d-scene2d-qmlmodule.html
  1986. share/doc/qt5/qt3d/qt3d-scene2d-scene2d-pro.html
  1987. share/doc/qt5/qt3d/qt3d-scene2d-scene2d-qrc.html
  1988. share/doc/qt5/qt3d/qt3d-scene3d-animatedentity-qml.html
  1989. share/doc/qt5/qt3d/qt3d-scene3d-example.html
  1990. share/doc/qt5/qt3d/qt3d-scene3d-main-cpp.html
  1991. share/doc/qt5/qt3d/qt3d-scene3d-main-qml.html
  1992. share/doc/qt5/qt3d/qt3d-scene3d-scene3d-pro.html
  1993. share/doc/qt5/qt3d/qt3d-scene3d-scene3d-qrc.html
  1994. share/doc/qt5/qt3d/qt3d-shadow-map-qml-adseffect-qml.html
  1995. share/doc/qt5/qt3d/qt3d-shadow-map-qml-adsmaterial-qml.html
  1996. share/doc/qt5/qt3d/qt3d-shadow-map-qml-example.html
  1997. share/doc/qt5/qt3d/qt3d-shadow-map-qml-groundplane-qml.html
  1998. share/doc/qt5/qt3d/qt3d-shadow-map-qml-main-cpp.html
  1999. share/doc/qt5/qt3d/qt3d-shadow-map-qml-main-qml.html
  2000. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-ads-vert.html
  2001. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-es3-ads-vert.html
  2002. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-es3-shadowmap-vert.html
  2003. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-shadowmap-vert.html
  2004. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadow-map-qml-pro.html
  2005. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadow-map-qml-qrc.html
  2006. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadowmapframegraph-qml.html
  2007. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadowmaplight-qml.html
  2008. share/doc/qt5/qt3d/qt3d-shadow-map-qml-toyplane-qml.html
  2009. share/doc/qt5/qt3d/qt3d-shadow-map-qml-trefoil-qml.html
  2010. share/doc/qt5/qt3d/qt3d-simple-cpp-example.html
  2011. share/doc/qt5/qt3d/qt3d-simple-cpp-main-cpp.html
  2012. share/doc/qt5/qt3d/qt3d-simple-cpp-orbittransformcontroller-cpp.html
  2013. share/doc/qt5/qt3d/qt3d-simple-cpp-orbittransformcontroller-h.html
  2014. share/doc/qt5/qt3d/qt3d-simple-cpp-simple-cpp-pro.html
  2015. share/doc/qt5/qt3d/qt3d-simple-qml-cameracontroller-qml.html
  2016. share/doc/qt5/qt3d/qt3d-simple-qml-example.html
  2017. share/doc/qt5/qt3d/qt3d-simple-qml-main-cpp.html
  2018. share/doc/qt5/qt3d/qt3d-simple-qml-main-qml.html
  2019. share/doc/qt5/qt3d/qt3d-simple-qml-simple-qml-pro.html
  2020. share/doc/qt5/qt3d/qt3d-simple-qml-simple-qml-qrc.html
  2021. share/doc/qt5/qt3d/qt3d-simplecustommaterial-example.html
  2022. share/doc/qt5/qt3d/qt3d-simplecustommaterial-main-cpp.html
  2023. share/doc/qt5/qt3d/qt3d-simplecustommaterial-main-qml.html
  2024. share/doc/qt5/qt3d/qt3d-simplecustommaterial-models-qrc.html
  2025. share/doc/qt5/qt3d/qt3d-simplecustommaterial-planemodel-qml.html
  2026. share/doc/qt5/qt3d/qt3d-simplecustommaterial-qml-qrc.html
  2027. share/doc/qt5/qt3d/qt3d-simplecustommaterial-sceneroot-qml.html
  2028. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-es2-simplecolor-vert.html
  2029. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-gl3-simplecolor-vert.html
  2030. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-qrc.html
  2031. share/doc/qt5/qt3d/qt3d-simplecustommaterial-simplecustommaterial-pro.html
  2032. share/doc/qt5/qt3d/qt3d-simplecustommaterial-simplematerial-qml.html
  2033. share/doc/qt5/qt3d/qt3d-simplecustommaterial-textures-qrc.html
  2034. share/doc/qt5/qt3d/qt3d-wave-background-qml.html
  2035. share/doc/qt5/qt3d/qt3d-wave-backgroundeffect-qml.html
  2036. share/doc/qt5/qt3d/qt3d-wave-basiccamera-qml.html
  2037. share/doc/qt5/qt3d/qt3d-wave-example.html
  2038. share/doc/qt5/qt3d/qt3d-wave-main-cpp.html
  2039. share/doc/qt5/qt3d/qt3d-wave-main-qml.html
  2040. share/doc/qt5/qt3d/qt3d-wave-shaders-background-vert.html
  2041. share/doc/qt5/qt3d/qt3d-wave-shaders-ribbon-vert.html
  2042. share/doc/qt5/qt3d/qt3d-wave-shaders-robustwireframe-geom.html
  2043. share/doc/qt5/qt3d/qt3d-wave-wave-pro.html
  2044. share/doc/qt5/qt3d/qt3d-wave-wave-qml.html
  2045. share/doc/qt5/qt3d/qt3d-wave-wave-qrc.html
  2046. share/doc/qt5/qt3d/qt3d-wave-waveeffect-qml.html
  2047. share/doc/qt5/qt3d/qt3d-wave-waveforwardrenderer-qml.html
  2048. share/doc/qt5/qt3d/qt3d-wave-wavematerial-qml.html
  2049. share/doc/qt5/qt3d/qt3d-widgets-scene3d-example.html
  2050. share/doc/qt5/qt3d/qt3d-widgets-scene3d-main-cpp.html
  2051. share/doc/qt5/qt3d/qt3d-widgets-scene3d-widgets-scene3d-pro.html
  2052. share/doc/qt5/qt3d/qt3d-widgets-scene3d-widgets-scene3d-qrc.html
  2053. share/doc/qt5/qt3d/qt3d-wireframe-basiccamera-qml.html
  2054. share/doc/qt5/qt3d/qt3d-wireframe-example.html
  2055. share/doc/qt5/qt3d/qt3d-wireframe-main-cpp.html
  2056. share/doc/qt5/qt3d/qt3d-wireframe-main-qml.html
  2057. share/doc/qt5/qt3d/qt3d-wireframe-shaders-robustwireframe-geom.html
  2058. share/doc/qt5/qt3d/qt3d-wireframe-shaders-robustwireframe-vert.html
  2059. share/doc/qt5/qt3d/qt3d-wireframe-trefoilknot-qml.html
  2060. share/doc/qt5/qt3d/qt3d-wireframe-wireframe-pro.html
  2061. share/doc/qt5/qt3d/qt3d-wireframe-wireframe-qrc.html
  2062. share/doc/qt5/qt3d/qt3d-wireframe-wireframeeffect-qml.html
  2063. share/doc/qt5/qt3d/qt3d-wireframe-wireframematerial-qml.html
  2064. share/doc/qt5/qt3d/qt3d.index
  2065. share/doc/qt5/qt3d/qt3d.qhp
  2066. share/doc/qt5/qt3d/qt3d.qhp.sha1
  2067. share/doc/qt5/qt3d/qt3d.tags
  2068. share/doc/qt5/qt3d/qt3danimation-module.html
  2069. share/doc/qt5/qt3d/qt3danimation-qabstractanimation-members.html
  2070. share/doc/qt5/qt3d/qt3danimation-qabstractanimation.html
  2071. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip-members.html
  2072. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip.html
  2073. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator-members.html
  2074. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator.html
  2075. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode-members.html
  2076. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode.html
  2077. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend-members.html
  2078. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend.html
  2079. share/doc/qt5/qt3d/qt3danimation-qanimationaspect-members.html
  2080. share/doc/qt5/qt3d/qt3danimation-qanimationaspect.html
  2081. share/doc/qt5/qt3d/qt3danimation-qanimationclip-members.html
  2082. share/doc/qt5/qt3d/qt3danimation-qanimationclip.html
  2083. share/doc/qt5/qt3d/qt3danimation-qanimationclipdata-members.html
  2084. share/doc/qt5/qt3d/qt3danimation-qanimationclipdata.html
  2085. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader-members.html
  2086. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader.html
  2087. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller-members.html
  2088. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller.html
  2089. share/doc/qt5/qt3d/qt3danimation-qanimationgroup-members.html
  2090. share/doc/qt5/qt3d/qt3danimation-qanimationgroup.html
  2091. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator-members.html
  2092. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator.html
  2093. share/doc/qt5/qt3d/qt3danimation-qchannel-members.html
  2094. share/doc/qt5/qt3d/qt3danimation-qchannel.html
  2095. share/doc/qt5/qt3d/qt3danimation-qchannelcomponent-members.html
  2096. share/doc/qt5/qt3d/qt3danimation-qchannelcomponent.html
  2097. share/doc/qt5/qt3d/qt3danimation-qchannelmapper-members.html
  2098. share/doc/qt5/qt3d/qt3danimation-qchannelmapper.html
  2099. share/doc/qt5/qt3d/qt3danimation-qchannelmapping-members.html
  2100. share/doc/qt5/qt3d/qt3danimation-qchannelmapping.html
  2101. share/doc/qt5/qt3d/qt3danimation-qclipanimator-members.html
  2102. share/doc/qt5/qt3d/qt3danimation-qclipanimator.html
  2103. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchange-members.html
  2104. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchange.html
  2105. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchangebase-members.html
  2106. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchangebase.html
  2107. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue-members.html
  2108. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue.html
  2109. share/doc/qt5/qt3d/qt3danimation-qkeyframe-members.html
  2110. share/doc/qt5/qt3d/qt3danimation-qkeyframe.html
  2111. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation-members.html
  2112. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation.html
  2113. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend-members.html
  2114. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend.html
  2115. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation-members.html
  2116. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation.html
  2117. share/doc/qt5/qt3d/qt3danimation-qmorphtarget-members.html
  2118. share/doc/qt5/qt3d/qt3danimation-qmorphtarget.html
  2119. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation-members.html
  2120. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation.html
  2121. share/doc/qt5/qt3d/qt3danimation.html
  2122. share/doc/qt5/qt3d/qt3dcore-module.html
  2123. share/doc/qt5/qt3d/qt3dcore-qabstractaspect-members.html
  2124. share/doc/qt5/qt3d/qt3dcore-qabstractaspect.html
  2125. share/doc/qt5/qt3d/qt3dcore-qaspectengine-members.html
  2126. share/doc/qt5/qt3d/qt3dcore-qaspectengine.html
  2127. share/doc/qt5/qt3d/qt3dcore-qaspectjob-members.html
  2128. share/doc/qt5/qt3d/qt3dcore-qaspectjob.html
  2129. share/doc/qt5/qt3d/qt3dcore-qbackendnode-members.html
  2130. share/doc/qt5/qt3d/qt3dcore-qbackendnode.html
  2131. share/doc/qt5/qt3d/qt3dcore-qbackendnodemapper-members.html
  2132. share/doc/qt5/qt3d/qt3dcore-qbackendnodemapper.html
  2133. share/doc/qt5/qt3d/qt3dcore-qcomponent-members.html
  2134. share/doc/qt5/qt3d/qt3dcore-qcomponent.html
  2135. share/doc/qt5/qt3d/qt3dcore-qcomponentaddedchange-members.html
  2136. share/doc/qt5/qt3d/qt3dcore-qcomponentaddedchange.html
  2137. share/doc/qt5/qt3d/qt3dcore-qcomponentremovedchange-members.html
  2138. share/doc/qt5/qt3d/qt3dcore-qcomponentremovedchange.html
  2139. share/doc/qt5/qt3d/qt3dcore-qdynamicpropertyupdatedchange-members.html
  2140. share/doc/qt5/qt3d/qt3dcore-qdynamicpropertyupdatedchange.html
  2141. share/doc/qt5/qt3d/qt3dcore-qentity-members.html
  2142. share/doc/qt5/qt3d/qt3dcore-qentity.html
  2143. share/doc/qt5/qt3d/qt3dcore-qnode-members.html
  2144. share/doc/qt5/qt3d/qt3dcore-qnode.html
  2145. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchange-members.html
  2146. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchange.html
  2147. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchangebase-members.html
  2148. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchangebase.html
  2149. share/doc/qt5/qt3d/qt3dcore-qnodedestroyedchange-members.html
  2150. share/doc/qt5/qt3d/qt3dcore-qnodedestroyedchange.html
  2151. share/doc/qt5/qt3d/qt3dcore-qnodeid-members.html
  2152. share/doc/qt5/qt3d/qt3dcore-qnodeid.html
  2153. share/doc/qt5/qt3d/qt3dcore-qnodeidtypepair-members.html
  2154. share/doc/qt5/qt3d/qt3dcore-qnodeidtypepair.html
  2155. share/doc/qt5/qt3d/qt3dcore-qpropertynodeaddedchange-members.html
  2156. share/doc/qt5/qt3d/qt3dcore-qpropertynodeaddedchange.html
  2157. share/doc/qt5/qt3d/qt3dcore-qpropertynoderemovedchange-members.html
  2158. share/doc/qt5/qt3d/qt3dcore-qpropertynoderemovedchange.html
  2159. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchange-members.html
  2160. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchange.html
  2161. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchangebase-members.html
  2162. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchangebase.html
  2163. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchange-members.html
  2164. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchange.html
  2165. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchangebase-members.html
  2166. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchangebase.html
  2167. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchange-members.html
  2168. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchange.html
  2169. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchangebase-members.html
  2170. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchangebase.html
  2171. share/doc/qt5/qt3d/qt3dcore-qscenechange-members.html
  2172. share/doc/qt5/qt3d/qt3dcore-qscenechange.html
  2173. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyupdatedchangebase-members.html
  2174. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyupdatedchangebase.html
  2175. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
  2176. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase.html
  2177. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
  2178. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase.html
  2179. share/doc/qt5/qt3d/qt3dcore-qtransform-members.html
  2180. share/doc/qt5/qt3d/qt3dcore-qtransform.html
  2181. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
  2182. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine.html
  2183. share/doc/qt5/qt3d/qt3dcore-quick.html
  2184. share/doc/qt5/qt3d/qt3dcore.html
  2185. share/doc/qt5/qt3d/qt3dextras-module.html
  2186. share/doc/qt5/qt3d/qt3dextras-qconegeometry-members.html
  2187. share/doc/qt5/qt3d/qt3dextras-qconegeometry.html
  2188. share/doc/qt5/qt3d/qt3dextras-qconemesh-members.html
  2189. share/doc/qt5/qt3d/qt3dextras-qconemesh.html
  2190. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry-members.html
  2191. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry.html
  2192. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh-members.html
  2193. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh.html
  2194. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry-members.html
  2195. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry.html
  2196. share/doc/qt5/qt3d/qt3dextras-qcylindermesh-members.html
  2197. share/doc/qt5/qt3d/qt3dextras-qcylindermesh.html
  2198. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial-members.html
  2199. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial.html
  2200. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
  2201. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
  2202. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry-members.html
  2203. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry.html
  2204. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh-members.html
  2205. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh.html
  2206. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
  2207. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller.html
  2208. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer-members.html
  2209. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer-obsolete.html
  2210. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer.html
  2211. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial-members.html
  2212. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial.html
  2213. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial-members.html
  2214. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial.html
  2215. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial-members.html
  2216. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial.html
  2217. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
  2218. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
  2219. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
  2220. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
  2221. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
  2222. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
  2223. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller-members.html
  2224. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller.html
  2225. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial-members.html
  2226. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial.html
  2227. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial-members.html
  2228. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial.html
  2229. share/doc/qt5/qt3d/qt3dextras-qphongmaterial-members.html
  2230. share/doc/qt5/qt3d/qt3dextras-qphongmaterial.html
  2231. share/doc/qt5/qt3d/qt3dextras-qplanegeometry-members.html
  2232. share/doc/qt5/qt3d/qt3dextras-qplanegeometry.html
  2233. share/doc/qt5/qt3d/qt3dextras-qplanemesh-members.html
  2234. share/doc/qt5/qt3d/qt3dextras-qplanemesh.html
  2235. share/doc/qt5/qt3d/qt3dextras-qskyboxentity-members.html
  2236. share/doc/qt5/qt3d/qt3dextras-qskyboxentity.html
  2237. share/doc/qt5/qt3d/qt3dextras-qspheregeometry-members.html
  2238. share/doc/qt5/qt3d/qt3dextras-qspheregeometry.html
  2239. share/doc/qt5/qt3d/qt3dextras-qspheremesh-members.html
  2240. share/doc/qt5/qt3d/qt3dextras-qspheremesh.html
  2241. share/doc/qt5/qt3d/qt3dextras-qt3dwindow-members.html
  2242. share/doc/qt5/qt3d/qt3dextras-qt3dwindow.html
  2243. share/doc/qt5/qt3d/qt3dextras-qtext2dentity-members.html
  2244. share/doc/qt5/qt3d/qt3dextras-qtext2dentity.html
  2245. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial-members.html
  2246. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial.html
  2247. share/doc/qt5/qt3d/qt3dextras-qtexturematerial-members.html
  2248. share/doc/qt5/qt3d/qt3dextras-qtexturematerial.html
  2249. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry-members.html
  2250. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry.html
  2251. share/doc/qt5/qt3d/qt3dextras-qtorusmesh-members.html
  2252. share/doc/qt5/qt3d/qt3dextras-qtorusmesh.html
  2253. share/doc/qt5/qt3d/qt3dextras.html
  2254. share/doc/qt5/qt3d/qt3dinput-module.html
  2255. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput-members.html
  2256. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput.html
  2257. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput-members.html
  2258. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput.html
  2259. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice-members.html
  2260. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice.html
  2261. share/doc/qt5/qt3d/qt3dinput-qaction-members.html
  2262. share/doc/qt5/qt3d/qt3dinput-qaction.html
  2263. share/doc/qt5/qt3d/qt3dinput-qactioninput-members.html
  2264. share/doc/qt5/qt3d/qt3dinput-qactioninput.html
  2265. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput-members.html
  2266. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput.html
  2267. share/doc/qt5/qt3d/qt3dinput-qaxis-members.html
  2268. share/doc/qt5/qt3d/qt3dinput-qaxis.html
  2269. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator-members.html
  2270. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator.html
  2271. share/doc/qt5/qt3d/qt3dinput-qaxissetting-members.html
  2272. share/doc/qt5/qt3d/qt3dinput-qaxissetting.html
  2273. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput-members.html
  2274. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput.html
  2275. share/doc/qt5/qt3d/qt3dinput-qinputaspect-members.html
  2276. share/doc/qt5/qt3d/qt3dinput-qinputaspect.html
  2277. share/doc/qt5/qt3d/qt3dinput-qinputchord-members.html
  2278. share/doc/qt5/qt3d/qt3dinput-qinputchord.html
  2279. share/doc/qt5/qt3d/qt3dinput-qinputsequence-members.html
  2280. share/doc/qt5/qt3d/qt3dinput-qinputsequence.html
  2281. share/doc/qt5/qt3d/qt3dinput-qinputsettings-members.html
  2282. share/doc/qt5/qt3d/qt3dinput-qinputsettings.html
  2283. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice-members.html
  2284. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice.html
  2285. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler-members.html
  2286. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler.html
  2287. share/doc/qt5/qt3d/qt3dinput-qkeyevent-members.html
  2288. share/doc/qt5/qt3d/qt3dinput-qkeyevent.html
  2289. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice-members.html
  2290. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice.html
  2291. share/doc/qt5/qt3d/qt3dinput-qmousedevice-members.html
  2292. share/doc/qt5/qt3d/qt3dinput-qmousedevice.html
  2293. share/doc/qt5/qt3d/qt3dinput-qmouseevent-members.html
  2294. share/doc/qt5/qt3d/qt3dinput-qmouseevent.html
  2295. share/doc/qt5/qt3d/qt3dinput-qmousehandler-members.html
  2296. share/doc/qt5/qt3d/qt3dinput-qmousehandler.html
  2297. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchange-members.html
  2298. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchange.html
  2299. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchangebase-members.html
  2300. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchangebase.html
  2301. share/doc/qt5/qt3d/qt3dinput-qwheelevent-members.html
  2302. share/doc/qt5/qt3d/qt3dinput-qwheelevent.html
  2303. share/doc/qt5/qt3d/qt3dinput.html
  2304. share/doc/qt5/qt3d/qt3dlogic-logic.html
  2305. share/doc/qt5/qt3d/qt3dlogic-module.html
  2306. share/doc/qt5/qt3d/qt3dlogic-qframeaction-members.html
  2307. share/doc/qt5/qt3d/qt3dlogic-qframeaction.html
  2308. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect-members.html
  2309. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect.html
  2310. share/doc/qt5/qt3d/qt3dlogic.html
  2311. share/doc/qt5/qt3d/qt3drender-assimphelper.html
  2312. share/doc/qt5/qt3d/qt3drender-assimpimporter-members.html
  2313. share/doc/qt5/qt3d/qt3drender-assimpimporter.html
  2314. share/doc/qt5/qt3d/qt3drender-fbxgeometryloader-members.html
  2315. share/doc/qt5/qt3d/qt3drender-fbxgeometryloader.html
  2316. share/doc/qt5/qt3d/qt3drender-framegraph.html
  2317. share/doc/qt5/qt3d/qt3drender-functortype-members.html
  2318. share/doc/qt5/qt3d/qt3drender-functortype.html
  2319. share/doc/qt5/qt3d/qt3drender-geometry.html
  2320. share/doc/qt5/qt3d/qt3drender-gltfexporter-gltfoptions-members.html
  2321. share/doc/qt5/qt3d/qt3drender-gltfexporter-gltfoptions.html
  2322. share/doc/qt5/qt3d/qt3drender-gltfexporter-members.html
  2323. share/doc/qt5/qt3d/qt3drender-gltfexporter.html
  2324. share/doc/qt5/qt3d/qt3drender-gltfgeometryloader-members.html
  2325. share/doc/qt5/qt3d/qt3drender-gltfgeometryloader.html
  2326. share/doc/qt5/qt3d/qt3drender-gltfimporter-members.html
  2327. share/doc/qt5/qt3d/qt3drender-gltfimporter.html
  2328. share/doc/qt5/qt3d/qt3drender-module.html
  2329. share/doc/qt5/qt3d/qt3drender-objgeometryloader-members.html
  2330. share/doc/qt5/qt3d/qt3drender-objgeometryloader.html
  2331. share/doc/qt5/qt3d/qt3drender-plygeometryloader-element-members.html
  2332. share/doc/qt5/qt3d/qt3drender-plygeometryloader-element.html
  2333. share/doc/qt5/qt3d/qt3drender-plygeometryloader-members.html
  2334. share/doc/qt5/qt3d/qt3drender-plygeometryloader-property-members.html
  2335. share/doc/qt5/qt3d/qt3drender-plygeometryloader-property.html
  2336. share/doc/qt5/qt3d/qt3drender-plygeometryloader.html
  2337. share/doc/qt5/qt3d/qt3drender-propertyreaderinterface-members.html
  2338. share/doc/qt5/qt3d/qt3drender-propertyreaderinterface.html
  2339. share/doc/qt5/qt3d/qt3drender-protips.html
  2340. share/doc/qt5/qt3d/qt3drender-qabstractfunctor-members.html
  2341. share/doc/qt5/qt3d/qt3drender-qabstractfunctor.html
  2342. share/doc/qt5/qt3d/qt3drender-qabstractlight-members.html
  2343. share/doc/qt5/qt3d/qt3drender-qabstractlight.html
  2344. share/doc/qt5/qt3d/qt3drender-qabstracttexture-members.html
  2345. share/doc/qt5/qt3d/qt3drender-qabstracttexture.html
  2346. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage-members.html
  2347. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage.html
  2348. share/doc/qt5/qt3d/qt3drender-qalphacoverage-members.html
  2349. share/doc/qt5/qt3d/qt3drender-qalphacoverage.html
  2350. share/doc/qt5/qt3d/qt3drender-qalphatest-members.html
  2351. share/doc/qt5/qt3d/qt3drender-qalphatest.html
  2352. share/doc/qt5/qt3d/qt3drender-qattribute-members.html
  2353. share/doc/qt5/qt3d/qt3drender-qattribute.html
  2354. share/doc/qt5/qt3d/qt3drender-qblendequation-members.html
  2355. share/doc/qt5/qt3d/qt3drender-qblendequation.html
  2356. share/doc/qt5/qt3d/qt3drender-qblendequationarguments-members.html
  2357. share/doc/qt5/qt3d/qt3drender-qblendequationarguments.html
  2358. share/doc/qt5/qt3d/qt3drender-qbuffer-members.html
  2359. share/doc/qt5/qt3d/qt3drender-qbuffer.html
  2360. share/doc/qt5/qt3d/qt3drender-qbuffercapture-members.html
  2361. share/doc/qt5/qt3d/qt3drender-qbuffercapture.html
  2362. share/doc/qt5/qt3d/qt3drender-qbufferdatagenerator-members.html
  2363. share/doc/qt5/qt3d/qt3drender-qbufferdatagenerator.html
  2364. share/doc/qt5/qt3d/qt3drender-qcamera-members.html
  2365. share/doc/qt5/qt3d/qt3drender-qcamera.html
  2366. share/doc/qt5/qt3d/qt3drender-qcameralens-members.html
  2367. share/doc/qt5/qt3d/qt3drender-qcameralens.html
  2368. share/doc/qt5/qt3d/qt3drender-qcameraselector-members.html
  2369. share/doc/qt5/qt3d/qt3drender-qcameraselector.html
  2370. share/doc/qt5/qt3d/qt3drender-qclearbuffers-members.html
  2371. share/doc/qt5/qt3d/qt3drender-qclearbuffers.html
  2372. share/doc/qt5/qt3d/qt3drender-qclipplane-members.html
  2373. share/doc/qt5/qt3d/qt3drender-qclipplane.html
  2374. share/doc/qt5/qt3d/qt3drender-qcolormask-members.html
  2375. share/doc/qt5/qt3d/qt3drender-qcolormask.html
  2376. share/doc/qt5/qt3d/qt3drender-qcomputecommand-members.html
  2377. share/doc/qt5/qt3d/qt3drender-qcomputecommand.html
  2378. share/doc/qt5/qt3d/qt3drender-qcullface-members.html
  2379. share/doc/qt5/qt3d/qt3drender-qcullface.html
  2380. share/doc/qt5/qt3d/qt3drender-qdepthtest-members.html
  2381. share/doc/qt5/qt3d/qt3drender-qdepthtest.html
  2382. share/doc/qt5/qt3d/qt3drender-qdirectionallight-members.html
  2383. share/doc/qt5/qt3d/qt3drender-qdirectionallight.html
  2384. share/doc/qt5/qt3d/qt3drender-qdispatchcompute-members.html
  2385. share/doc/qt5/qt3d/qt3drender-qdispatchcompute.html
  2386. share/doc/qt5/qt3d/qt3drender-qdithering-members.html
  2387. share/doc/qt5/qt3d/qt3drender-qdithering.html
  2388. share/doc/qt5/qt3d/qt3drender-qeffect-members.html
  2389. share/doc/qt5/qt3d/qt3drender-qeffect.html
  2390. share/doc/qt5/qt3d/qt3drender-qenvironmentlight-members.html
  2391. share/doc/qt5/qt3d/qt3drender-qenvironmentlight.html
  2392. share/doc/qt5/qt3d/qt3drender-qfilterkey-members.html
  2393. share/doc/qt5/qt3d/qt3drender-qfilterkey.html
  2394. share/doc/qt5/qt3d/qt3drender-qframegraphnode-members.html
  2395. share/doc/qt5/qt3d/qt3drender-qframegraphnode.html
  2396. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchange-members.html
  2397. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchange.html
  2398. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchangebase-members.html
  2399. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchangebase.html
  2400. share/doc/qt5/qt3d/qt3drender-qfrontface-members.html
  2401. share/doc/qt5/qt3d/qt3drender-qfrontface.html
  2402. share/doc/qt5/qt3d/qt3drender-qfrustumculling-members.html
  2403. share/doc/qt5/qt3d/qt3drender-qfrustumculling.html
  2404. share/doc/qt5/qt3d/qt3drender-qgeometry-members.html
  2405. share/doc/qt5/qt3d/qt3drender-qgeometry.html
  2406. share/doc/qt5/qt3d/qt3drender-qgeometryfactory-members.html
  2407. share/doc/qt5/qt3d/qt3drender-qgeometryfactory.html
  2408. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer-members.html
  2409. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer.html
  2410. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter-members.html
  2411. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter.html
  2412. share/doc/qt5/qt3d/qt3drender-qlayer-members.html
  2413. share/doc/qt5/qt3d/qt3drender-qlayer.html
  2414. share/doc/qt5/qt3d/qt3drender-qlayerfilter-members.html
  2415. share/doc/qt5/qt3d/qt3drender-qlayerfilter.html
  2416. share/doc/qt5/qt3d/qt3drender-qlevelofdetail-members.html
  2417. share/doc/qt5/qt3d/qt3drender-qlevelofdetail.html
  2418. share/doc/qt5/qt3d/qt3drender-qlevelofdetailboundingsphere-members.html
  2419. share/doc/qt5/qt3d/qt3drender-qlevelofdetailboundingsphere.html
  2420. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch-members.html
  2421. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch.html
  2422. share/doc/qt5/qt3d/qt3drender-qmaterial-members.html
  2423. share/doc/qt5/qt3d/qt3drender-qmaterial.html
  2424. share/doc/qt5/qt3d/qt3drender-qmemorybarrier-members.html
  2425. share/doc/qt5/qt3d/qt3drender-qmemorybarrier.html
  2426. share/doc/qt5/qt3d/qt3drender-qmesh-members.html
  2427. share/doc/qt5/qt3d/qt3drender-qmesh.html
  2428. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing-members.html
  2429. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing.html
  2430. share/doc/qt5/qt3d/qt3drender-qnodepthmask-members.html
  2431. share/doc/qt5/qt3d/qt3drender-qnodepthmask.html
  2432. share/doc/qt5/qt3d/qt3drender-qnodraw-members.html
  2433. share/doc/qt5/qt3d/qt3drender-qnodraw.html
  2434. share/doc/qt5/qt3d/qt3drender-qobjectpicker-members.html
  2435. share/doc/qt5/qt3d/qt3drender-qobjectpicker.html
  2436. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage-members.html
  2437. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage.html
  2438. share/doc/qt5/qt3d/qt3drender-qparameter-members.html
  2439. share/doc/qt5/qt3d/qt3drender-qparameter.html
  2440. share/doc/qt5/qt3d/qt3drender-qpickevent-members.html
  2441. share/doc/qt5/qt3d/qt3drender-qpickevent.html
  2442. share/doc/qt5/qt3d/qt3drender-qpickingsettings-members.html
  2443. share/doc/qt5/qt3d/qt3drender-qpickingsettings.html
  2444. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent-members.html
  2445. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent.html
  2446. share/doc/qt5/qt3d/qt3drender-qpointlight-members.html
  2447. share/doc/qt5/qt3d/qt3drender-qpointlight.html
  2448. share/doc/qt5/qt3d/qt3drender-qpointsize-members.html
  2449. share/doc/qt5/qt3d/qt3drender-qpointsize.html
  2450. share/doc/qt5/qt3d/qt3drender-qpolygonoffset-members.html
  2451. share/doc/qt5/qt3d/qt3drender-qpolygonoffset.html
  2452. share/doc/qt5/qt3d/qt3drender-qrenderaspect-members.html
  2453. share/doc/qt5/qt3d/qt3drender-qrenderaspect.html
  2454. share/doc/qt5/qt3d/qt3drender-qrendercapture-members.html
  2455. share/doc/qt5/qt3d/qt3drender-qrendercapture.html
  2456. share/doc/qt5/qt3d/qt3drender-qrendercapturereply-members.html
  2457. share/doc/qt5/qt3d/qt3drender-qrendercapturereply.html
  2458. share/doc/qt5/qt3d/qt3drender-qrenderpass-members.html
  2459. share/doc/qt5/qt3d/qt3drender-qrenderpass.html
  2460. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter-members.html
  2461. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter.html
  2462. share/doc/qt5/qt3d/qt3drender-qrendersettings-members.html
  2463. share/doc/qt5/qt3d/qt3drender-qrendersettings.html
  2464. share/doc/qt5/qt3d/qt3drender-qrenderstate-members.html
  2465. share/doc/qt5/qt3d/qt3drender-qrenderstate.html
  2466. share/doc/qt5/qt3d/qt3drender-qrenderstateset-members.html
  2467. share/doc/qt5/qt3d/qt3drender-qrenderstateset.html
  2468. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector-members.html
  2469. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector.html
  2470. share/doc/qt5/qt3d/qt3drender-qrendertarget-members.html
  2471. share/doc/qt5/qt3d/qt3drender-qrendertarget.html
  2472. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput-members.html
  2473. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput.html
  2474. share/doc/qt5/qt3d/qt3drender-qrendertargetselector-members.html
  2475. share/doc/qt5/qt3d/qt3drender-qrendertargetselector.html
  2476. share/doc/qt5/qt3d/qt3drender-qsceneloader-members.html
  2477. share/doc/qt5/qt3d/qt3drender-qsceneloader.html
  2478. share/doc/qt5/qt3d/qt3drender-qscissortest-members.html
  2479. share/doc/qt5/qt3d/qt3drender-qscissortest.html
  2480. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap-members.html
  2481. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap.html
  2482. share/doc/qt5/qt3d/qt3drender-qshaderdata-members.html
  2483. share/doc/qt5/qt3d/qt3drender-qshaderdata.html
  2484. share/doc/qt5/qt3d/qt3drender-qshaderprogram-members.html
  2485. share/doc/qt5/qt3d/qt3drender-qshaderprogram.html
  2486. share/doc/qt5/qt3d/qt3drender-qsortpolicy-members.html
  2487. share/doc/qt5/qt3d/qt3drender-qsortpolicy.html
  2488. share/doc/qt5/qt3d/qt3drender-qspotlight-members.html
  2489. share/doc/qt5/qt3d/qt3drender-qspotlight.html
  2490. share/doc/qt5/qt3d/qt3drender-qstencilmask-members.html
  2491. share/doc/qt5/qt3d/qt3drender-qstencilmask.html
  2492. share/doc/qt5/qt3d/qt3drender-qstenciloperation-members.html
  2493. share/doc/qt5/qt3d/qt3drender-qstenciloperation.html
  2494. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments-members.html
  2495. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments.html
  2496. share/doc/qt5/qt3d/qt3drender-qstenciltest-members.html
  2497. share/doc/qt5/qt3d/qt3drender-qstenciltest.html
  2498. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments-members.html
  2499. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments.html
  2500. share/doc/qt5/qt3d/qt3drender-qtechnique-members.html
  2501. share/doc/qt5/qt3d/qt3drender-qtechnique.html
  2502. share/doc/qt5/qt3d/qt3drender-qtechniquefilter-members.html
  2503. share/doc/qt5/qt3d/qt3drender-qtechniquefilter.html
  2504. share/doc/qt5/qt3d/qt3drender-qtexture1d-members.html
  2505. share/doc/qt5/qt3d/qt3drender-qtexture1d.html
  2506. share/doc/qt5/qt3d/qt3drender-qtexture1darray-members.html
  2507. share/doc/qt5/qt3d/qt3drender-qtexture1darray.html
  2508. share/doc/qt5/qt3d/qt3drender-qtexture2d-members.html
  2509. share/doc/qt5/qt3d/qt3drender-qtexture2d.html
  2510. share/doc/qt5/qt3d/qt3drender-qtexture2darray-members.html
  2511. share/doc/qt5/qt3d/qt3drender-qtexture2darray.html
  2512. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample-members.html
  2513. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample.html
  2514. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
  2515. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray.html
  2516. share/doc/qt5/qt3d/qt3drender-qtexture3d-members.html
  2517. share/doc/qt5/qt3d/qt3drender-qtexture3d.html
  2518. share/doc/qt5/qt3d/qt3drender-qtexturebuffer-members.html
  2519. share/doc/qt5/qt3d/qt3drender-qtexturebuffer.html
  2520. share/doc/qt5/qt3d/qt3drender-qtexturecubemap-members.html
  2521. share/doc/qt5/qt3d/qt3drender-qtexturecubemap.html
  2522. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray-members.html
  2523. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray.html
  2524. share/doc/qt5/qt3d/qt3drender-qtexturedata-members.html
  2525. share/doc/qt5/qt3d/qt3drender-qtexturedata.html
  2526. share/doc/qt5/qt3d/qt3drender-qtexturegenerator-members.html
  2527. share/doc/qt5/qt3d/qt3drender-qtexturegenerator.html
  2528. share/doc/qt5/qt3d/qt3drender-qtextureimage-members.html
  2529. share/doc/qt5/qt3d/qt3drender-qtextureimage.html
  2530. share/doc/qt5/qt3d/qt3drender-qtextureimagedata-members.html
  2531. share/doc/qt5/qt3d/qt3drender-qtextureimagedata.html
  2532. share/doc/qt5/qt3d/qt3drender-qtextureimagedatagenerator-members.html
  2533. share/doc/qt5/qt3d/qt3drender-qtextureimagedatagenerator.html
  2534. share/doc/qt5/qt3d/qt3drender-qtextureloader-members.html
  2535. share/doc/qt5/qt3d/qt3drender-qtextureloader.html
  2536. share/doc/qt5/qt3d/qt3drender-qtexturerectangle-members.html
  2537. share/doc/qt5/qt3d/qt3drender-qtexturerectangle.html
  2538. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode-members.html
  2539. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode.html
  2540. share/doc/qt5/qt3d/qt3drender-quick-qscene2d-members.html
  2541. share/doc/qt5/qt3d/qt3drender-quick-qscene2d.html
  2542. share/doc/qt5/qt3d/qt3drender-qviewport-members.html
  2543. share/doc/qt5/qt3d/qt3drender-qviewport.html
  2544. share/doc/qt5/qt3d/qt3drender-render.html
  2545. share/doc/qt5/qt3d/qt3drender-stlgeometryloader-members.html
  2546. share/doc/qt5/qt3d/qt3drender-stlgeometryloader.html
  2547. share/doc/qt5/qt3d/qt3drender.html
  2548. share/doc/qt5/qt3d/qt3dscene2d-module.html
  2549. share/doc/qt5/qt3d/style/offline-simple.css
  2550. share/doc/qt5/qt3d/style/offline.css
  2551. share/doc/qt5/qtandroidextras.qch
  2552. share/doc/qt5/qtandroidextras/examples-manifest.xml
  2553. share/doc/qt5/qtandroidextras/examples-qtandroidextras.html
  2554. share/doc/qt5/qtandroidextras/images/arrow_bc.png
  2555. share/doc/qt5/qtandroidextras/images/bgrContent.png
  2556. share/doc/qt5/qtandroidextras/images/btn_next.png
  2557. share/doc/qt5/qtandroidextras/images/btn_prev.png
  2558. share/doc/qt5/qtandroidextras/images/bullet_dn.png
  2559. share/doc/qt5/qtandroidextras/images/bullet_sq.png
  2560. share/doc/qt5/qtandroidextras/images/home.png
  2561. share/doc/qt5/qtandroidextras/images/ico_note.png
  2562. share/doc/qt5/qtandroidextras/images/ico_note_attention.png
  2563. share/doc/qt5/qtandroidextras/images/ico_out.png
  2564. share/doc/qt5/qtandroidextras/images/logo.png
  2565. share/doc/qt5/qtandroidextras/images/notification.png
  2566. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/images/happy.png
  2567. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/images/sad.png
  2568. share/doc/qt5/qtandroidextras/qandroidactivityresultreceiver-members.html
  2569. share/doc/qt5/qtandroidextras/qandroidactivityresultreceiver.html
  2570. share/doc/qt5/qtandroidextras/qandroidjnienvironment-members.html
  2571. share/doc/qt5/qtandroidextras/qandroidjnienvironment.html
  2572. share/doc/qt5/qtandroidextras/qandroidjniobject-members.html
  2573. share/doc/qt5/qtandroidextras/qandroidjniobject.html
  2574. share/doc/qt5/qtandroidextras/qtandroid.html
  2575. share/doc/qt5/qtandroidextras/qtandroidextras-index.html
  2576. share/doc/qt5/qtandroidextras/qtandroidextras-module.html
  2577. share/doc/qt5/qtandroidextras/qtandroidextras-notification-android-sources-androidmanifest-xml.html
  2578. share/doc/qt5/qtandroidextras/qtandroidextras-notification-android-sources-src-org-qtproject-example-notification-notificationclient-java.html
  2579. share/doc/qt5/qtandroidextras/qtandroidextras-notification-example.html
  2580. share/doc/qt5/qtandroidextras/qtandroidextras-notification-main-cpp.html
  2581. share/doc/qt5/qtandroidextras/qtandroidextras-notification-main-qrc.html
  2582. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notification-pro.html
  2583. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notificationclient-cpp.html
  2584. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notificationclient-h.html
  2585. share/doc/qt5/qtandroidextras/qtandroidextras-notification-qml-main-qml.html
  2586. share/doc/qt5/qtandroidextras/qtandroidextras.index
  2587. share/doc/qt5/qtandroidextras/qtandroidextras.qhp
  2588. share/doc/qt5/qtandroidextras/qtandroidextras.qhp.sha1
  2589. share/doc/qt5/qtandroidextras/style/offline-simple.css
  2590. share/doc/qt5/qtandroidextras/style/offline.css
  2591. share/doc/qt5/qtassistant.qch
  2592. share/doc/qt5/qtassistant/assistant-custom-help-viewer.html
  2593. share/doc/qt5/qtassistant/assistant-details.html
  2594. share/doc/qt5/qtassistant/assistant-quick-guide.html
  2595. share/doc/qt5/qtassistant/examples-manifest.xml
  2596. share/doc/qt5/qtassistant/examples-qtassistant.html
  2597. share/doc/qt5/qtassistant/images/arrow_bc.png
  2598. share/doc/qt5/qtassistant/images/assistant-assistant.png
  2599. share/doc/qt5/qtassistant/images/assistant-bookmarks.png
  2600. share/doc/qt5/qtassistant/images/assistant-dockwidgets.png
  2601. share/doc/qt5/qtassistant/images/assistant-examples.png
  2602. share/doc/qt5/qtassistant/images/assistant-index.png
  2603. share/doc/qt5/qtassistant/images/assistant-preferences-documentation.png
  2604. share/doc/qt5/qtassistant/images/assistant-preferences-filters.png
  2605. share/doc/qt5/qtassistant/images/assistant-preferences-fonts.png
  2606. share/doc/qt5/qtassistant/images/assistant-preferences-options.png
  2607. share/doc/qt5/qtassistant/images/assistant-search.png
  2608. share/doc/qt5/qtassistant/images/bgrContent.png
  2609. share/doc/qt5/qtassistant/images/btn_next.png
  2610. share/doc/qt5/qtassistant/images/btn_prev.png
  2611. share/doc/qt5/qtassistant/images/bullet_dn.png
  2612. share/doc/qt5/qtassistant/images/bullet_sq.png
  2613. share/doc/qt5/qtassistant/images/home.png
  2614. share/doc/qt5/qtassistant/images/ico_note.png
  2615. share/doc/qt5/qtassistant/images/ico_note_attention.png
  2616. share/doc/qt5/qtassistant/images/ico_out.png
  2617. share/doc/qt5/qtassistant/images/logo.png
  2618. share/doc/qt5/qtassistant/images/simpletextviewer-example.png
  2619. share/doc/qt5/qtassistant/images/simpletextviewer-findfiledialog.png
  2620. share/doc/qt5/qtassistant/images/simpletextviewer-mainwindow.png
  2621. share/doc/qt5/qtassistant/qtassistant-index.html
  2622. share/doc/qt5/qtassistant/qtassistant-remotecontrol-example.html
  2623. share/doc/qt5/qtassistant/qtassistant-remotecontrol-main-cpp.html
  2624. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-cpp.html
  2625. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-h.html
  2626. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-pro.html
  2627. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-qrc.html
  2628. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-ui.html
  2629. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-assistant-cpp.html
  2630. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-assistant-h.html
  2631. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhcp.html
  2632. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhp.html
  2633. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-example.html
  2634. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-findfiledialog-cpp.html
  2635. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-findfiledialog-h.html
  2636. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-main-cpp.html
  2637. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-mainwindow-cpp.html
  2638. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-mainwindow-h.html
  2639. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-simpletextviewer-pro.html
  2640. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-textedit-cpp.html
  2641. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-textedit-h.html
  2642. share/doc/qt5/qtassistant/qtassistant.index
  2643. share/doc/qt5/qtassistant/qtassistant.qhp
  2644. share/doc/qt5/qtassistant/qtassistant.qhp.sha1
  2645. share/doc/qt5/qtassistant/style/offline-simple.css
  2646. share/doc/qt5/qtassistant/style/offline.css
  2647. share/doc/qt5/qtbluetooth.qch
  2648. share/doc/qt5/qtbluetooth/bluetooth-examples.html
  2649. share/doc/qt5/qtbluetooth/examples-manifest.xml
  2650. share/doc/qt5/qtbluetooth/images/arrow_bc.png
  2651. share/doc/qt5/qtbluetooth/images/bgrContent.png
  2652. share/doc/qt5/qtbluetooth/images/btchat-example.png
  2653. share/doc/qt5/qtbluetooth/images/btfiletransfer-example.png
  2654. share/doc/qt5/qtbluetooth/images/btn_next.png
  2655. share/doc/qt5/qtbluetooth/images/btn_prev.png
  2656. share/doc/qt5/qtbluetooth/images/btscanner-example.png
  2657. share/doc/qt5/qtbluetooth/images/bullet_dn.png
  2658. share/doc/qt5/qtbluetooth/images/bullet_sq.png
  2659. share/doc/qt5/qtbluetooth/images/chat-view.png
  2660. share/doc/qt5/qtbluetooth/images/devicescan.png
  2661. share/doc/qt5/qtbluetooth/images/heartgame-result.png
  2662. share/doc/qt5/qtbluetooth/images/heartgame-running.png
  2663. share/doc/qt5/qtbluetooth/images/heartgame-search.png
  2664. share/doc/qt5/qtbluetooth/images/heartgame-start.png
  2665. share/doc/qt5/qtbluetooth/images/home.png
  2666. share/doc/qt5/qtbluetooth/images/ico_note.png
  2667. share/doc/qt5/qtbluetooth/images/ico_note_attention.png
  2668. share/doc/qt5/qtbluetooth/images/ico_out.png
  2669. share/doc/qt5/qtbluetooth/images/intro.png
  2670. share/doc/qt5/qtbluetooth/images/intro1.png
  2671. share/doc/qt5/qtbluetooth/images/logo.png
  2672. share/doc/qt5/qtbluetooth/images/lowenergyscanner-chars.png
  2673. share/doc/qt5/qtbluetooth/images/lowenergyscanner-devices.png
  2674. share/doc/qt5/qtbluetooth/images/lowenergyscanner-services.png
  2675. share/doc/qt5/qtbluetooth/images/opp-example-1.png
  2676. share/doc/qt5/qtbluetooth/images/opp-example-2.png
  2677. share/doc/qt5/qtbluetooth/images/opp-example-3.png
  2678. share/doc/qt5/qtbluetooth/images/peripheral-structure.png
  2679. share/doc/qt5/qtbluetooth/images/servicescan.png
  2680. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/clear.png
  2681. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/default.png
  2682. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/lineedit-bg.png
  2683. share/doc/qt5/qtbluetooth/qbluetooth.html
  2684. share/doc/qt5/qtbluetooth/qbluetoothaddress-members.html
  2685. share/doc/qt5/qtbluetooth/qbluetoothaddress.html
  2686. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
  2687. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent.html
  2688. share/doc/qt5/qtbluetooth/qbluetoothdeviceinfo-members.html
  2689. share/doc/qt5/qtbluetooth/qbluetoothdeviceinfo.html
  2690. share/doc/qt5/qtbluetooth/qbluetoothhostinfo-members.html
  2691. share/doc/qt5/qtbluetooth/qbluetoothhostinfo.html
  2692. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice-members.html
  2693. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice.html
  2694. share/doc/qt5/qtbluetooth/qbluetoothserver-members.html
  2695. share/doc/qt5/qtbluetooth/qbluetoothserver.html
  2696. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent-members.html
  2697. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent.html
  2698. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
  2699. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-alternative.html
  2700. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-members.html
  2701. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
  2702. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-sequence.html
  2703. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo.html
  2704. share/doc/qt5/qtbluetooth/qbluetoothsocket-members.html
  2705. share/doc/qt5/qtbluetooth/qbluetoothsocket.html
  2706. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager-members.html
  2707. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager.html
  2708. share/doc/qt5/qtbluetooth/qbluetoothtransferreply-members.html
  2709. share/doc/qt5/qtbluetooth/qbluetoothtransferreply.html
  2710. share/doc/qt5/qtbluetooth/qbluetoothtransferrequest-members.html
  2711. share/doc/qt5/qtbluetooth/qbluetoothtransferrequest.html
  2712. share/doc/qt5/qtbluetooth/qbluetoothuuid-members.html
  2713. share/doc/qt5/qtbluetooth/qbluetoothuuid.html
  2714. share/doc/qt5/qtbluetooth/qlowenergyadvertisingdata-members.html
  2715. share/doc/qt5/qtbluetooth/qlowenergyadvertisingdata.html
  2716. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
  2717. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
  2718. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-members.html
  2719. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters.html
  2720. share/doc/qt5/qtbluetooth/qlowenergycharacteristic-members.html
  2721. share/doc/qt5/qtbluetooth/qlowenergycharacteristic.html
  2722. share/doc/qt5/qtbluetooth/qlowenergycharacteristicdata-members.html
  2723. share/doc/qt5/qtbluetooth/qlowenergycharacteristicdata.html
  2724. share/doc/qt5/qtbluetooth/qlowenergyconnectionparameters-members.html
  2725. share/doc/qt5/qtbluetooth/qlowenergyconnectionparameters.html
  2726. share/doc/qt5/qtbluetooth/qlowenergycontroller-members.html
  2727. share/doc/qt5/qtbluetooth/qlowenergycontroller-obsolete.html
  2728. share/doc/qt5/qtbluetooth/qlowenergycontroller.html
  2729. share/doc/qt5/qtbluetooth/qlowenergydescriptor-members.html
  2730. share/doc/qt5/qtbluetooth/qlowenergydescriptor.html
  2731. share/doc/qt5/qtbluetooth/qlowenergydescriptordata-members.html
  2732. share/doc/qt5/qtbluetooth/qlowenergydescriptordata.html
  2733. share/doc/qt5/qtbluetooth/qlowenergyservice-members.html
  2734. share/doc/qt5/qtbluetooth/qlowenergyservice.html
  2735. share/doc/qt5/qtbluetooth/qlowenergyservicedata-members.html
  2736. share/doc/qt5/qtbluetooth/qlowenergyservicedata.html
  2737. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel-members.html
  2738. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel.html
  2739. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothservice-members.html
  2740. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothservice.html
  2741. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothsocket-members.html
  2742. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothsocket.html
  2743. share/doc/qt5/qtbluetooth/qtbluetooth-attribution-bluez.html
  2744. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-btchat-pro.html
  2745. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-cpp.html
  2746. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-h.html
  2747. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-ui.html
  2748. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatclient-cpp.html
  2749. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatclient-h.html
  2750. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatserver-cpp.html
  2751. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatserver-h.html
  2752. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-example.html
  2753. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-main-cpp.html
  2754. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-cpp.html
  2755. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-h.html
  2756. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-ui.html
  2757. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-pro.html
  2758. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-qrc.html
  2759. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-example.html
  2760. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-main-cpp.html
  2761. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-cpp.html
  2762. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-h.html
  2763. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-ui.html
  2764. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-cpp.html
  2765. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-h.html
  2766. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-ui.html
  2767. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-cpp.html
  2768. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-h.html
  2769. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-ui.html
  2770. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-btscanner-pro.html
  2771. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-cpp.html
  2772. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-h.html
  2773. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-ui.html
  2774. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-example.html
  2775. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-main-cpp.html
  2776. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-cpp.html
  2777. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-h.html
  2778. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-ui.html
  2779. share/doc/qt5/qtbluetooth/qtbluetooth-chat-button-qml.html
  2780. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-pro.html
  2781. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-qml.html
  2782. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-qrc.html
  2783. share/doc/qt5/qtbluetooth/qtbluetooth-chat-example.html
  2784. share/doc/qt5/qtbluetooth/qtbluetooth-chat-inputbox-qml.html
  2785. share/doc/qt5/qtbluetooth/qtbluetooth-chat-qmlchat-cpp.html
  2786. share/doc/qt5/qtbluetooth/qtbluetooth-chat-search-qml.html
  2787. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-cpp.html
  2788. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-h.html
  2789. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-cpp.html
  2790. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-h.html
  2791. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-cpp.html
  2792. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-h.html
  2793. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-cpp.html
  2794. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-h.html
  2795. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-cpp.html
  2796. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-h.html
  2797. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-example.html
  2798. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-heartrate-game-pro.html
  2799. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-heartrate-global-h.html
  2800. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-images-qrc.html
  2801. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-main-cpp.html
  2802. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-app-qml.html
  2803. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-bluetoothalarmdialog-qml.html
  2804. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-bottomline-qml.html
  2805. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-connect-qml.html
  2806. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamebutton-qml.html
  2807. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamepage-qml.html
  2808. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamesettings-qml.html
  2809. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-main-qml.html
  2810. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-measure-qml.html
  2811. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-qmldir.html
  2812. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-qrc.html
  2813. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-splashscreen-qml.html
  2814. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-stats-qml.html
  2815. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-statslabel-qml.html
  2816. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-titlebar-qml.html
  2817. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-example.html
  2818. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-heartrate-server-pro.html
  2819. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-main-cpp.html
  2820. share/doc/qt5/qtbluetooth/qtbluetooth-index.html
  2821. share/doc/qt5/qtbluetooth/qtbluetooth-le-overview.html
  2822. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-characteristics-qml.html
  2823. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-dialog-qml.html
  2824. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-header-qml.html
  2825. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-label-qml.html
  2826. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-main-qml.html
  2827. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-menu-qml.html
  2828. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-services-qml.html
  2829. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-cpp.html
  2830. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-h.html
  2831. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-device-cpp.html
  2832. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-device-h.html
  2833. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-cpp.html
  2834. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-h.html
  2835. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
  2836. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-lowenergyscanner-pro.html
  2837. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-main-cpp.html
  2838. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-resources-qrc.html
  2839. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-cpp.html
  2840. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-h.html
  2841. share/doc/qt5/qtbluetooth/qtbluetooth-module.html
  2842. share/doc/qt5/qtbluetooth/qtbluetooth-overview.html
  2843. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-bttransfer-qml.html
  2844. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-button-qml.html
  2845. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-devicediscovery-qml.html
  2846. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-example.html
  2847. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filesending-qml.html
  2848. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-cpp.html
  2849. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-h.html
  2850. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-main-cpp.html
  2851. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-pictureselector-qml.html
  2852. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-picturetransfer-pro.html
  2853. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-qmltransfer-qrc.html
  2854. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-board-qml.html
  2855. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-dialog-qml.html
  2856. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-main-qml.html
  2857. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-menu-qml.html
  2858. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-example.html
  2859. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-main-cpp.html
  2860. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-cpp.html
  2861. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-h.html
  2862. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-pro.html
  2863. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-resource-qrc.html
  2864. share/doc/qt5/qtbluetooth/qtbluetooth-qmlmodule.html
  2865. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-button-qml.html
  2866. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-example.html
  2867. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-qmlscanner-cpp.html
  2868. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-pro.html
  2869. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-qml.html
  2870. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-qrc.html
  2871. share/doc/qt5/qtbluetooth/qtbluetooth.index
  2872. share/doc/qt5/qtbluetooth/qtbluetooth.qhp
  2873. share/doc/qt5/qtbluetooth/qtbluetooth.qhp.sha1
  2874. share/doc/qt5/qtbluetooth/qtbluetooth.tags
  2875. share/doc/qt5/qtbluetooth/style/offline-simple.css
  2876. share/doc/qt5/qtbluetooth/style/offline.css
  2877. share/doc/qt5/qtcanvas3d.qch
  2878. share/doc/qt5/qtcanvas3d/examples-manifest.xml
  2879. share/doc/qt5/qtcanvas3d/images/arrow_bc.png
  2880. share/doc/qt5/qtcanvas3d/images/bgrContent.png
  2881. share/doc/qt5/qtcanvas3d/images/btn_next.png
  2882. share/doc/qt5/qtcanvas3d/images/btn_prev.png
  2883. share/doc/qt5/qtcanvas3d/images/bullet_dn.png
  2884. share/doc/qt5/qtcanvas3d/images/bullet_sq.png
  2885. share/doc/qt5/qtcanvas3d/images/cellphone-example.png
  2886. share/doc/qt5/qtcanvas3d/images/framebuffer-example.png
  2887. share/doc/qt5/qtcanvas3d/images/home.png
  2888. share/doc/qt5/qtcanvas3d/images/ico_note.png
  2889. share/doc/qt5/qtcanvas3d/images/ico_note_attention.png
  2890. share/doc/qt5/qtcanvas3d/images/ico_out.png
  2891. share/doc/qt5/qtcanvas3d/images/interaction-example.png
  2892. share/doc/qt5/qtcanvas3d/images/jsonmodels-example.png
  2893. share/doc/qt5/qtcanvas3d/images/logo.png
  2894. share/doc/qt5/qtcanvas3d/images/oneqt-example.png
  2895. share/doc/qt5/qtcanvas3d/images/planets-example.jpg
  2896. share/doc/qt5/qtcanvas3d/images/quickitemtexture-example.png
  2897. share/doc/qt5/qtcanvas3d/images/textureandlight-example.png
  2898. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/calendar.png
  2899. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/camera.png
  2900. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/clock.png
  2901. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/contacts.png
  2902. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/gallery.png
  2903. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/games.png
  2904. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/lock.png
  2905. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/mail.png
  2906. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/maps.png
  2907. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/menu_background.jpg
  2908. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/music.png
  2909. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/plutomap1k.jpg
  2910. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/qtlogo_with_alpha.png
  2911. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/settings.png
  2912. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/todo.png
  2913. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/videos.png
  2914. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earth.png
  2915. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthbump1k.jpg
  2916. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthcloudmapcolortrans.png
  2917. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthmap1k.jpg
  2918. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthspec1k.jpg
  2919. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/galaxy_starfield.png
  2920. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupiter.png
  2921. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupitermap.jpg
  2922. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mars.png
  2923. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsbump1k.jpg
  2924. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsmap1k.jpg
  2925. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercury.png
  2926. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurybump.jpg
  2927. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurymap.jpg
  2928. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonbump1k.jpg
  2929. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonmap1k.jpg
  2930. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptune.png
  2931. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptunemap.jpg
  2932. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutobump1k.jpg
  2933. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutomap1k.jpg
  2934. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturn.png
  2935. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnmap.jpg
  2936. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnringcolortrans.png
  2937. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/sun.png
  2938. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/sunmap.jpg
  2939. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranus.png
  2940. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusmap.jpg
  2941. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusringcolortrans.png
  2942. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venus.png
  2943. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusbump.jpg
  2944. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusmap.jpg
  2945. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3d-members.html
  2946. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3d.html
  2947. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject-members.html
  2948. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject.html
  2949. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo-members.html
  2950. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo.html
  2951. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer-members.html
  2952. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer.html
  2953. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes-members.html
  2954. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes.html
  2955. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer-members.html
  2956. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer.html
  2957. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram-members.html
  2958. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram.html
  2959. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer-members.html
  2960. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer.html
  2961. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshader-members.html
  2962. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshader.html
  2963. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat-members.html
  2964. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat.html
  2965. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture-members.html
  2966. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture.html
  2967. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider-members.html
  2968. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider.html
  2969. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation-members.html
  2970. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation.html
  2971. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-context3d-members.html
  2972. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-context3d.html
  2973. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-glstatedumpext-members.html
  2974. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-glstatedumpext.html
  2975. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimage-members.html
  2976. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimage.html
  2977. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimagefactory-members.html
  2978. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimagefactory.html
  2979. share/doc/qt5/qtcanvas3d/qtcanvas3d-conformance-issues-html.html
  2980. share/doc/qt5/qtcanvas3d/qtcanvas3d-examples.html
  2981. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-example.html
  2982. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-pro.html
  2983. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-qrc.html
  2984. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-main-cpp.html
  2985. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-framebuffer-js.html
  2986. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-main-qml.html
  2987. share/doc/qt5/qtcanvas3d/qtcanvas3d-getting-started.html
  2988. share/doc/qt5/qtcanvas3d/qtcanvas3d-index.html
  2989. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-example.html
  2990. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-interaction-pro.html
  2991. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-interaction-qrc.html
  2992. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-main-cpp.html
  2993. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-interaction-js.html
  2994. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-main-qml.html
  2995. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-example.html
  2996. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-jsonmodels-pro.html
  2997. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-main-cpp.html
  2998. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-js.html
  2999. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-qml.html
  3000. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-qrc.html
  3001. share/doc/qt5/qtcanvas3d/qtcanvas3d-logging.html
  3002. share/doc/qt5/qtcanvas3d/qtcanvas3d-qmlmodule.html
  3003. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-example.html
  3004. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-main-cpp.html
  3005. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-main-qml.html
  3006. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-quickitemtexture-js.html
  3007. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-pro.html
  3008. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-qrc.html
  3009. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-example.html
  3010. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-main-cpp.html
  3011. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-main-qml.html
  3012. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-textureandlight-js.html
  3013. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-pro.html
  3014. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-qrc.html
  3015. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-pro.html
  3016. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-qrc.html
  3017. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-example.html
  3018. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-main-cpp.html
  3019. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphone-js.html
  3020. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphoneapp-qml.html
  3021. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphonecanvas-qml.html
  3022. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-colorselector-qml.html
  3023. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-fpsdisplay-qml.html
  3024. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-main-qml.html
  3025. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-example.html
  3026. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-js.html
  3027. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-qml.html
  3028. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-infosheet-qml.html
  3029. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-main-cpp.html
  3030. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-navibutton-qml.html
  3031. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-pro.html
  3032. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qml.html
  3033. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qrc.html
  3034. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-swipearea-qml.html
  3035. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-example.html
  3036. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-fpsdisplay-qml.html
  3037. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-infosheet-qml.html
  3038. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-main-cpp.html
  3039. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planetbutton-qml.html
  3040. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-js.html
  3041. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-pro.html
  3042. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qml.html
  3043. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qrc.html
  3044. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-styledslider-qml.html
  3045. share/doc/qt5/qtcanvas3d/qtcanvas3d.index
  3046. share/doc/qt5/qtcanvas3d/qtcanvas3d.qhp
  3047. share/doc/qt5/qtcanvas3d/qtcanvas3d.qhp.sha1
  3048. share/doc/qt5/qtcanvas3d/style/offline-simple.css
  3049. share/doc/qt5/qtcanvas3d/style/offline.css
  3050. share/doc/qt5/qtconcurrent.qch
  3051. share/doc/qt5/qtconcurrent/examples-manifest.xml
  3052. share/doc/qt5/qtconcurrent/images/arrow_bc.png
  3053. share/doc/qt5/qtconcurrent/images/bgrContent.png
  3054. share/doc/qt5/qtconcurrent/images/btn_next.png
  3055. share/doc/qt5/qtconcurrent/images/btn_prev.png
  3056. share/doc/qt5/qtconcurrent/images/bullet_dn.png
  3057. share/doc/qt5/qtconcurrent/images/bullet_sq.png
  3058. share/doc/qt5/qtconcurrent/images/home.png
  3059. share/doc/qt5/qtconcurrent/images/ico_note.png
  3060. share/doc/qt5/qtconcurrent/images/ico_note_attention.png
  3061. share/doc/qt5/qtconcurrent/images/ico_out.png
  3062. share/doc/qt5/qtconcurrent/images/imagescaling_example.png
  3063. share/doc/qt5/qtconcurrent/images/logo.png
  3064. share/doc/qt5/qtconcurrent/images/qtconcurrent-progressdialog.png
  3065. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-example.html
  3066. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-cpp.html
  3067. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-h.html
  3068. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-pro.html
  3069. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-main-cpp.html
  3070. share/doc/qt5/qtconcurrent/qtconcurrent-index.html
  3071. share/doc/qt5/qtconcurrent/qtconcurrent-map-example.html
  3072. share/doc/qt5/qtconcurrent/qtconcurrent-map-main-cpp.html
  3073. share/doc/qt5/qtconcurrent/qtconcurrent-map-map-pro.html
  3074. share/doc/qt5/qtconcurrent/qtconcurrent-module.html
  3075. share/doc/qt5/qtconcurrent/qtconcurrent-obsolete.html
  3076. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-example.html
  3077. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-main-cpp.html
  3078. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-progressdialog-pro.html
  3079. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-example.html
  3080. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-main-cpp.html
  3081. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-runfunction-pro.html
  3082. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-example.html
  3083. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-main-cpp.html
  3084. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-wordcount-pro.html
  3085. share/doc/qt5/qtconcurrent/qtconcurrent.html
  3086. share/doc/qt5/qtconcurrent/qtconcurrent.index
  3087. share/doc/qt5/qtconcurrent/qtconcurrent.qhp
  3088. share/doc/qt5/qtconcurrent/qtconcurrent.qhp.sha1
  3089. share/doc/qt5/qtconcurrent/qtconcurrent.tags
  3090. share/doc/qt5/qtconcurrent/qtconcurrentfilter.html
  3091. share/doc/qt5/qtconcurrent/qtconcurrentmap.html
  3092. share/doc/qt5/qtconcurrent/qtconcurrentrun.html
  3093. share/doc/qt5/qtconcurrent/style/offline-simple.css
  3094. share/doc/qt5/qtconcurrent/style/offline.css
  3095. share/doc/qt5/qtcore.qch
  3096. share/doc/qt5/qtcore/animation-overview.html
  3097. share/doc/qt5/qtcore/animation.html
  3098. share/doc/qt5/qtcore/codec-big5.html
  3099. share/doc/qt5/qtcore/codec-big5hkscs.html
  3100. share/doc/qt5/qtcore/codec-eucjp.html
  3101. share/doc/qt5/qtcore/codec-euckr.html
  3102. share/doc/qt5/qtcore/codec-gbk.html
  3103. share/doc/qt5/qtcore/codec-sjis.html
  3104. share/doc/qt5/qtcore/codec-tscii.html
  3105. share/doc/qt5/qtcore/codecs-jis.html
  3106. share/doc/qt5/qtcore/containers.html
  3107. share/doc/qt5/qtcore/custom-types.html
  3108. share/doc/qt5/qtcore/datastreamformat.html
  3109. share/doc/qt5/qtcore/events.html
  3110. share/doc/qt5/qtcore/eventsandfilters.html
  3111. share/doc/qt5/qtcore/examples-manifest.xml
  3112. share/doc/qt5/qtcore/images/abstract-connections.png
  3113. share/doc/qt5/qtcore/images/animations-architecture.png
  3114. share/doc/qt5/qtcore/images/arrow_bc.png
  3115. share/doc/qt5/qtcore/images/bgrContent.png
  3116. share/doc/qt5/qtcore/images/brush-styles.png
  3117. share/doc/qt5/qtcore/images/btn_next.png
  3118. share/doc/qt5/qtcore/images/btn_prev.png
  3119. share/doc/qt5/qtcore/images/bullet_dn.png
  3120. share/doc/qt5/qtcore/images/bullet_sq.png
  3121. share/doc/qt5/qtcore/images/cursor-arrow.png
  3122. share/doc/qt5/qtcore/images/cursor-busy.png
  3123. share/doc/qt5/qtcore/images/cursor-closedhand.png
  3124. share/doc/qt5/qtcore/images/cursor-cross.png
  3125. share/doc/qt5/qtcore/images/cursor-forbidden.png
  3126. share/doc/qt5/qtcore/images/cursor-hand.png
  3127. share/doc/qt5/qtcore/images/cursor-hsplit.png
  3128. share/doc/qt5/qtcore/images/cursor-ibeam.png
  3129. share/doc/qt5/qtcore/images/cursor-openhand.png
  3130. share/doc/qt5/qtcore/images/cursor-sizeall.png
  3131. share/doc/qt5/qtcore/images/cursor-sizeb.png
  3132. share/doc/qt5/qtcore/images/cursor-sizef.png
  3133. share/doc/qt5/qtcore/images/cursor-sizeh.png
  3134. share/doc/qt5/qtcore/images/cursor-sizev.png
  3135. share/doc/qt5/qtcore/images/cursor-uparrow.png
  3136. share/doc/qt5/qtcore/images/cursor-vsplit.png
  3137. share/doc/qt5/qtcore/images/cursor-wait.png
  3138. share/doc/qt5/qtcore/images/cursor-whatsthis.png
  3139. share/doc/qt5/qtcore/images/home.png
  3140. share/doc/qt5/qtcore/images/ico_note.png
  3141. share/doc/qt5/qtcore/images/ico_note_attention.png
  3142. share/doc/qt5/qtcore/images/ico_out.png
  3143. share/doc/qt5/qtcore/images/javaiterators1.png
  3144. share/doc/qt5/qtcore/images/javaiterators2.png
  3145. share/doc/qt5/qtcore/images/localfortuneclient-example.png
  3146. share/doc/qt5/qtcore/images/localfortuneserver-example.png
  3147. share/doc/qt5/qtcore/images/logo.png
  3148. share/doc/qt5/qtcore/images/mandelbrot-example.png
  3149. share/doc/qt5/qtcore/images/mandelbrot_scroll1.png
  3150. share/doc/qt5/qtcore/images/mandelbrot_scroll2.png
  3151. share/doc/qt5/qtcore/images/mandelbrot_scroll3.png
  3152. share/doc/qt5/qtcore/images/mandelbrot_zoom1.png
  3153. share/doc/qt5/qtcore/images/mandelbrot_zoom2.png
  3154. share/doc/qt5/qtcore/images/mandelbrot_zoom3.png
  3155. share/doc/qt5/qtcore/images/mimetypebrowser.png
  3156. share/doc/qt5/qtcore/images/modelindex-no-parent.png
  3157. share/doc/qt5/qtcore/images/modelview-begin-append-columns.png
  3158. share/doc/qt5/qtcore/images/modelview-begin-append-rows.png
  3159. share/doc/qt5/qtcore/images/modelview-begin-insert-columns.png
  3160. share/doc/qt5/qtcore/images/modelview-begin-insert-rows.png
  3161. share/doc/qt5/qtcore/images/modelview-begin-remove-columns.png
  3162. share/doc/qt5/qtcore/images/modelview-begin-remove-rows.png
  3163. share/doc/qt5/qtcore/images/modelview-move-rows-1.png
  3164. share/doc/qt5/qtcore/images/modelview-move-rows-2.png
  3165. share/doc/qt5/qtcore/images/modelview-move-rows-3.png
  3166. share/doc/qt5/qtcore/images/modelview-move-rows-4.png
  3167. share/doc/qt5/qtcore/images/qeasingcurve-inback.png
  3168. share/doc/qt5/qtcore/images/qeasingcurve-inbounce.png
  3169. share/doc/qt5/qtcore/images/qeasingcurve-incirc.png
  3170. share/doc/qt5/qtcore/images/qeasingcurve-incubic.png
  3171. share/doc/qt5/qtcore/images/qeasingcurve-inelastic.png
  3172. share/doc/qt5/qtcore/images/qeasingcurve-inexpo.png
  3173. share/doc/qt5/qtcore/images/qeasingcurve-inoutback.png
  3174. share/doc/qt5/qtcore/images/qeasingcurve-inoutbounce.png
  3175. share/doc/qt5/qtcore/images/qeasingcurve-inoutcirc.png
  3176. share/doc/qt5/qtcore/images/qeasingcurve-inoutcubic.png
  3177. share/doc/qt5/qtcore/images/qeasingcurve-inoutelastic.png
  3178. share/doc/qt5/qtcore/images/qeasingcurve-inoutexpo.png
  3179. share/doc/qt5/qtcore/images/qeasingcurve-inoutquad.png
  3180. share/doc/qt5/qtcore/images/qeasingcurve-inoutquart.png
  3181. share/doc/qt5/qtcore/images/qeasingcurve-inoutquint.png
  3182. share/doc/qt5/qtcore/images/qeasingcurve-inoutsine.png
  3183. share/doc/qt5/qtcore/images/qeasingcurve-inquad.png
  3184. share/doc/qt5/qtcore/images/qeasingcurve-inquart.png
  3185. share/doc/qt5/qtcore/images/qeasingcurve-inquint.png
  3186. share/doc/qt5/qtcore/images/qeasingcurve-insine.png
  3187. share/doc/qt5/qtcore/images/qeasingcurve-linear.png
  3188. share/doc/qt5/qtcore/images/qeasingcurve-outback.png
  3189. share/doc/qt5/qtcore/images/qeasingcurve-outbounce.png
  3190. share/doc/qt5/qtcore/images/qeasingcurve-outcirc.png
  3191. share/doc/qt5/qtcore/images/qeasingcurve-outcubic.png
  3192. share/doc/qt5/qtcore/images/qeasingcurve-outelastic.png
  3193. share/doc/qt5/qtcore/images/qeasingcurve-outexpo.png
  3194. share/doc/qt5/qtcore/images/qeasingcurve-outinback.png
  3195. share/doc/qt5/qtcore/images/qeasingcurve-outinbounce.png
  3196. share/doc/qt5/qtcore/images/qeasingcurve-outincirc.png
  3197. share/doc/qt5/qtcore/images/qeasingcurve-outincubic.png
  3198. share/doc/qt5/qtcore/images/qeasingcurve-outinelastic.png
  3199. share/doc/qt5/qtcore/images/qeasingcurve-outinexpo.png
  3200. share/doc/qt5/qtcore/images/qeasingcurve-outinquad.png
  3201. share/doc/qt5/qtcore/images/qeasingcurve-outinquart.png
  3202. share/doc/qt5/qtcore/images/qeasingcurve-outinquint.png
  3203. share/doc/qt5/qtcore/images/qeasingcurve-outinsine.png
  3204. share/doc/qt5/qtcore/images/qeasingcurve-outquad.png
  3205. share/doc/qt5/qtcore/images/qeasingcurve-outquart.png
  3206. share/doc/qt5/qtcore/images/qeasingcurve-outquint.png
  3207. share/doc/qt5/qtcore/images/qeasingcurve-outsine.png
  3208. share/doc/qt5/qtcore/images/qimage-scaling.png
  3209. share/doc/qt5/qtcore/images/qline-coordinates.png
  3210. share/doc/qt5/qtcore/images/qline-point.png
  3211. share/doc/qt5/qtcore/images/qlinef-angle-identicaldirection.png
  3212. share/doc/qt5/qtcore/images/qlinef-angle-oppositedirection.png
  3213. share/doc/qt5/qtcore/images/qlinef-bounded.png
  3214. share/doc/qt5/qtcore/images/qlinef-normalvector.png
  3215. share/doc/qt5/qtcore/images/qlinef-unbounded.png
  3216. share/doc/qt5/qtcore/images/qpen-bevel.png
  3217. share/doc/qt5/qtcore/images/qpen-custom.png
  3218. share/doc/qt5/qtcore/images/qpen-dash.png
  3219. share/doc/qt5/qtcore/images/qpen-dashdot.png
  3220. share/doc/qt5/qtcore/images/qpen-dashdotdot.png
  3221. share/doc/qt5/qtcore/images/qpen-dot.png
  3222. share/doc/qt5/qtcore/images/qpen-flat.png
  3223. share/doc/qt5/qtcore/images/qpen-miter.png
  3224. share/doc/qt5/qtcore/images/qpen-roundcap.png
  3225. share/doc/qt5/qtcore/images/qpen-roundjoin.png
  3226. share/doc/qt5/qtcore/images/qpen-solid.png
  3227. share/doc/qt5/qtcore/images/qpen-square.png
  3228. share/doc/qt5/qtcore/images/qrect-coordinates.png
  3229. share/doc/qt5/qtcore/images/qrect-diagram-one.png
  3230. share/doc/qt5/qtcore/images/qrect-diagram-three.png
  3231. share/doc/qt5/qtcore/images/qrect-diagram-two.png
  3232. share/doc/qt5/qtcore/images/qrect-diagram-zero.png
  3233. share/doc/qt5/qtcore/images/qrect-intersect.png
  3234. share/doc/qt5/qtcore/images/qrect-unite.png
  3235. share/doc/qt5/qtcore/images/qrectf-coordinates.png
  3236. share/doc/qt5/qtcore/images/qrectf-diagram-one.png
  3237. share/doc/qt5/qtcore/images/qrectf-diagram-three.png
  3238. share/doc/qt5/qtcore/images/qrectf-diagram-two.png
  3239. share/doc/qt5/qtcore/images/qsortfilterproxymodel-sorting.png
  3240. share/doc/qt5/qtcore/images/queuedcustomtype-example.png
  3241. share/doc/qt5/qtcore/images/qurl-authority.png
  3242. share/doc/qt5/qtcore/images/qurl-authority2.png
  3243. share/doc/qt5/qtcore/images/qurl-authority3.png
  3244. share/doc/qt5/qtcore/images/qurl-fragment.png
  3245. share/doc/qt5/qtcore/images/qurl-ftppath.png
  3246. share/doc/qt5/qtcore/images/qurl-mailtopath.png
  3247. share/doc/qt5/qtcore/images/qurl-querystring.png
  3248. share/doc/qt5/qtcore/images/resources.png
  3249. share/doc/qt5/qtcore/images/sharedmemory-example_1.png
  3250. share/doc/qt5/qtcore/images/sharedmemory-example_2.png
  3251. share/doc/qt5/qtcore/images/statemachine-button-history.png
  3252. share/doc/qt5/qtcore/images/statemachine-button-nested.png
  3253. share/doc/qt5/qtcore/images/statemachine-button.png
  3254. share/doc/qt5/qtcore/images/statemachine-customevents.png
  3255. share/doc/qt5/qtcore/images/statemachine-customevents2.png
  3256. share/doc/qt5/qtcore/images/statemachine-finished.png
  3257. share/doc/qt5/qtcore/images/statemachine-nonparallel.png
  3258. share/doc/qt5/qtcore/images/statemachine-parallel.png
  3259. share/doc/qt5/qtcore/images/stliterators1.png
  3260. share/doc/qt5/qtcore/implicit-sharing.html
  3261. share/doc/qt5/qtcore/io-functions.html
  3262. share/doc/qt5/qtcore/io.html
  3263. share/doc/qt5/qtcore/json.html
  3264. share/doc/qt5/qtcore/metaobjects.html
  3265. share/doc/qt5/qtcore/object.html
  3266. share/doc/qt5/qtcore/objecttrees.html
  3267. share/doc/qt5/qtcore/plugins.html
  3268. share/doc/qt5/qtcore/properties.html
  3269. share/doc/qt5/qtcore/qabstractanimation-members.html
  3270. share/doc/qt5/qtcore/qabstractanimation.html
  3271. share/doc/qt5/qtcore/qabstracteventdispatcher-members.html
  3272. share/doc/qt5/qtcore/qabstracteventdispatcher-obsolete.html
  3273. share/doc/qt5/qtcore/qabstracteventdispatcher-timerinfo-members.html
  3274. share/doc/qt5/qtcore/qabstracteventdispatcher-timerinfo.html
  3275. share/doc/qt5/qtcore/qabstracteventdispatcher.html
  3276. share/doc/qt5/qtcore/qabstractitemmodel-members.html
  3277. share/doc/qt5/qtcore/qabstractitemmodel-obsolete.html
  3278. share/doc/qt5/qtcore/qabstractitemmodel.html
  3279. share/doc/qt5/qtcore/qabstractlistmodel-members.html
  3280. share/doc/qt5/qtcore/qabstractlistmodel.html
  3281. share/doc/qt5/qtcore/qabstractnativeeventfilter-members.html
  3282. share/doc/qt5/qtcore/qabstractnativeeventfilter.html
  3283. share/doc/qt5/qtcore/qabstractproxymodel-members.html
  3284. share/doc/qt5/qtcore/qabstractproxymodel.html
  3285. share/doc/qt5/qtcore/qabstractstate-members.html
  3286. share/doc/qt5/qtcore/qabstractstate.html
  3287. share/doc/qt5/qtcore/qabstracttablemodel-members.html
  3288. share/doc/qt5/qtcore/qabstracttablemodel.html
  3289. share/doc/qt5/qtcore/qabstracttransition-members.html
  3290. share/doc/qt5/qtcore/qabstracttransition.html
  3291. share/doc/qt5/qtcore/qanimationgroup-members.html
  3292. share/doc/qt5/qtcore/qanimationgroup.html
  3293. share/doc/qt5/qtcore/qassociativeiterable-const-iterator-members.html
  3294. share/doc/qt5/qtcore/qassociativeiterable-const-iterator.html
  3295. share/doc/qt5/qtcore/qassociativeiterable-members.html
  3296. share/doc/qt5/qtcore/qassociativeiterable.html
  3297. share/doc/qt5/qtcore/qatomicint-members.html
  3298. share/doc/qt5/qtcore/qatomicint.html
  3299. share/doc/qt5/qtcore/qatomicinteger-members.html
  3300. share/doc/qt5/qtcore/qatomicinteger.html
  3301. share/doc/qt5/qtcore/qatomicpointer-members.html
  3302. share/doc/qt5/qtcore/qatomicpointer.html
  3303. share/doc/qt5/qtcore/qbasictimer-members.html
  3304. share/doc/qt5/qtcore/qbasictimer.html
  3305. share/doc/qt5/qtcore/qbitarray-members.html
  3306. share/doc/qt5/qtcore/qbitarray.html
  3307. share/doc/qt5/qtcore/qbuffer-members.html
  3308. share/doc/qt5/qtcore/qbuffer.html
  3309. share/doc/qt5/qtcore/qbytearray-members.html
  3310. share/doc/qt5/qtcore/qbytearray-obsolete.html
  3311. share/doc/qt5/qtcore/qbytearray.html
  3312. share/doc/qt5/qtcore/qbytearraylist-members.html
  3313. share/doc/qt5/qtcore/qbytearraylist.html
  3314. share/doc/qt5/qtcore/qbytearraymatcher-members.html
  3315. share/doc/qt5/qtcore/qbytearraymatcher.html
  3316. share/doc/qt5/qtcore/qcache-members.html
  3317. share/doc/qt5/qtcore/qcache.html
  3318. share/doc/qt5/qtcore/qchar-members.html
  3319. share/doc/qt5/qtcore/qchar-obsolete.html
  3320. share/doc/qt5/qtcore/qchar.html
  3321. share/doc/qt5/qtcore/qchildevent-members.html
  3322. share/doc/qt5/qtcore/qchildevent.html
  3323. share/doc/qt5/qtcore/qcollator-members.html
  3324. share/doc/qt5/qtcore/qcollator.html
  3325. share/doc/qt5/qtcore/qcollatorsortkey-members.html
  3326. share/doc/qt5/qtcore/qcollatorsortkey.html
  3327. share/doc/qt5/qtcore/qcommandlineoption-members.html
  3328. share/doc/qt5/qtcore/qcommandlineoption-obsolete.html
  3329. share/doc/qt5/qtcore/qcommandlineoption.html
  3330. share/doc/qt5/qtcore/qcommandlineparser-members.html
  3331. share/doc/qt5/qtcore/qcommandlineparser.html
  3332. share/doc/qt5/qtcore/qcontiguouscache-members.html
  3333. share/doc/qt5/qtcore/qcontiguouscache.html
  3334. share/doc/qt5/qtcore/qcoreapplication-members.html
  3335. share/doc/qt5/qtcore/qcoreapplication-obsolete.html
  3336. share/doc/qt5/qtcore/qcoreapplication.html
  3337. share/doc/qt5/qtcore/qcryptographichash-members.html
  3338. share/doc/qt5/qtcore/qcryptographichash.html
  3339. share/doc/qt5/qtcore/qdatastream-members.html
  3340. share/doc/qt5/qtcore/qdatastream-obsolete.html
  3341. share/doc/qt5/qtcore/qdatastream.html
  3342. share/doc/qt5/qtcore/qdate-members.html
  3343. share/doc/qt5/qtcore/qdate-obsolete.html
  3344. share/doc/qt5/qtcore/qdate.html
  3345. share/doc/qt5/qtcore/qdatetime-members.html
  3346. share/doc/qt5/qtcore/qdatetime-obsolete.html
  3347. share/doc/qt5/qtcore/qdatetime.html
  3348. share/doc/qt5/qtcore/qdeadlinetimer-members.html
  3349. share/doc/qt5/qtcore/qdeadlinetimer.html
  3350. share/doc/qt5/qtcore/qdebug-members.html
  3351. share/doc/qt5/qtcore/qdebug.html
  3352. share/doc/qt5/qtcore/qdebugstatesaver-members.html
  3353. share/doc/qt5/qtcore/qdebugstatesaver.html
  3354. share/doc/qt5/qtcore/qdir-members.html
  3355. share/doc/qt5/qtcore/qdir-obsolete.html
  3356. share/doc/qt5/qtcore/qdir.html
  3357. share/doc/qt5/qtcore/qdiriterator-members.html
  3358. share/doc/qt5/qtcore/qdiriterator.html
  3359. share/doc/qt5/qtcore/qdynamicpropertychangeevent-members.html
  3360. share/doc/qt5/qtcore/qdynamicpropertychangeevent.html
  3361. share/doc/qt5/qtcore/qeasingcurve-members.html
  3362. share/doc/qt5/qtcore/qeasingcurve-obsolete.html
  3363. share/doc/qt5/qtcore/qeasingcurve.html
  3364. share/doc/qt5/qtcore/qelapsedtimer-members.html
  3365. share/doc/qt5/qtcore/qelapsedtimer.html
  3366. share/doc/qt5/qtcore/qenablesharedfromthis-members.html
  3367. share/doc/qt5/qtcore/qenablesharedfromthis.html
  3368. share/doc/qt5/qtcore/qevent-members.html
  3369. share/doc/qt5/qtcore/qevent.html
  3370. share/doc/qt5/qtcore/qeventloop-members.html
  3371. share/doc/qt5/qtcore/qeventloop.html
  3372. share/doc/qt5/qtcore/qeventlooplocker-members.html
  3373. share/doc/qt5/qtcore/qeventlooplocker.html
  3374. share/doc/qt5/qtcore/qeventtransition-members.html
  3375. share/doc/qt5/qtcore/qeventtransition.html
  3376. share/doc/qt5/qtcore/qexception-members.html
  3377. share/doc/qt5/qtcore/qexception.html
  3378. share/doc/qt5/qtcore/qexplicitlyshareddatapointer-members.html
  3379. share/doc/qt5/qtcore/qexplicitlyshareddatapointer.html
  3380. share/doc/qt5/qtcore/qfile-members.html
  3381. share/doc/qt5/qtcore/qfile-obsolete.html
  3382. share/doc/qt5/qtcore/qfile.html
  3383. share/doc/qt5/qtcore/qfiledevice-members.html
  3384. share/doc/qt5/qtcore/qfiledevice.html
  3385. share/doc/qt5/qtcore/qfileinfo-members.html
  3386. share/doc/qt5/qtcore/qfileinfo-obsolete.html
  3387. share/doc/qt5/qtcore/qfileinfo.html
  3388. share/doc/qt5/qtcore/qfileselector-members.html
  3389. share/doc/qt5/qtcore/qfileselector.html
  3390. share/doc/qt5/qtcore/qfilesystemwatcher-members.html
  3391. share/doc/qt5/qtcore/qfilesystemwatcher.html
  3392. share/doc/qt5/qtcore/qfinalstate-members.html
  3393. share/doc/qt5/qtcore/qfinalstate.html
  3394. share/doc/qt5/qtcore/qflag-members.html
  3395. share/doc/qt5/qtcore/qflag.html
  3396. share/doc/qt5/qtcore/qflags-members.html
  3397. share/doc/qt5/qtcore/qflags.html
  3398. share/doc/qt5/qtcore/qfloat16.html
  3399. share/doc/qt5/qtcore/qfuture-const-iterator-members.html
  3400. share/doc/qt5/qtcore/qfuture-const-iterator.html
  3401. share/doc/qt5/qtcore/qfuture-members.html
  3402. share/doc/qt5/qtcore/qfuture.html
  3403. share/doc/qt5/qtcore/qfutureiterator-members.html
  3404. share/doc/qt5/qtcore/qfutureiterator.html
  3405. share/doc/qt5/qtcore/qfuturesynchronizer-members.html
  3406. share/doc/qt5/qtcore/qfuturesynchronizer.html
  3407. share/doc/qt5/qtcore/qfuturewatcher-members.html
  3408. share/doc/qt5/qtcore/qfuturewatcher.html
  3409. share/doc/qt5/qtcore/qgenericargument-members.html
  3410. share/doc/qt5/qtcore/qgenericargument.html
  3411. share/doc/qt5/qtcore/qgenericreturnargument-members.html
  3412. share/doc/qt5/qtcore/qgenericreturnargument.html
  3413. share/doc/qt5/qtcore/qglobalstatic-members.html
  3414. share/doc/qt5/qtcore/qglobalstatic-obsolete.html
  3415. share/doc/qt5/qtcore/qglobalstatic.html
  3416. share/doc/qt5/qtcore/qhash-const-iterator-members.html
  3417. share/doc/qt5/qtcore/qhash-const-iterator.html
  3418. share/doc/qt5/qtcore/qhash-iterator-members.html
  3419. share/doc/qt5/qtcore/qhash-iterator.html
  3420. share/doc/qt5/qtcore/qhash-key-iterator-members.html
  3421. share/doc/qt5/qtcore/qhash-key-iterator.html
  3422. share/doc/qt5/qtcore/qhash-members.html
  3423. share/doc/qt5/qtcore/qhash.html
  3424. share/doc/qt5/qtcore/qhashiterator-members.html
  3425. share/doc/qt5/qtcore/qhashiterator.html
  3426. share/doc/qt5/qtcore/qhistorystate-members.html
  3427. share/doc/qt5/qtcore/qhistorystate.html
  3428. share/doc/qt5/qtcore/qidentityproxymodel-members.html
  3429. share/doc/qt5/qtcore/qidentityproxymodel.html
  3430. share/doc/qt5/qtcore/qiodevice-members.html
  3431. share/doc/qt5/qtcore/qiodevice.html
  3432. share/doc/qt5/qtcore/qitemselection-members.html
  3433. share/doc/qt5/qtcore/qitemselection.html
  3434. share/doc/qt5/qtcore/qitemselectionmodel-members.html
  3435. share/doc/qt5/qtcore/qitemselectionmodel.html
  3436. share/doc/qt5/qtcore/qitemselectionrange-members.html
  3437. share/doc/qt5/qtcore/qitemselectionrange-obsolete.html
  3438. share/doc/qt5/qtcore/qitemselectionrange.html
  3439. share/doc/qt5/qtcore/qjsonarray-const-iterator-members.html
  3440. share/doc/qt5/qtcore/qjsonarray-const-iterator.html
  3441. share/doc/qt5/qtcore/qjsonarray-iterator-members.html
  3442. share/doc/qt5/qtcore/qjsonarray-iterator.html
  3443. share/doc/qt5/qtcore/qjsonarray-members.html
  3444. share/doc/qt5/qtcore/qjsonarray.html
  3445. share/doc/qt5/qtcore/qjsondocument-members.html
  3446. share/doc/qt5/qtcore/qjsondocument.html
  3447. share/doc/qt5/qtcore/qjsonobject-const-iterator-members.html
  3448. share/doc/qt5/qtcore/qjsonobject-const-iterator.html
  3449. share/doc/qt5/qtcore/qjsonobject-iterator-members.html
  3450. share/doc/qt5/qtcore/qjsonobject-iterator.html
  3451. share/doc/qt5/qtcore/qjsonobject-members.html
  3452. share/doc/qt5/qtcore/qjsonobject.html
  3453. share/doc/qt5/qtcore/qjsonparseerror-members.html
  3454. share/doc/qt5/qtcore/qjsonparseerror.html
  3455. share/doc/qt5/qtcore/qjsonvalue-members.html
  3456. share/doc/qt5/qtcore/qjsonvalue.html
  3457. share/doc/qt5/qtcore/qlatin1char-members.html
  3458. share/doc/qt5/qtcore/qlatin1char.html
  3459. share/doc/qt5/qtcore/qlatin1string-members.html
  3460. share/doc/qt5/qtcore/qlatin1string.html
  3461. share/doc/qt5/qtcore/qlibrary-members.html
  3462. share/doc/qt5/qtcore/qlibrary.html
  3463. share/doc/qt5/qtcore/qlibraryinfo-members.html
  3464. share/doc/qt5/qtcore/qlibraryinfo-obsolete.html
  3465. share/doc/qt5/qtcore/qlibraryinfo.html
  3466. share/doc/qt5/qtcore/qline-members.html
  3467. share/doc/qt5/qtcore/qline.html
  3468. share/doc/qt5/qtcore/qlinef-members.html
  3469. share/doc/qt5/qtcore/qlinef-obsolete.html
  3470. share/doc/qt5/qtcore/qlinef.html
  3471. share/doc/qt5/qtcore/qlinkedlist-const-iterator-members.html
  3472. share/doc/qt5/qtcore/qlinkedlist-const-iterator.html
  3473. share/doc/qt5/qtcore/qlinkedlist-iterator-members.html
  3474. share/doc/qt5/qtcore/qlinkedlist-iterator.html
  3475. share/doc/qt5/qtcore/qlinkedlist-members.html
  3476. share/doc/qt5/qtcore/qlinkedlist.html
  3477. share/doc/qt5/qtcore/qlinkedlistiterator-members.html
  3478. share/doc/qt5/qtcore/qlinkedlistiterator.html
  3479. share/doc/qt5/qtcore/qlist-const-iterator-members.html
  3480. share/doc/qt5/qtcore/qlist-const-iterator.html
  3481. share/doc/qt5/qtcore/qlist-iterator-members.html
  3482. share/doc/qt5/qtcore/qlist-iterator.html
  3483. share/doc/qt5/qtcore/qlist-members.html
  3484. share/doc/qt5/qtcore/qlist-memorylayout.html
  3485. share/doc/qt5/qtcore/qlist.html
  3486. share/doc/qt5/qtcore/qlistiterator-members.html
  3487. share/doc/qt5/qtcore/qlistiterator.html
  3488. share/doc/qt5/qtcore/qlocale-members.html
  3489. share/doc/qt5/qtcore/qlocale-obsolete.html
  3490. share/doc/qt5/qtcore/qlocale.html
  3491. share/doc/qt5/qtcore/qlockfile-members.html
  3492. share/doc/qt5/qtcore/qlockfile.html
  3493. share/doc/qt5/qtcore/qloggingcategory-members.html
  3494. share/doc/qt5/qtcore/qloggingcategory.html
  3495. share/doc/qt5/qtcore/qmap-const-iterator-members.html
  3496. share/doc/qt5/qtcore/qmap-const-iterator.html
  3497. share/doc/qt5/qtcore/qmap-iterator-members.html
  3498. share/doc/qt5/qtcore/qmap-iterator.html
  3499. share/doc/qt5/qtcore/qmap-key-iterator-members.html
  3500. share/doc/qt5/qtcore/qmap-key-iterator.html
  3501. share/doc/qt5/qtcore/qmap-members.html
  3502. share/doc/qt5/qtcore/qmap.html
  3503. share/doc/qt5/qtcore/qmapiterator-members.html
  3504. share/doc/qt5/qtcore/qmapiterator.html
  3505. share/doc/qt5/qtcore/qmargins-members.html
  3506. share/doc/qt5/qtcore/qmargins.html
  3507. share/doc/qt5/qtcore/qmarginsf-members.html
  3508. share/doc/qt5/qtcore/qmarginsf.html
  3509. share/doc/qt5/qtcore/qmessageauthenticationcode-members.html
  3510. share/doc/qt5/qtcore/qmessageauthenticationcode.html
  3511. share/doc/qt5/qtcore/qmessagelogcontext-members.html
  3512. share/doc/qt5/qtcore/qmessagelogcontext.html
  3513. share/doc/qt5/qtcore/qmessagelogger-members.html
  3514. share/doc/qt5/qtcore/qmessagelogger.html
  3515. share/doc/qt5/qtcore/qmetaclassinfo-members.html
  3516. share/doc/qt5/qtcore/qmetaclassinfo.html
  3517. share/doc/qt5/qtcore/qmetaenum-members.html
  3518. share/doc/qt5/qtcore/qmetaenum.html
  3519. share/doc/qt5/qtcore/qmetamethod-members.html
  3520. share/doc/qt5/qtcore/qmetamethod.html
  3521. share/doc/qt5/qtcore/qmetaobject-connection-members.html
  3522. share/doc/qt5/qtcore/qmetaobject-connection.html
  3523. share/doc/qt5/qtcore/qmetaobject-members.html
  3524. share/doc/qt5/qtcore/qmetaobject.html
  3525. share/doc/qt5/qtcore/qmetaproperty-members.html
  3526. share/doc/qt5/qtcore/qmetaproperty-obsolete.html
  3527. share/doc/qt5/qtcore/qmetaproperty.html
  3528. share/doc/qt5/qtcore/qmetatype-members.html
  3529. share/doc/qt5/qtcore/qmetatype-obsolete.html
  3530. share/doc/qt5/qtcore/qmetatype.html
  3531. share/doc/qt5/qtcore/qmimedata-members.html
  3532. share/doc/qt5/qtcore/qmimedata.html
  3533. share/doc/qt5/qtcore/qmimedatabase-members.html
  3534. share/doc/qt5/qtcore/qmimedatabase.html
  3535. share/doc/qt5/qtcore/qmimetype-members.html
  3536. share/doc/qt5/qtcore/qmimetype.html
  3537. share/doc/qt5/qtcore/qmodelindex-members.html
  3538. share/doc/qt5/qtcore/qmodelindex-obsolete.html
  3539. share/doc/qt5/qtcore/qmodelindex.html
  3540. share/doc/qt5/qtcore/qmultihash-members.html
  3541. share/doc/qt5/qtcore/qmultihash.html
  3542. share/doc/qt5/qtcore/qmultimap-members.html
  3543. share/doc/qt5/qtcore/qmultimap.html
  3544. share/doc/qt5/qtcore/qmutablehashiterator-members.html
  3545. share/doc/qt5/qtcore/qmutablehashiterator.html
  3546. share/doc/qt5/qtcore/qmutablelinkedlistiterator-members.html
  3547. share/doc/qt5/qtcore/qmutablelinkedlistiterator.html
  3548. share/doc/qt5/qtcore/qmutablelistiterator-members.html
  3549. share/doc/qt5/qtcore/qmutablelistiterator.html
  3550. share/doc/qt5/qtcore/qmutablemapiterator-members.html
  3551. share/doc/qt5/qtcore/qmutablemapiterator.html
  3552. share/doc/qt5/qtcore/qmutablesetiterator-members.html
  3553. share/doc/qt5/qtcore/qmutablesetiterator.html
  3554. share/doc/qt5/qtcore/qmutablevectoriterator-members.html
  3555. share/doc/qt5/qtcore/qmutablevectoriterator.html
  3556. share/doc/qt5/qtcore/qmutex-members.html
  3557. share/doc/qt5/qtcore/qmutex.html
  3558. share/doc/qt5/qtcore/qmutexlocker-members.html
  3559. share/doc/qt5/qtcore/qmutexlocker.html
  3560. share/doc/qt5/qtcore/qobject-members.html
  3561. share/doc/qt5/qtcore/qobject-obsolete.html
  3562. share/doc/qt5/qtcore/qobject.html
  3563. share/doc/qt5/qtcore/qobjectcleanuphandler-members.html
  3564. share/doc/qt5/qtcore/qobjectcleanuphandler.html
  3565. share/doc/qt5/qtcore/qoperatingsystemversion-members.html
  3566. share/doc/qt5/qtcore/qoperatingsystemversion.html
  3567. share/doc/qt5/qtcore/qpair-members.html
  3568. share/doc/qt5/qtcore/qpair.html
  3569. share/doc/qt5/qtcore/qparallelanimationgroup-members.html
  3570. share/doc/qt5/qtcore/qparallelanimationgroup.html
  3571. share/doc/qt5/qtcore/qpauseanimation-members.html
  3572. share/doc/qt5/qtcore/qpauseanimation.html
  3573. share/doc/qt5/qtcore/qpersistentmodelindex-members.html
  3574. share/doc/qt5/qtcore/qpersistentmodelindex-obsolete.html
  3575. share/doc/qt5/qtcore/qpersistentmodelindex.html
  3576. share/doc/qt5/qtcore/qpluginloader-members.html
  3577. share/doc/qt5/qtcore/qpluginloader.html
  3578. share/doc/qt5/qtcore/qpoint-members.html
  3579. share/doc/qt5/qtcore/qpoint.html
  3580. share/doc/qt5/qtcore/qpointer-members.html
  3581. share/doc/qt5/qtcore/qpointer.html
  3582. share/doc/qt5/qtcore/qpointf-members.html
  3583. share/doc/qt5/qtcore/qpointf.html
  3584. share/doc/qt5/qtcore/qprocess-createprocessarguments-members.html
  3585. share/doc/qt5/qtcore/qprocess-createprocessarguments.html
  3586. share/doc/qt5/qtcore/qprocess-members.html
  3587. share/doc/qt5/qtcore/qprocess-obsolete.html
  3588. share/doc/qt5/qtcore/qprocess.html
  3589. share/doc/qt5/qtcore/qprocessenvironment-members.html
  3590. share/doc/qt5/qtcore/qprocessenvironment.html
  3591. share/doc/qt5/qtcore/qpropertyanimation-members.html
  3592. share/doc/qt5/qtcore/qpropertyanimation.html
  3593. share/doc/qt5/qtcore/qqueue-members.html
  3594. share/doc/qt5/qtcore/qqueue.html
  3595. share/doc/qt5/qtcore/qreadlocker-members.html
  3596. share/doc/qt5/qtcore/qreadlocker.html
  3597. share/doc/qt5/qtcore/qreadwritelock-members.html
  3598. share/doc/qt5/qtcore/qreadwritelock.html
  3599. share/doc/qt5/qtcore/qrect-members.html
  3600. share/doc/qt5/qtcore/qrect-obsolete.html
  3601. share/doc/qt5/qtcore/qrect.html
  3602. share/doc/qt5/qtcore/qrectf-members.html
  3603. share/doc/qt5/qtcore/qrectf-obsolete.html
  3604. share/doc/qt5/qtcore/qrectf.html
  3605. share/doc/qt5/qtcore/qregexp-members.html
  3606. share/doc/qt5/qtcore/qregexp.html
  3607. share/doc/qt5/qtcore/qregularexpression-members.html
  3608. share/doc/qt5/qtcore/qregularexpression.html
  3609. share/doc/qt5/qtcore/qregularexpressionmatch-members.html
  3610. share/doc/qt5/qtcore/qregularexpressionmatch.html
  3611. share/doc/qt5/qtcore/qregularexpressionmatchiterator-members.html
  3612. share/doc/qt5/qtcore/qregularexpressionmatchiterator.html
  3613. share/doc/qt5/qtcore/qresource-members.html
  3614. share/doc/qt5/qtcore/qresource-obsolete.html
  3615. share/doc/qt5/qtcore/qresource.html
  3616. share/doc/qt5/qtcore/qrunnable-members.html
  3617. share/doc/qt5/qtcore/qrunnable.html
  3618. share/doc/qt5/qtcore/qsavefile-members.html
  3619. share/doc/qt5/qtcore/qsavefile.html
  3620. share/doc/qt5/qtcore/qscopedarraypointer-members.html
  3621. share/doc/qt5/qtcore/qscopedarraypointer.html
  3622. share/doc/qt5/qtcore/qscopedpointer-members.html
  3623. share/doc/qt5/qtcore/qscopedpointer.html
  3624. share/doc/qt5/qtcore/qscopedvaluerollback-members.html
  3625. share/doc/qt5/qtcore/qscopedvaluerollback.html
  3626. share/doc/qt5/qtcore/qsemaphore-members.html
  3627. share/doc/qt5/qtcore/qsemaphore.html
  3628. share/doc/qt5/qtcore/qsequentialanimationgroup-members.html
  3629. share/doc/qt5/qtcore/qsequentialanimationgroup.html
  3630. share/doc/qt5/qtcore/qsequentialiterable-const-iterator-members.html
  3631. share/doc/qt5/qtcore/qsequentialiterable-const-iterator.html
  3632. share/doc/qt5/qtcore/qsequentialiterable-members.html
  3633. share/doc/qt5/qtcore/qsequentialiterable.html
  3634. share/doc/qt5/qtcore/qset-const-iterator-members.html
  3635. share/doc/qt5/qtcore/qset-const-iterator.html
  3636. share/doc/qt5/qtcore/qset-iterator-members.html
  3637. share/doc/qt5/qtcore/qset-iterator.html
  3638. share/doc/qt5/qtcore/qset-members.html
  3639. share/doc/qt5/qtcore/qset.html
  3640. share/doc/qt5/qtcore/qsetiterator-members.html
  3641. share/doc/qt5/qtcore/qsetiterator.html
  3642. share/doc/qt5/qtcore/qsettings-members.html
  3643. share/doc/qt5/qtcore/qsettings-obsolete.html
  3644. share/doc/qt5/qtcore/qsettings.html
  3645. share/doc/qt5/qtcore/qshareddata-members.html
  3646. share/doc/qt5/qtcore/qshareddata.html
  3647. share/doc/qt5/qtcore/qshareddatapointer-members.html
  3648. share/doc/qt5/qtcore/qshareddatapointer.html
  3649. share/doc/qt5/qtcore/qsharedmemory-members.html
  3650. share/doc/qt5/qtcore/qsharedmemory.html
  3651. share/doc/qt5/qtcore/qsharedpointer-members.html
  3652. share/doc/qt5/qtcore/qsharedpointer.html
  3653. share/doc/qt5/qtcore/qsignalblocker-members.html
  3654. share/doc/qt5/qtcore/qsignalblocker.html
  3655. share/doc/qt5/qtcore/qsignalmapper-members.html
  3656. share/doc/qt5/qtcore/qsignalmapper.html
  3657. share/doc/qt5/qtcore/qsignaltransition-members.html
  3658. share/doc/qt5/qtcore/qsignaltransition.html
  3659. share/doc/qt5/qtcore/qsize-members.html
  3660. share/doc/qt5/qtcore/qsize.html
  3661. share/doc/qt5/qtcore/qsizef-members.html
  3662. share/doc/qt5/qtcore/qsizef.html
  3663. share/doc/qt5/qtcore/qsocketnotifier-members.html
  3664. share/doc/qt5/qtcore/qsocketnotifier.html
  3665. share/doc/qt5/qtcore/qsortfilterproxymodel-members.html
  3666. share/doc/qt5/qtcore/qsortfilterproxymodel-obsolete.html
  3667. share/doc/qt5/qtcore/qsortfilterproxymodel.html
  3668. share/doc/qt5/qtcore/qstack-members.html
  3669. share/doc/qt5/qtcore/qstack.html
  3670. share/doc/qt5/qtcore/qstandardpaths-members.html
  3671. share/doc/qt5/qtcore/qstandardpaths-obsolete.html
  3672. share/doc/qt5/qtcore/qstandardpaths.html
  3673. share/doc/qt5/qtcore/qstate-members.html
  3674. share/doc/qt5/qtcore/qstate.html
  3675. share/doc/qt5/qtcore/qstatemachine-members.html
  3676. share/doc/qt5/qtcore/qstatemachine-signalevent-members.html
  3677. share/doc/qt5/qtcore/qstatemachine-signalevent.html
  3678. share/doc/qt5/qtcore/qstatemachine-wrappedevent-members.html
  3679. share/doc/qt5/qtcore/qstatemachine-wrappedevent.html
  3680. share/doc/qt5/qtcore/qstatemachine.html
  3681. share/doc/qt5/qtcore/qstaticbytearraymatcher.html
  3682. share/doc/qt5/qtcore/qstaticplugin-members.html
  3683. share/doc/qt5/qtcore/qstaticplugin.html
  3684. share/doc/qt5/qtcore/qstorageinfo-members.html
  3685. share/doc/qt5/qtcore/qstorageinfo.html
  3686. share/doc/qt5/qtcore/qstring-members.html
  3687. share/doc/qt5/qtcore/qstring-null.html
  3688. share/doc/qt5/qtcore/qstring-obsolete.html
  3689. share/doc/qt5/qtcore/qstring.html
  3690. share/doc/qt5/qtcore/qstringlist-members.html
  3691. share/doc/qt5/qtcore/qstringlist.html
  3692. share/doc/qt5/qtcore/qstringlistmodel-members.html
  3693. share/doc/qt5/qtcore/qstringlistmodel.html
  3694. share/doc/qt5/qtcore/qstringmatcher-members.html
  3695. share/doc/qt5/qtcore/qstringmatcher.html
  3696. share/doc/qt5/qtcore/qstringref-members.html
  3697. share/doc/qt5/qtcore/qstringref-obsolete.html
  3698. share/doc/qt5/qtcore/qstringref.html
  3699. share/doc/qt5/qtcore/qsysinfo-members.html
  3700. share/doc/qt5/qtcore/qsysinfo-obsolete.html
  3701. share/doc/qt5/qtcore/qsysinfo.html
  3702. share/doc/qt5/qtcore/qsystemsemaphore-members.html
  3703. share/doc/qt5/qtcore/qsystemsemaphore.html
  3704. share/doc/qt5/qtcore/qt-obsolete.html
  3705. share/doc/qt5/qtcore/qt.html
  3706. share/doc/qt5/qtcore/qtalgorithms-obsolete.html
  3707. share/doc/qt5/qtcore/qtalgorithms.html
  3708. share/doc/qt5/qtcore/qtcore-attribution-android-gradle-wrapper.html
  3709. share/doc/qt5/qtcore/qtcore-attribution-cldr-data.html
  3710. share/doc/qt5/qtcore/qtcore-attribution-doubleconversion.html
  3711. share/doc/qt5/qtcore/qtcore-attribution-easing.html
  3712. share/doc/qt5/qtcore/qtcore-attribution-forkfd.html
  3713. share/doc/qt5/qtcore/qtcore-attribution-freebsd.html
  3714. share/doc/qt5/qtcore/qtcore-attribution-md4.html
  3715. share/doc/qt5/qtcore/qtcore-attribution-md5.html
  3716. share/doc/qt5/qtcore/qtcore-attribution-pcre2.html
  3717. share/doc/qt5/qtcore/qtcore-attribution-psl.html
  3718. share/doc/qt5/qtcore/qtcore-attribution-qbig5codecs.html
  3719. share/doc/qt5/qtcore/qtcore-attribution-qbkcodec.html
  3720. share/doc/qt5/qtcore/qtcore-attribution-qeucjpcodec.html
  3721. share/doc/qt5/qtcore/qtcore-attribution-qeuckrcodec.html
  3722. share/doc/qt5/qtcore/qtcore-attribution-qeventdispatcher-cf.html
  3723. share/doc/qt5/qtcore/qtcore-attribution-qjiscodec.html
  3724. share/doc/qt5/qtcore/qtcore-attribution-qsjiscodec.html
  3725. share/doc/qt5/qtcore/qtcore-attribution-qtemporaryfile.html
  3726. share/doc/qt5/qtcore/qtcore-attribution-qtsciicodec.html
  3727. share/doc/qt5/qtcore/qtcore-attribution-rfc6234.html
  3728. share/doc/qt5/qtcore/qtcore-attribution-sha1.html
  3729. share/doc/qt5/qtcore/qtcore-attribution-sha3-endian.html
  3730. share/doc/qt5/qtcore/qtcore-attribution-sha3-keccak.html
  3731. share/doc/qt5/qtcore/qtcore-attribution-zlib.html
  3732. share/doc/qt5/qtcore/qtcore-index.html
  3733. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-client-cpp.html
  3734. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-client-h.html
  3735. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-example.html
  3736. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-localfortuneclient-pro.html
  3737. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-main-cpp.html
  3738. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-example.html
  3739. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-localfortuneserver-pro.html
  3740. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-main-cpp.html
  3741. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-server-cpp.html
  3742. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-server-h.html
  3743. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-cpp.html
  3744. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-h.html
  3745. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-ui.html
  3746. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-example.html
  3747. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-main-cpp.html
  3748. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-sharedmemory-pro.html
  3749. share/doc/qt5/qtcore/qtcore-json-savegame-character-cpp.html
  3750. share/doc/qt5/qtcore/qtcore-json-savegame-character-h.html
  3751. share/doc/qt5/qtcore/qtcore-json-savegame-example.html
  3752. share/doc/qt5/qtcore/qtcore-json-savegame-game-cpp.html
  3753. share/doc/qt5/qtcore/qtcore-json-savegame-game-h.html
  3754. share/doc/qt5/qtcore/qtcore-json-savegame-level-cpp.html
  3755. share/doc/qt5/qtcore/qtcore-json-savegame-level-h.html
  3756. share/doc/qt5/qtcore/qtcore-json-savegame-main-cpp.html
  3757. share/doc/qt5/qtcore/qtcore-json-savegame-savegame-pro.html
  3758. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
  3759. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-main-cpp.html
  3760. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-cpp.html
  3761. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-h.html
  3762. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypebrowser-pro.html
  3763. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-cpp.html
  3764. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-h.html
  3765. share/doc/qt5/qtcore/qtcore-module.html
  3766. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-example.html
  3767. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-main-cpp.html
  3768. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrot-pro.html
  3769. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-cpp.html
  3770. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-h.html
  3771. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-renderthread-cpp.html
  3772. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-renderthread-h.html
  3773. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-block-cpp.html
  3774. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-block-h.html
  3775. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-example.html
  3776. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-main-cpp.html
  3777. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-queuedcustomtype-pro.html
  3778. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-renderthread-cpp.html
  3779. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-renderthread-h.html
  3780. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-window-cpp.html
  3781. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-window-h.html
  3782. share/doc/qt5/qtcore/qtcore-threads-semaphores-example.html
  3783. share/doc/qt5/qtcore/qtcore-threads-semaphores-semaphores-cpp.html
  3784. share/doc/qt5/qtcore/qtcore-threads-semaphores-semaphores-pro.html
  3785. share/doc/qt5/qtcore/qtcore-threads-waitconditions-example.html
  3786. share/doc/qt5/qtcore/qtcore-threads-waitconditions-waitconditions-cpp.html
  3787. share/doc/qt5/qtcore/qtcore-threads-waitconditions-waitconditions-pro.html
  3788. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-contiguouscache-pro.html
  3789. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-example.html
  3790. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-main-cpp.html
  3791. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-randomlistmodel-cpp.html
  3792. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-randomlistmodel-h.html
  3793. share/doc/qt5/qtcore/qtcore-tools-customtype-customtype-pro.html
  3794. share/doc/qt5/qtcore/qtcore-tools-customtype-example.html
  3795. share/doc/qt5/qtcore/qtcore-tools-customtype-main-cpp.html
  3796. share/doc/qt5/qtcore/qtcore-tools-customtype-message-cpp.html
  3797. share/doc/qt5/qtcore/qtcore-tools-customtype-message-h.html
  3798. share/doc/qt5/qtcore/qtcore.index
  3799. share/doc/qt5/qtcore/qtcore.qhp
  3800. share/doc/qt5/qtcore/qtcore.qhp.sha1
  3801. share/doc/qt5/qtcore/qtcore.tags
  3802. share/doc/qt5/qtcore/qtemporarydir-members.html
  3803. share/doc/qt5/qtcore/qtemporarydir.html
  3804. share/doc/qt5/qtcore/qtemporaryfile-members.html
  3805. share/doc/qt5/qtcore/qtemporaryfile-obsolete.html
  3806. share/doc/qt5/qtcore/qtemporaryfile.html
  3807. share/doc/qt5/qtcore/qtendian.html
  3808. share/doc/qt5/qtcore/qtextboundaryfinder-members.html
  3809. share/doc/qt5/qtcore/qtextboundaryfinder.html
  3810. share/doc/qt5/qtcore/qtextcodec-converterstate-members.html
  3811. share/doc/qt5/qtcore/qtextcodec-converterstate.html
  3812. share/doc/qt5/qtcore/qtextcodec-members.html
  3813. share/doc/qt5/qtcore/qtextcodec-obsolete.html
  3814. share/doc/qt5/qtcore/qtextcodec.html
  3815. share/doc/qt5/qtcore/qtextdecoder-members.html
  3816. share/doc/qt5/qtcore/qtextdecoder.html
  3817. share/doc/qt5/qtcore/qtextencoder-members.html
  3818. share/doc/qt5/qtcore/qtextencoder.html
  3819. share/doc/qt5/qtcore/qtextstream-members.html
  3820. share/doc/qt5/qtcore/qtextstream.html
  3821. share/doc/qt5/qtcore/qtglobal-obsolete.html
  3822. share/doc/qt5/qtcore/qtglobal.html
  3823. share/doc/qt5/qtcore/qthread-members.html
  3824. share/doc/qt5/qtcore/qthread.html
  3825. share/doc/qt5/qtcore/qthreadpool-members.html
  3826. share/doc/qt5/qtcore/qthreadpool-obsolete.html
  3827. share/doc/qt5/qtcore/qthreadpool.html
  3828. share/doc/qt5/qtcore/qthreadstorage-members.html
  3829. share/doc/qt5/qtcore/qthreadstorage.html
  3830. share/doc/qt5/qtcore/qtime-members.html
  3831. share/doc/qt5/qtcore/qtime.html
  3832. share/doc/qt5/qtcore/qtimeline-members.html
  3833. share/doc/qt5/qtcore/qtimeline.html
  3834. share/doc/qt5/qtcore/qtimer-members.html
  3835. share/doc/qt5/qtcore/qtimer.html
  3836. share/doc/qt5/qtcore/qtimerevent-members.html
  3837. share/doc/qt5/qtcore/qtimerevent.html
  3838. share/doc/qt5/qtcore/qtimezone-members.html
  3839. share/doc/qt5/qtcore/qtimezone-offsetdata-members.html
  3840. share/doc/qt5/qtcore/qtimezone-offsetdata.html
  3841. share/doc/qt5/qtcore/qtimezone.html
  3842. share/doc/qt5/qtcore/qtmath.html
  3843. share/doc/qt5/qtcore/qtplugin.html
  3844. share/doc/qt5/qtcore/qtranslator-members.html
  3845. share/doc/qt5/qtcore/qtranslator.html
  3846. share/doc/qt5/qtcore/qunhandledexception-members.html
  3847. share/doc/qt5/qtcore/qunhandledexception.html
  3848. share/doc/qt5/qtcore/qurl-members.html
  3849. share/doc/qt5/qtcore/qurl-obsolete.html
  3850. share/doc/qt5/qtcore/qurl.html
  3851. share/doc/qt5/qtcore/qurlquery-members.html
  3852. share/doc/qt5/qtcore/qurlquery.html
  3853. share/doc/qt5/qtcore/quuid-members.html
  3854. share/doc/qt5/qtcore/quuid.html
  3855. share/doc/qt5/qtcore/qvariant-members.html
  3856. share/doc/qt5/qtcore/qvariant-obsolete.html
  3857. share/doc/qt5/qtcore/qvariant.html
  3858. share/doc/qt5/qtcore/qvariantanimation-members.html
  3859. share/doc/qt5/qtcore/qvariantanimation.html
  3860. share/doc/qt5/qtcore/qvarlengtharray-members.html
  3861. share/doc/qt5/qtcore/qvarlengtharray.html
  3862. share/doc/qt5/qtcore/qvector-members.html
  3863. share/doc/qt5/qtcore/qvector.html
  3864. share/doc/qt5/qtcore/qvectoriterator-members.html
  3865. share/doc/qt5/qtcore/qvectoriterator.html
  3866. share/doc/qt5/qtcore/qversionnumber-members.html
  3867. share/doc/qt5/qtcore/qversionnumber.html
  3868. share/doc/qt5/qtcore/qwaitcondition-members.html
  3869. share/doc/qt5/qtcore/qwaitcondition.html
  3870. share/doc/qt5/qtcore/qweakpointer-members.html
  3871. share/doc/qt5/qtcore/qweakpointer-obsolete.html
  3872. share/doc/qt5/qtcore/qweakpointer.html
  3873. share/doc/qt5/qtcore/qwineventnotifier-members.html
  3874. share/doc/qt5/qtcore/qwineventnotifier.html
  3875. share/doc/qt5/qtcore/qwritelocker-members.html
  3876. share/doc/qt5/qtcore/qwritelocker.html
  3877. share/doc/qt5/qtcore/qxmlstreamattribute-members.html
  3878. share/doc/qt5/qtcore/qxmlstreamattribute.html
  3879. share/doc/qt5/qtcore/qxmlstreamattributes-members.html
  3880. share/doc/qt5/qtcore/qxmlstreamattributes.html
  3881. share/doc/qt5/qtcore/qxmlstreamentitydeclaration-members.html
  3882. share/doc/qt5/qtcore/qxmlstreamentitydeclaration.html
  3883. share/doc/qt5/qtcore/qxmlstreamentityresolver-members.html
  3884. share/doc/qt5/qtcore/qxmlstreamentityresolver.html
  3885. share/doc/qt5/qtcore/qxmlstreamnamespacedeclaration-members.html
  3886. share/doc/qt5/qtcore/qxmlstreamnamespacedeclaration.html
  3887. share/doc/qt5/qtcore/qxmlstreamnotationdeclaration-members.html
  3888. share/doc/qt5/qtcore/qxmlstreamnotationdeclaration.html
  3889. share/doc/qt5/qtcore/qxmlstreamreader-members.html
  3890. share/doc/qt5/qtcore/qxmlstreamreader.html
  3891. share/doc/qt5/qtcore/qxmlstreamwriter-members.html
  3892. share/doc/qt5/qtcore/qxmlstreamwriter.html
  3893. share/doc/qt5/qtcore/resources.html
  3894. share/doc/qt5/qtcore/shared.html
  3895. share/doc/qt5/qtcore/signalsandslots.html
  3896. share/doc/qt5/qtcore/statemachine-api.html
  3897. share/doc/qt5/qtcore/statemachine.html
  3898. share/doc/qt5/qtcore/style/offline-simple.css
  3899. share/doc/qt5/qtcore/style/offline.css
  3900. share/doc/qt5/qtcore/timers.html
  3901. share/doc/qt5/qtdbus.qch
  3902. share/doc/qt5/qtdbus/examples-dbus.html
  3903. share/doc/qt5/qtdbus/examples-manifest.xml
  3904. share/doc/qt5/qtdbus/images/arrow_bc.png
  3905. share/doc/qt5/qtdbus/images/bgrContent.png
  3906. share/doc/qt5/qtdbus/images/btn_next.png
  3907. share/doc/qt5/qtdbus/images/btn_prev.png
  3908. share/doc/qt5/qtdbus/images/bullet_dn.png
  3909. share/doc/qt5/qtdbus/images/bullet_sq.png
  3910. share/doc/qt5/qtdbus/images/dbus-chat-example.png
  3911. share/doc/qt5/qtdbus/images/home.png
  3912. share/doc/qt5/qtdbus/images/ico_note.png
  3913. share/doc/qt5/qtdbus/images/ico_note_attention.png
  3914. share/doc/qt5/qtdbus/images/ico_out.png
  3915. share/doc/qt5/qtdbus/images/logo.png
  3916. share/doc/qt5/qtdbus/images/qurl-ftppath.png
  3917. share/doc/qt5/qtdbus/images/remotecontrolledcar-car-example.png
  3918. share/doc/qt5/qtdbus/qdbus.html
  3919. share/doc/qt5/qtdbus/qdbusabstractadaptor-members.html
  3920. share/doc/qt5/qtdbus/qdbusabstractadaptor.html
  3921. share/doc/qt5/qtdbus/qdbusabstractinterface-members.html
  3922. share/doc/qt5/qtdbus/qdbusabstractinterface.html
  3923. share/doc/qt5/qtdbus/qdbusadaptorexample.html
  3924. share/doc/qt5/qtdbus/qdbusargument-members.html
  3925. share/doc/qt5/qtdbus/qdbusargument.html
  3926. share/doc/qt5/qtdbus/qdbusconnection-members.html
  3927. share/doc/qt5/qtdbus/qdbusconnection-obsolete.html
  3928. share/doc/qt5/qtdbus/qdbusconnection.html
  3929. share/doc/qt5/qtdbus/qdbusconnectioninterface-members.html
  3930. share/doc/qt5/qtdbus/qdbusconnectioninterface-obsolete.html
  3931. share/doc/qt5/qtdbus/qdbusconnectioninterface.html
  3932. share/doc/qt5/qtdbus/qdbuscontext-members.html
  3933. share/doc/qt5/qtdbus/qdbuscontext.html
  3934. share/doc/qt5/qtdbus/qdbusdeclaringsignals.html
  3935. share/doc/qt5/qtdbus/qdbusdeclaringslots.html
  3936. share/doc/qt5/qtdbus/qdbuserror-members.html
  3937. share/doc/qt5/qtdbus/qdbuserror.html
  3938. share/doc/qt5/qtdbus/qdbusinterface-members.html
  3939. share/doc/qt5/qtdbus/qdbusinterface.html
  3940. share/doc/qt5/qtdbus/qdbusmessage-members.html
  3941. share/doc/qt5/qtdbus/qdbusmessage.html
  3942. share/doc/qt5/qtdbus/qdbusobjectpath-members.html
  3943. share/doc/qt5/qtdbus/qdbusobjectpath.html
  3944. share/doc/qt5/qtdbus/qdbuspendingcall-members.html
  3945. share/doc/qt5/qtdbus/qdbuspendingcall.html
  3946. share/doc/qt5/qtdbus/qdbuspendingcallwatcher-members.html
  3947. share/doc/qt5/qtdbus/qdbuspendingcallwatcher.html
  3948. share/doc/qt5/qtdbus/qdbuspendingreply-members.html
  3949. share/doc/qt5/qtdbus/qdbuspendingreply.html
  3950. share/doc/qt5/qtdbus/qdbusreply-members.html
  3951. share/doc/qt5/qtdbus/qdbusreply.html
  3952. share/doc/qt5/qtdbus/qdbusserver-members.html
  3953. share/doc/qt5/qtdbus/qdbusserver.html
  3954. share/doc/qt5/qtdbus/qdbusservicewatcher-members.html
  3955. share/doc/qt5/qtdbus/qdbusservicewatcher.html
  3956. share/doc/qt5/qtdbus/qdbussignature-members.html
  3957. share/doc/qt5/qtdbus/qdbussignature.html
  3958. share/doc/qt5/qtdbus/qdbustypesystem.html
  3959. share/doc/qt5/qtdbus/qdbusunixfiledescriptor-members.html
  3960. share/doc/qt5/qtdbus/qdbusunixfiledescriptor.html
  3961. share/doc/qt5/qtdbus/qdbusvariant-members.html
  3962. share/doc/qt5/qtdbus/qdbusvariant.html
  3963. share/doc/qt5/qtdbus/qdbusviewer.html
  3964. share/doc/qt5/qtdbus/qdbusvirtualobject-members.html
  3965. share/doc/qt5/qtdbus/qdbusvirtualobject.html
  3966. share/doc/qt5/qtdbus/qdbusxml2cpp.html
  3967. share/doc/qt5/qtdbus/qtdbus-chat-chat-cpp.html
  3968. share/doc/qt5/qtdbus/qtdbus-chat-chat-h.html
  3969. share/doc/qt5/qtdbus/qtdbus-chat-chat-pro.html
  3970. share/doc/qt5/qtdbus/qtdbus-chat-chatmainwindow-ui.html
  3971. share/doc/qt5/qtdbus/qtdbus-chat-chatsetnickname-ui.html
  3972. share/doc/qt5/qtdbus/qtdbus-chat-example.html
  3973. share/doc/qt5/qtdbus/qtdbus-chat-org-example-chat-xml.html
  3974. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-cpp.html
  3975. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-h.html
  3976. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-pro.html
  3977. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpingpong-pro.html
  3978. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-cpp.html
  3979. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-h.html
  3980. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-pro.html
  3981. share/doc/qt5/qtdbus/qtdbus-complexpingpong-example.html
  3982. share/doc/qt5/qtdbus/qtdbus-complexpingpong-ping-common-h.html
  3983. share/doc/qt5/qtdbus/qtdbus-index.html
  3984. share/doc/qt5/qtdbus/qtdbus-listnames-example.html
  3985. share/doc/qt5/qtdbus/qtdbus-listnames-listnames-cpp.html
  3986. share/doc/qt5/qtdbus/qtdbus-listnames-listnames-pro.html
  3987. share/doc/qt5/qtdbus/qtdbus-module.html
  3988. share/doc/qt5/qtdbus/qtdbus-pingpong-example.html
  3989. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-common-h.html
  3990. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-cpp.html
  3991. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-pro.html
  3992. share/doc/qt5/qtdbus/qtdbus-pingpong-pingpong-pro.html
  3993. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-cpp.html
  3994. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-h.html
  3995. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-pro.html
  3996. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-cpp.html
  3997. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-h.html
  3998. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-pro.html
  3999. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-xml.html
  4000. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-main-cpp.html
  4001. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-car-xml.html
  4002. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-cpp.html
  4003. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-h.html
  4004. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-pro.html
  4005. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-ui.html
  4006. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-example.html
  4007. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-remotecontrolledcar-pro.html
  4008. share/doc/qt5/qtdbus/qtdbus.index
  4009. share/doc/qt5/qtdbus/qtdbus.qhp
  4010. share/doc/qt5/qtdbus/qtdbus.qhp.sha1
  4011. share/doc/qt5/qtdbus/style/offline-simple.css
  4012. share/doc/qt5/qtdbus/style/offline.css
  4013. share/doc/qt5/qtdbus/usingadaptors.html
  4014. share/doc/qt5/qtdesigner.qch
  4015. share/doc/qt5/qtdesigner/designer-buddy-mode.html
  4016. share/doc/qt5/qtdesigner/designer-connection-mode.html
  4017. share/doc/qt5/qtdesigner/designer-creating-custom-widgets-extensions.html
  4018. share/doc/qt5/qtdesigner/designer-creating-custom-widgets.html
  4019. share/doc/qt5/qtdesigner/designer-creating-mainwindows.html
  4020. share/doc/qt5/qtdesigner/designer-customizing-forms.html
  4021. share/doc/qt5/qtdesigner/designer-editing-mode.html
  4022. share/doc/qt5/qtdesigner/designer-layouts.html
  4023. share/doc/qt5/qtdesigner/designer-preview.html
  4024. share/doc/qt5/qtdesigner/designer-quick-start.html
  4025. share/doc/qt5/qtdesigner/designer-resources.html
  4026. share/doc/qt5/qtdesigner/designer-stylesheet.html
  4027. share/doc/qt5/qtdesigner/designer-tab-order.html
  4028. share/doc/qt5/qtdesigner/designer-to-know.html
  4029. share/doc/qt5/qtdesigner/designer-ui-file-format.html
  4030. share/doc/qt5/qtdesigner/designer-using-a-ui-file.html
  4031. share/doc/qt5/qtdesigner/designer-using-containers.html
  4032. share/doc/qt5/qtdesigner/designer-using-custom-widgets.html
  4033. share/doc/qt5/qtdesigner/designer-widget-mode.html
  4034. share/doc/qt5/qtdesigner/examples-designer.html
  4035. share/doc/qt5/qtdesigner/examples-manifest.xml
  4036. share/doc/qt5/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
  4037. share/doc/qt5/qtdesigner/images/arrow_bc.png
  4038. share/doc/qt5/qtdesigner/images/bgrContent.png
  4039. share/doc/qt5/qtdesigner/images/btn_next.png
  4040. share/doc/qt5/qtdesigner/images/btn_prev.png
  4041. share/doc/qt5/qtdesigner/images/bullet_dn.png
  4042. share/doc/qt5/qtdesigner/images/bullet_sq.png
  4043. share/doc/qt5/qtdesigner/images/calculatorbuilder-example.png
  4044. share/doc/qt5/qtdesigner/images/calculatorform-example.png
  4045. share/doc/qt5/qtdesigner/images/containerextension-example.png
  4046. share/doc/qt5/qtdesigner/images/customwidgetplugin-example.png
  4047. share/doc/qt5/qtdesigner/images/designer-action-editor.png
  4048. share/doc/qt5/qtdesigner/images/designer-add-files-button.png
  4049. share/doc/qt5/qtdesigner/images/designer-add-resource-entry-button.png
  4050. share/doc/qt5/qtdesigner/images/designer-adding-dockwidget.png
  4051. share/doc/qt5/qtdesigner/images/designer-adding-menu-action.png
  4052. share/doc/qt5/qtdesigner/images/designer-adding-toolbar-action.png
  4053. share/doc/qt5/qtdesigner/images/designer-buddy-making.png
  4054. share/doc/qt5/qtdesigner/images/designer-buddy-mode.png
  4055. share/doc/qt5/qtdesigner/images/designer-buddy-tool.png
  4056. share/doc/qt5/qtdesigner/images/designer-choosing-form.png
  4057. share/doc/qt5/qtdesigner/images/designer-code-viewer.png
  4058. share/doc/qt5/qtdesigner/images/designer-connection-dialog.png
  4059. share/doc/qt5/qtdesigner/images/designer-connection-editing.png
  4060. share/doc/qt5/qtdesigner/images/designer-connection-editor.png
  4061. share/doc/qt5/qtdesigner/images/designer-connection-highlight.png
  4062. share/doc/qt5/qtdesigner/images/designer-connection-making.png
  4063. share/doc/qt5/qtdesigner/images/designer-connection-mode.png
  4064. share/doc/qt5/qtdesigner/images/designer-connection-to-form.png
  4065. share/doc/qt5/qtdesigner/images/designer-connection-tool.png
  4066. share/doc/qt5/qtdesigner/images/designer-containers-dockwidget.png
  4067. share/doc/qt5/qtdesigner/images/designer-containers-frame.png
  4068. share/doc/qt5/qtdesigner/images/designer-containers-groupbox.png
  4069. share/doc/qt5/qtdesigner/images/designer-containers-stackedwidget.png
  4070. share/doc/qt5/qtdesigner/images/designer-containers-tabwidget.png
  4071. share/doc/qt5/qtdesigner/images/designer-containers-toolbox.png
  4072. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry1.png
  4073. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry2.png
  4074. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry3.png
  4075. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry4.png
  4076. share/doc/qt5/qtdesigner/images/designer-creating-menu1.png
  4077. share/doc/qt5/qtdesigner/images/designer-creating-menu2.png
  4078. share/doc/qt5/qtdesigner/images/designer-creating-menu3.png
  4079. share/doc/qt5/qtdesigner/images/designer-creating-menu4.png
  4080. share/doc/qt5/qtdesigner/images/designer-creating-toolbar.png
  4081. share/doc/qt5/qtdesigner/images/designer-dialog-preview.png
  4082. share/doc/qt5/qtdesigner/images/designer-dragging-onto-form.png
  4083. share/doc/qt5/qtdesigner/images/designer-edit-resource.png
  4084. share/doc/qt5/qtdesigner/images/designer-edit-resources-button.png
  4085. share/doc/qt5/qtdesigner/images/designer-editing-mode.png
  4086. share/doc/qt5/qtdesigner/images/designer-english-dialog.png
  4087. share/doc/qt5/qtdesigner/images/designer-file-menu.png
  4088. share/doc/qt5/qtdesigner/images/designer-form-layout-cleanlooks.png
  4089. share/doc/qt5/qtdesigner/images/designer-form-layout-macintosh.png
  4090. share/doc/qt5/qtdesigner/images/designer-form-layout-windowsXP.png
  4091. share/doc/qt5/qtdesigner/images/designer-form-layout.png
  4092. share/doc/qt5/qtdesigner/images/designer-form-layoutfunction.png
  4093. share/doc/qt5/qtdesigner/images/designer-form-settings.png
  4094. share/doc/qt5/qtdesigner/images/designer-form-viewcode.png
  4095. share/doc/qt5/qtdesigner/images/designer-french-dialog.png
  4096. share/doc/qt5/qtdesigner/images/designer-layout-inserting.png
  4097. share/doc/qt5/qtdesigner/images/designer-main-window.png
  4098. share/doc/qt5/qtdesigner/images/designer-manual-containerextension.png
  4099. share/doc/qt5/qtdesigner/images/designer-manual-membersheetextension.png
  4100. share/doc/qt5/qtdesigner/images/designer-manual-propertysheetextension.png
  4101. share/doc/qt5/qtdesigner/images/designer-manual-taskmenuextension.png
  4102. share/doc/qt5/qtdesigner/images/designer-multiple-screenshot.png
  4103. share/doc/qt5/qtdesigner/images/designer-object-inspector.png
  4104. share/doc/qt5/qtdesigner/images/designer-preview-deviceskin-selection.png
  4105. share/doc/qt5/qtdesigner/images/designer-preview-style-selection.png
  4106. share/doc/qt5/qtdesigner/images/designer-preview-style.png
  4107. share/doc/qt5/qtdesigner/images/designer-preview-stylesheet.png
  4108. share/doc/qt5/qtdesigner/images/designer-promoting-widgets.png
  4109. share/doc/qt5/qtdesigner/images/designer-property-editor-add-dynamic.png
  4110. share/doc/qt5/qtdesigner/images/designer-property-editor-configure.png
  4111. share/doc/qt5/qtdesigner/images/designer-property-editor-remove-dynamic.png
  4112. share/doc/qt5/qtdesigner/images/designer-property-editor-toolbar.png
  4113. share/doc/qt5/qtdesigner/images/designer-property-editor.png
  4114. share/doc/qt5/qtdesigner/images/designer-reload-resources-button.png
  4115. share/doc/qt5/qtdesigner/images/designer-remove-resource-entry-button.png
  4116. share/doc/qt5/qtdesigner/images/designer-removing-toolbar-action.png
  4117. share/doc/qt5/qtdesigner/images/designer-resource-browser.png
  4118. share/doc/qt5/qtdesigner/images/designer-resource-selector.png
  4119. share/doc/qt5/qtdesigner/images/designer-resources-editing.png
  4120. share/doc/qt5/qtdesigner/images/designer-resources-using.png
  4121. share/doc/qt5/qtdesigner/images/designer-screenshot.png
  4122. share/doc/qt5/qtdesigner/images/designer-selecting-widget.png
  4123. share/doc/qt5/qtdesigner/images/designer-set-layout.png
  4124. share/doc/qt5/qtdesigner/images/designer-set-layout2.png
  4125. share/doc/qt5/qtdesigner/images/designer-splitter-layout.png
  4126. share/doc/qt5/qtdesigner/images/designer-stylesheet-options.png
  4127. share/doc/qt5/qtdesigner/images/designer-stylesheet-usage.png
  4128. share/doc/qt5/qtdesigner/images/designer-tab-order-mode.png
  4129. share/doc/qt5/qtdesigner/images/designer-tab-order-tool.png
  4130. share/doc/qt5/qtdesigner/images/designer-widget-box.png
  4131. share/doc/qt5/qtdesigner/images/designer-widget-morph.png
  4132. share/doc/qt5/qtdesigner/images/designer-widget-tool.png
  4133. share/doc/qt5/qtdesigner/images/directapproach-calculatorform.png
  4134. share/doc/qt5/qtdesigner/images/home.png
  4135. share/doc/qt5/qtdesigner/images/ico_note.png
  4136. share/doc/qt5/qtdesigner/images/ico_note_attention.png
  4137. share/doc/qt5/qtdesigner/images/ico_out.png
  4138. share/doc/qt5/qtdesigner/images/logo.png
  4139. share/doc/qt5/qtdesigner/images/qtdesignerextensions.png
  4140. share/doc/qt5/qtdesigner/images/qtdesignerscreenshot.png
  4141. share/doc/qt5/qtdesigner/images/rgbController-arrangement.png
  4142. share/doc/qt5/qtdesigner/images/rgbController-configure-connection1.png
  4143. share/doc/qt5/qtdesigner/images/rgbController-configure-connection2.png
  4144. share/doc/qt5/qtdesigner/images/rgbController-final-layout.png
  4145. share/doc/qt5/qtdesigner/images/rgbController-form-gridLayout.png
  4146. share/doc/qt5/qtdesigner/images/rgbController-no-toplevel-layout.png
  4147. share/doc/qt5/qtdesigner/images/rgbController-property-editing.png
  4148. share/doc/qt5/qtdesigner/images/rgbController-screenshot.png
  4149. share/doc/qt5/qtdesigner/images/rgbController-selectForLayout.png
  4150. share/doc/qt5/qtdesigner/images/rgbController-signalsAndSlots.png
  4151. share/doc/qt5/qtdesigner/images/taskmenuextension-dialog.png
  4152. share/doc/qt5/qtdesigner/images/taskmenuextension-example-faded.png
  4153. share/doc/qt5/qtdesigner/images/taskmenuextension-menu.png
  4154. share/doc/qt5/qtdesigner/images/worldtimeclock-connection.png
  4155. share/doc/qt5/qtdesigner/images/worldtimeclock-signalandslot.png
  4156. share/doc/qt5/qtdesigner/images/worldtimeclockbuilder-example.png
  4157. share/doc/qt5/qtdesigner/images/worldtimeclockplugin-example.png
  4158. share/doc/qt5/qtdesigner/qabstractextensionfactory-members.html
  4159. share/doc/qt5/qtdesigner/qabstractextensionfactory.html
  4160. share/doc/qt5/qtdesigner/qabstractextensionmanager-members.html
  4161. share/doc/qt5/qtdesigner/qabstractextensionmanager.html
  4162. share/doc/qt5/qtdesigner/qabstractformbuilder-members.html
  4163. share/doc/qt5/qtdesigner/qabstractformbuilder.html
  4164. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface-members.html
  4165. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface.html
  4166. share/doc/qt5/qtdesigner/qdesignercontainerextension-members.html
  4167. share/doc/qt5/qtdesigner/qdesignercontainerextension.html
  4168. share/doc/qt5/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
  4169. share/doc/qt5/qtdesigner/qdesignercustomwidgetcollectioninterface.html
  4170. share/doc/qt5/qtdesigner/qdesignercustomwidgetinterface-members.html
  4171. share/doc/qt5/qtdesigner/qdesignercustomwidgetinterface.html
  4172. share/doc/qt5/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
  4173. share/doc/qt5/qtdesigner/qdesignerdynamicpropertysheetextension.html
  4174. share/doc/qt5/qtdesigner/qdesignerformeditorinterface-members.html
  4175. share/doc/qt5/qtdesigner/qdesignerformeditorinterface.html
  4176. share/doc/qt5/qtdesigner/qdesignerformwindowcursorinterface-members.html
  4177. share/doc/qt5/qtdesigner/qdesignerformwindowcursorinterface.html
  4178. share/doc/qt5/qtdesigner/qdesignerformwindowinterface-members.html
  4179. share/doc/qt5/qtdesigner/qdesignerformwindowinterface.html
  4180. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface-members.html
  4181. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
  4182. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface.html
  4183. share/doc/qt5/qtdesigner/qdesignermembersheetextension-members.html
  4184. share/doc/qt5/qtdesigner/qdesignermembersheetextension.html
  4185. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface-members.html
  4186. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface.html
  4187. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface-members.html
  4188. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface.html
  4189. share/doc/qt5/qtdesigner/qdesignerpropertysheetextension-members.html
  4190. share/doc/qt5/qtdesigner/qdesignerpropertysheetextension.html
  4191. share/doc/qt5/qtdesigner/qdesignertaskmenuextension-members.html
  4192. share/doc/qt5/qtdesigner/qdesignertaskmenuextension.html
  4193. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface-members.html
  4194. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface.html
  4195. share/doc/qt5/qtdesigner/qextensionfactory-members.html
  4196. share/doc/qt5/qtdesigner/qextensionfactory.html
  4197. share/doc/qt5/qtdesigner/qextensionmanager-members.html
  4198. share/doc/qt5/qtdesigner/qextensionmanager.html
  4199. share/doc/qt5/qtdesigner/qformbuilder-members.html
  4200. share/doc/qt5/qtdesigner/qformbuilder.html
  4201. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-pro.html
  4202. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-qrc.html
  4203. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-cpp.html
  4204. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-h.html
  4205. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-ui.html
  4206. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-example.html
  4207. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-main-cpp.html
  4208. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-cpp.html
  4209. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-h.html
  4210. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-pro.html
  4211. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-ui.html
  4212. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-example.html
  4213. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-main-cpp.html
  4214. share/doc/qt5/qtdesigner/qtdesigner-components.html
  4215. share/doc/qt5/qtdesigner/qtdesigner-containerextension-containerextension-pro.html
  4216. share/doc/qt5/qtdesigner/qtdesigner-containerextension-example.html
  4217. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidget-cpp.html
  4218. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidget-h.html
  4219. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-cpp.html
  4220. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-h.html
  4221. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-cpp.html
  4222. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-h.html
  4223. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-cpp.html
  4224. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-h.html
  4225. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-analogclock-cpp.html
  4226. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-analogclock-h.html
  4227. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-cpp.html
  4228. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-h.html
  4229. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-pro.html
  4230. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-example.html
  4231. share/doc/qt5/qtdesigner/qtdesigner-index.html
  4232. share/doc/qt5/qtdesigner/qtdesigner-manual.html
  4233. share/doc/qt5/qtdesigner/qtdesigner-module.html
  4234. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-example.html
  4235. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-taskmenuextension-pro.html
  4236. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoe-cpp.html
  4237. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoe-h.html
  4238. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-cpp.html
  4239. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-h.html
  4240. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-cpp.html
  4241. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-h.html
  4242. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-cpp.html
  4243. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-h.html
  4244. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-example.html
  4245. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-form-ui.html
  4246. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-main-cpp.html
  4247. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-pro.html
  4248. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-qrc.html
  4249. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-example.html
  4250. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-cpp.html
  4251. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-h.html
  4252. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-cpp.html
  4253. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-h.html
  4254. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-pro.html
  4255. share/doc/qt5/qtdesigner/qtdesigner.index
  4256. share/doc/qt5/qtdesigner/qtdesigner.qhp
  4257. share/doc/qt5/qtdesigner/qtdesigner.qhp.sha1
  4258. share/doc/qt5/qtdesigner/style/offline-simple.css
  4259. share/doc/qt5/qtdesigner/style/offline.css
  4260. share/doc/qt5/qtdoc.qch
  4261. share/doc/qt5/qtdoc/accelerators.html
  4262. share/doc/qt5/qtdoc/accessibility.html
  4263. share/doc/qt5/qtdoc/accessible-qtquick.html
  4264. share/doc/qt5/qtdoc/accessible-qwidget.html
  4265. share/doc/qt5/qtdoc/accessible.html
  4266. share/doc/qt5/qtdoc/activeqt-idc.html
  4267. share/doc/qt5/qtdoc/activeqt-testcon.html
  4268. share/doc/qt5/qtdoc/all-examples.html
  4269. share/doc/qt5/qtdoc/android-runtime-licensing-notes.html
  4270. share/doc/qt5/qtdoc/android-support.html
  4271. share/doc/qt5/qtdoc/android3rdpartylibs.html
  4272. share/doc/qt5/qtdoc/androidgs.html
  4273. share/doc/qt5/qtdoc/androidservices.html
  4274. share/doc/qt5/qtdoc/annotated.html
  4275. share/doc/qt5/qtdoc/appicon.html
  4276. share/doc/qt5/qtdoc/atomic-operations.html
  4277. share/doc/qt5/qtdoc/best-practices.html
  4278. share/doc/qt5/qtdoc/bughowto.html
  4279. share/doc/qt5/qtdoc/build-sources.html
  4280. share/doc/qt5/qtdoc/building-from-source-ios.html
  4281. share/doc/qt5/qtdoc/classes.html
  4282. share/doc/qt5/qtdoc/classesandfunctions.html
  4283. share/doc/qt5/qtdoc/cmake-manual.html
  4284. share/doc/qt5/qtdoc/commerciallicense.html
  4285. share/doc/qt5/qtdoc/configure-options.html
  4286. share/doc/qt5/qtdoc/debug.html
  4287. share/doc/qt5/qtdoc/deployment-android.html
  4288. share/doc/qt5/qtdoc/deployment-plugins.html
  4289. share/doc/qt5/qtdoc/deployment.html
  4290. share/doc/qt5/qtdoc/desktop-integration.html
  4291. share/doc/qt5/qtdoc/embedded-linux.html
  4292. share/doc/qt5/qtdoc/examples-activeqt.html
  4293. share/doc/qt5/qtdoc/examples-android.html
  4294. share/doc/qt5/qtdoc/examples-animation.html
  4295. share/doc/qt5/qtdoc/examples-draganddrop.html
  4296. share/doc/qt5/qtdoc/examples-gestures.html
  4297. share/doc/qt5/qtdoc/examples-ios.html
  4298. share/doc/qt5/qtdoc/examples-ipc.html
  4299. share/doc/qt5/qtdoc/examples-layouts.html
  4300. share/doc/qt5/qtdoc/examples-sql.html
  4301. share/doc/qt5/qtdoc/examples-statemachine.html
  4302. share/doc/qt5/qtdoc/examples-threadandconcurrent.html
  4303. share/doc/qt5/qtdoc/examples-widgets-tools.html
  4304. share/doc/qt5/qtdoc/examples-xml.html
  4305. share/doc/qt5/qtdoc/exceptionsafety.html
  4306. share/doc/qt5/qtdoc/fdl.html
  4307. share/doc/qt5/qtdoc/functions.html
  4308. share/doc/qt5/qtdoc/gettingstarted.html
  4309. share/doc/qt5/qtdoc/gettingstartedqml.html
  4310. share/doc/qt5/qtdoc/gpl.html
  4311. share/doc/qt5/qtdoc/groups.html
  4312. share/doc/qt5/qtdoc/hierarchy.html
  4313. share/doc/qt5/qtdoc/highdpi.html
  4314. share/doc/qt5/qtdoc/i18n-plural-rules.html
  4315. share/doc/qt5/qtdoc/i18n-source-translation.html
  4316. share/doc/qt5/qtdoc/i18n.html
  4317. share/doc/qt5/qtdoc/images/accessibleobjecttree.png
  4318. share/doc/qt5/qtdoc/images/activeqt-examples.png
  4319. share/doc/qt5/qtdoc/images/animatedtiles_snapshot.png
  4320. share/doc/qt5/qtdoc/images/animation-examples.png
  4321. share/doc/qt5/qtdoc/images/applicationwindow.png
  4322. share/doc/qt5/qtdoc/images/arrow_bc.png
  4323. share/doc/qt5/qtdoc/images/bgrContent.png
  4324. share/doc/qt5/qtdoc/images/btn_next.png
  4325. share/doc/qt5/qtdoc/images/btn_prev.png
  4326. share/doc/qt5/qtdoc/images/bullet_dn.png
  4327. share/doc/qt5/qtdoc/images/bullet_sq.png
  4328. share/doc/qt5/qtdoc/images/controlstexteditor_designer.png
  4329. share/doc/qt5/qtdoc/images/controlstexteditor_main.png
  4330. share/doc/qt5/qtdoc/images/controlstexteditor_navigator.png
  4331. share/doc/qt5/qtdoc/images/controlstexteditor_newproperties.png
  4332. share/doc/qt5/qtdoc/images/controlstexteditor_openproperties.png
  4333. share/doc/qt5/qtdoc/images/controlstexteditor_rowproperties.png
  4334. share/doc/qt5/qtdoc/images/deployment-mac-application.png
  4335. share/doc/qt5/qtdoc/images/deployment-mac-bundlestructure.png
  4336. share/doc/qt5/qtdoc/images/deployment-windows-depends.png
  4337. share/doc/qt5/qtdoc/images/draganddrop-examples.png
  4338. share/doc/qt5/qtdoc/images/flickr_application.png
  4339. share/doc/qt5/qtdoc/images/home.png
  4340. share/doc/qt5/qtdoc/images/ico_note.png
  4341. share/doc/qt5/qtdoc/images/ico_note_attention.png
  4342. share/doc/qt5/qtdoc/images/ico_out.png
  4343. share/doc/qt5/qtdoc/images/icon_QtCreator_78x78px.png
  4344. share/doc/qt5/qtdoc/images/icon_Qt_78x78px.png
  4345. share/doc/qt5/qtdoc/images/icon_Tools.png
  4346. share/doc/qt5/qtdoc/images/kernel-settings.png
  4347. share/doc/qt5/qtdoc/images/layout-examples.png
  4348. share/doc/qt5/qtdoc/images/logo.png
  4349. share/doc/qt5/qtdoc/images/ok.png
  4350. share/doc/qt5/qtdoc/images/open-project.png
  4351. share/doc/qt5/qtdoc/images/project-view-2.png
  4352. share/doc/qt5/qtdoc/images/project-view.png
  4353. share/doc/qt5/qtdoc/images/project-wizard.png
  4354. share/doc/qt5/qtdoc/images/qml-extending-types.png
  4355. share/doc/qt5/qtdoc/images/qml-texteditor1_button.png
  4356. share/doc/qt5/qtdoc/images/qml-texteditor1_editmenu.png
  4357. share/doc/qt5/qtdoc/images/qml-texteditor1_filemenu.png
  4358. share/doc/qt5/qtdoc/images/qml-texteditor1_simplebutton.png
  4359. share/doc/qt5/qtdoc/images/qml-texteditor2_menubar.png
  4360. share/doc/qt5/qtdoc/images/qml-texteditor3_texteditor.png
  4361. share/doc/qt5/qtdoc/images/qml-texteditor4_texteditor.png
  4362. share/doc/qt5/qtdoc/images/qml-texteditor5_editmenu.png
  4363. share/doc/qt5/qtdoc/images/qml-texteditor5_filemenu.png
  4364. share/doc/qt5/qtdoc/images/qml-texteditor5_newfile.png
  4365. share/doc/qt5/qtdoc/images/qml-uses-animation.png
  4366. share/doc/qt5/qtdoc/images/qml-uses-integratingjs.png
  4367. share/doc/qt5/qtdoc/images/qml-uses-layouts-anchors.png
  4368. share/doc/qt5/qtdoc/images/qml-uses-layouts-direct.png
  4369. share/doc/qt5/qtdoc/images/qml-uses-layouts-positioners.png
  4370. share/doc/qt5/qtdoc/images/qml-uses-text.png
  4371. share/doc/qt5/qtdoc/images/qml-uses-visual-opacity.png
  4372. share/doc/qt5/qtdoc/images/qml-uses-visual-rectangles.png
  4373. share/doc/qt5/qtdoc/images/qml-uses-visual-transforms.png
  4374. share/doc/qt5/qtdoc/images/qt-codesample.png
  4375. share/doc/qt5/qtdoc/images/qt-creator-gs.png
  4376. share/doc/qt5/qtdoc/images/qt-embedded-fontfeatures.png
  4377. share/doc/qt5/qtdoc/images/qt5_everywhere_demo.jpg
  4378. share/doc/qt5/qtdoc/images/qt5_graphicaleffects.jpg
  4379. share/doc/qt5/qtdoc/images/qt5_particles.jpg
  4380. share/doc/qt5/qtdoc/images/qt5_shadereffect.jpg
  4381. share/doc/qt5/qtdoc/images/qt5_video.jpg
  4382. share/doc/qt5/qtdoc/images/qt5_widgets.jpg
  4383. share/doc/qt5/qtdoc/images/qtcreator-run.png
  4384. share/doc/qt5/qtdoc/images/qtlocation-mapviewer-demo.jpg
  4385. share/doc/qt5/qtdoc/images/qtpositioning_weatherinfo_ex.jpg
  4386. share/doc/qt5/qtdoc/images/qtquickcontrols2-material.png
  4387. share/doc/qt5/qtdoc/images/qtsensors_accelbubble_ex.jpg
  4388. share/doc/qt5/qtdoc/images/qtwebengine_quicknanobrowser.jpg
  4389. share/doc/qt5/qtdoc/images/scalability-gridlayout.png
  4390. share/doc/qt5/qtdoc/images/select-item-to-add.png
  4391. share/doc/qt5/qtdoc/images/session.png
  4392. share/doc/qt5/qtdoc/images/sql-examples.png
  4393. share/doc/qt5/qtdoc/images/thread-examples.png
  4394. share/doc/qt5/qtdoc/images/threadsandobjects.png
  4395. share/doc/qt5/qtdoc/images/threadvisual-example.png
  4396. share/doc/qt5/qtdoc/images/tool-examples.png
  4397. share/doc/qt5/qtdoc/images/xml-examples.png
  4398. share/doc/qt5/qtdoc/index.html
  4399. share/doc/qt5/qtdoc/integrity-building-monolith.html
  4400. share/doc/qt5/qtdoc/integrity-building-qt-for-imx6quad-board.html
  4401. share/doc/qt5/qtdoc/integrity-building-u-boot-image.html
  4402. share/doc/qt5/qtdoc/integrity-creating-bootable-sd-card.html
  4403. share/doc/qt5/qtdoc/integrity-installing-dependencies.html
  4404. share/doc/qt5/qtdoc/integrity-monolith-project-tutorial.html
  4405. share/doc/qt5/qtdoc/integrity-preparing-bsp-for-imx6quad-board.html
  4406. share/doc/qt5/qtdoc/integrity-preparing-u-boot.html
  4407. share/doc/qt5/qtdoc/internationalization.html
  4408. share/doc/qt5/qtdoc/ios-support.html
  4409. share/doc/qt5/qtdoc/ipc.html
  4410. share/doc/qt5/qtdoc/known-issues.html
  4411. share/doc/qt5/qtdoc/lgpl.html
  4412. share/doc/qt5/qtdoc/licenses-used-in-qt.html
  4413. share/doc/qt5/qtdoc/licensing.html
  4414. share/doc/qt5/qtdoc/linux-building.html
  4415. share/doc/qt5/qtdoc/linux-deployment.html
  4416. share/doc/qt5/qtdoc/linux-issues.html
  4417. share/doc/qt5/qtdoc/linux-requirements.html
  4418. share/doc/qt5/qtdoc/linux.html
  4419. share/doc/qt5/qtdoc/mac-licensing.html
  4420. share/doc/qt5/qtdoc/mobiledevelopment.html
  4421. share/doc/qt5/qtdoc/moc.html
  4422. share/doc/qt5/qtdoc/modules-cpp.html
  4423. share/doc/qt5/qtdoc/modules-qml.html
  4424. share/doc/qt5/qtdoc/modules.html
  4425. share/doc/qt5/qtdoc/namespaces.html
  4426. share/doc/qt5/qtdoc/newclasses51.html
  4427. share/doc/qt5/qtdoc/newclasses52.html
  4428. share/doc/qt5/qtdoc/newclasses53.html
  4429. share/doc/qt5/qtdoc/newclasses54.html
  4430. share/doc/qt5/qtdoc/newclasses55.html
  4431. share/doc/qt5/qtdoc/newclasses56.html
  4432. share/doc/qt5/qtdoc/newclasses57.html
  4433. share/doc/qt5/qtdoc/newclasses58.html
  4434. share/doc/qt5/qtdoc/newclasses59.html
  4435. share/doc/qt5/qtdoc/obsoleteclasses.html
  4436. share/doc/qt5/qtdoc/obsoleteqmltypes.html
  4437. share/doc/qt5/qtdoc/opensourcelicense.html
  4438. share/doc/qt5/qtdoc/opensslsupport.html
  4439. share/doc/qt5/qtdoc/osx-building.html
  4440. share/doc/qt5/qtdoc/osx-deployment.html
  4441. share/doc/qt5/qtdoc/osx-issues.html
  4442. share/doc/qt5/qtdoc/osx-requirements.html
  4443. share/doc/qt5/qtdoc/osx.html
  4444. share/doc/qt5/qtdoc/overviews-main.html
  4445. share/doc/qt5/qtdoc/overviews.html
  4446. share/doc/qt5/qtdoc/platform-notes-android.html
  4447. share/doc/qt5/qtdoc/platform-notes-integrity.html
  4448. share/doc/qt5/qtdoc/platform-notes-ios.html
  4449. share/doc/qt5/qtdoc/platform-notes-qnx.html
  4450. share/doc/qt5/qtdoc/platform-notes-vxworks.html
  4451. share/doc/qt5/qtdoc/plugins-howto.html
  4452. share/doc/qt5/qtdoc/porting-to-ios.html
  4453. share/doc/qt5/qtdoc/portingcppapp.html
  4454. share/doc/qt5/qtdoc/portingguide.html
  4455. share/doc/qt5/qtdoc/portingqmlapp.html
  4456. share/doc/qt5/qtdoc/portingtoandroid.html
  4457. share/doc/qt5/qtdoc/publishtogoogleplay.html
  4458. share/doc/qt5/qtdoc/qml-codingconventions.html
  4459. share/doc/qt5/qtdoc/qml-glossary.html
  4460. share/doc/qt5/qtdoc/qmlapplications.html
  4461. share/doc/qt5/qtdoc/qmlbasictypes.html
  4462. share/doc/qt5/qtdoc/qmlfirststeps.html
  4463. share/doc/qt5/qtdoc/qmltypes.html
  4464. share/doc/qt5/qtdoc/qpa.html
  4465. share/doc/qt5/qtdoc/qt-activex.html
  4466. share/doc/qt5/qtdoc/qt-attribution-cmake-macros.html
  4467. share/doc/qt5/qtdoc/qt-attribution-llvmpipe.html
  4468. share/doc/qt5/qtdoc/qt-conf.html
  4469. share/doc/qt5/qtdoc/qt-embedded-fonts.html
  4470. share/doc/qt5/qtdoc/qt-embedded-kmap2qmap.html
  4471. share/doc/qt5/qtdoc/qt-embedded-makeqpf.html
  4472. share/doc/qt5/qtdoc/qt-gui-concepts.html
  4473. share/doc/qt5/qtdoc/qt5-intro.html
  4474. share/doc/qt5/qtdoc/qtconcurrent-mtexamples.html
  4475. share/doc/qt5/qtdoc/qtconcurrentexamples.html
  4476. share/doc/qt5/qtdoc/qtdoc.index
  4477. share/doc/qt5/qtdoc/qtdoc.qhp
  4478. share/doc/qt5/qtdoc/qtdoc.qhp.sha1
  4479. share/doc/qt5/qtdoc/qtexamples.html
  4480. share/doc/qt5/qtdoc/qtexamplesandtutorials.html
  4481. share/doc/qt5/qtdoc/qtmain.html
  4482. share/doc/qt5/qtdoc/qtmodules.html
  4483. share/doc/qt5/qtdoc/qtquick-debugging.html
  4484. share/doc/qt5/qtdoc/qtquick-deployment.html
  4485. share/doc/qt5/qtdoc/qtquick-internationalization.html
  4486. share/doc/qt5/qtdoc/qtquick-performance.html
  4487. share/doc/qt5/qtdoc/qtquick-porting-qt5.html
  4488. share/doc/qt5/qtdoc/qtquick-qmlscene.html
  4489. share/doc/qt5/qtdoc/qtquick-qtquicktest.html
  4490. share/doc/qt5/qtdoc/qtquick-usecase-animations.html
  4491. share/doc/qt5/qtdoc/qtquick-usecase-integratingjs.html
  4492. share/doc/qt5/qtdoc/qtquick-usecase-layouts.html
  4493. share/doc/qt5/qtdoc/qtquick-usecase-styling.html
  4494. share/doc/qt5/qtdoc/qtquick-usecase-text.html
  4495. share/doc/qt5/qtdoc/qtquick-usecase-userinput.html
  4496. share/doc/qt5/qtdoc/qtquick-usecase-visual.html
  4497. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-action.html
  4498. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-logic.html
  4499. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-ui.html
  4500. share/doc/qt5/qtdoc/qtquickcontrols-texteditor.html
  4501. share/doc/qt5/qtdoc/qundo.html
  4502. share/doc/qt5/qtdoc/rcc.html
  4503. share/doc/qt5/qtdoc/reference-overview.html
  4504. share/doc/qt5/qtdoc/restoring-geometry.html
  4505. share/doc/qt5/qtdoc/scalability.html
  4506. share/doc/qt5/qtdoc/session.html
  4507. share/doc/qt5/qtdoc/sharedlibrary.html
  4508. share/doc/qt5/qtdoc/signalsandslots-syntaxes.html
  4509. share/doc/qt5/qtdoc/sourcebreaks.html
  4510. share/doc/qt5/qtdoc/sql-examples.html
  4511. share/doc/qt5/qtdoc/string-processing.html
  4512. share/doc/qt5/qtdoc/style/offline-simple.css
  4513. share/doc/qt5/qtdoc/style/offline.css
  4514. share/doc/qt5/qtdoc/style/qt5-sidebar.html
  4515. share/doc/qt5/qtdoc/supported-platforms-and-configurations.html
  4516. share/doc/qt5/qtdoc/supported-platforms.html
  4517. share/doc/qt5/qtdoc/testing-and-debugging.html
  4518. share/doc/qt5/qtdoc/third-party-libraries.html
  4519. share/doc/qt5/qtdoc/thread-basics.html
  4520. share/doc/qt5/qtdoc/thread.html
  4521. share/doc/qt5/qtdoc/threads-modules.html
  4522. share/doc/qt5/qtdoc/threads-qobject.html
  4523. share/doc/qt5/qtdoc/threads-reentrancy.html
  4524. share/doc/qt5/qtdoc/threads-synchronizing.html
  4525. share/doc/qt5/qtdoc/threads-technologies.html
  4526. share/doc/qt5/qtdoc/threads.html
  4527. share/doc/qt5/qtdoc/topics-app-development.html
  4528. share/doc/qt5/qtdoc/topics-core.html
  4529. share/doc/qt5/qtdoc/topics-data-storage.html
  4530. share/doc/qt5/qtdoc/topics-graphics.html
  4531. share/doc/qt5/qtdoc/topics-network-connectivity.html
  4532. share/doc/qt5/qtdoc/topics-scripting.html
  4533. share/doc/qt5/qtdoc/topics-ui.html
  4534. share/doc/qt5/qtdoc/topics-web-content.html
  4535. share/doc/qt5/qtdoc/touchinputexamples.html
  4536. share/doc/qt5/qtdoc/trademarks.html
  4537. share/doc/qt5/qtdoc/uic.html
  4538. share/doc/qt5/qtdoc/unicode.html
  4539. share/doc/qt5/qtdoc/unix-signals.html
  4540. share/doc/qt5/qtdoc/vxworks.html
  4541. share/doc/qt5/qtdoc/whatsnew50.html
  4542. share/doc/qt5/qtdoc/whatsnew51.html
  4543. share/doc/qt5/qtdoc/whatsnew52.html
  4544. share/doc/qt5/qtdoc/whatsnew53.html
  4545. share/doc/qt5/qtdoc/whatsnew54.html
  4546. share/doc/qt5/qtdoc/whatsnew55.html
  4547. share/doc/qt5/qtdoc/whatsnew56.html
  4548. share/doc/qt5/qtdoc/whatsnew57.html
  4549. share/doc/qt5/qtdoc/whatsnew58.html
  4550. share/doc/qt5/qtdoc/whatsnew59.html
  4551. share/doc/qt5/qtdoc/why-moc.html
  4552. share/doc/qt5/qtdoc/windows-building.html
  4553. share/doc/qt5/qtdoc/windows-deployment.html
  4554. share/doc/qt5/qtdoc/windows-issues.html
  4555. share/doc/qt5/qtdoc/windows-requirements.html
  4556. share/doc/qt5/qtdoc/windows-support.html
  4557. share/doc/qt5/qtdoc/winrt-support.html
  4558. share/doc/qt5/qtdoc/xml-examples.html
  4559. share/doc/qt5/qtgamepad.qch
  4560. share/doc/qt5/qtgamepad/examples-manifest.xml
  4561. share/doc/qt5/qtgamepad/images/arrow_bc.png
  4562. share/doc/qt5/qtgamepad/images/bgrContent.png
  4563. share/doc/qt5/qtgamepad/images/btn_next.png
  4564. share/doc/qt5/qtgamepad/images/btn_prev.png
  4565. share/doc/qt5/qtgamepad/images/bullet_dn.png
  4566. share/doc/qt5/qtgamepad/images/bullet_sq.png
  4567. share/doc/qt5/qtgamepad/images/configuregamepadbuttons-example.png
  4568. share/doc/qt5/qtgamepad/images/home.png
  4569. share/doc/qt5/qtgamepad/images/ico_note.png
  4570. share/doc/qt5/qtgamepad/images/ico_note_attention.png
  4571. share/doc/qt5/qtgamepad/images/ico_out.png
  4572. share/doc/qt5/qtgamepad/images/keynavigationgamepad-example.png
  4573. share/doc/qt5/qtgamepad/images/logo.png
  4574. share/doc/qt5/qtgamepad/images/qtquickgamepad-example.png
  4575. share/doc/qt5/qtgamepad/qgamepad-members.html
  4576. share/doc/qt5/qtgamepad/qgamepad.html
  4577. share/doc/qt5/qtgamepad/qgamepadkeynavigation-members.html
  4578. share/doc/qt5/qtgamepad/qgamepadkeynavigation.html
  4579. share/doc/qt5/qtgamepad/qgamepadmanager-members.html
  4580. share/doc/qt5/qtgamepad/qgamepadmanager.html
  4581. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-android-androidmanifest-xml.html
  4582. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-configurebuttons-pro.html
  4583. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-example.html
  4584. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-main-cpp.html
  4585. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-main-qml.html
  4586. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-qml-qrc.html
  4587. share/doc/qt5/qtgamepad/qtgamepad-examples.html
  4588. share/doc/qt5/qtgamepad/qtgamepad-index.html
  4589. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-example.html
  4590. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-keynavigation-pro.html
  4591. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-main-cpp.html
  4592. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-qml-main-qml.html
  4593. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-qml-qrc.html
  4594. share/doc/qt5/qtgamepad/qtgamepad-module.html
  4595. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-example.html
  4596. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-main-cpp.html
  4597. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-mouseitem-pro.html
  4598. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-qml-main-qml.html
  4599. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-qml-qrc.html
  4600. share/doc/qt5/qtgamepad/qtgamepad-qmlmodule.html
  4601. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-example.html
  4602. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-main-cpp.html
  4603. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-buttonimage-qml.html
  4604. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-dpad-qml.html
  4605. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-joystickviewer-qml.html
  4606. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-leftthumbstick-qml.html
  4607. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-main-qml.html
  4608. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-qrc.html
  4609. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-rightthumbstick-qml.html
  4610. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-quickgamepad-pro.html
  4611. share/doc/qt5/qtgamepad/qtgamepad-simple-android-androidmanifest-xml.html
  4612. share/doc/qt5/qtgamepad/qtgamepad-simple-example.html
  4613. share/doc/qt5/qtgamepad/qtgamepad-simple-gamepadmonitor-cpp.html
  4614. share/doc/qt5/qtgamepad/qtgamepad-simple-gamepadmonitor-h.html
  4615. share/doc/qt5/qtgamepad/qtgamepad-simple-main-cpp.html
  4616. share/doc/qt5/qtgamepad/qtgamepad-simple-simple-pro.html
  4617. share/doc/qt5/qtgamepad/qtgamepad.index
  4618. share/doc/qt5/qtgamepad/qtgamepad.qhp
  4619. share/doc/qt5/qtgamepad/qtgamepad.qhp.sha1
  4620. share/doc/qt5/qtgamepad/style/offline-simple.css
  4621. share/doc/qt5/qtgamepad/style/offline.css
  4622. share/doc/qt5/qtgraphicaleffects.qch
  4623. share/doc/qt5/qtgraphicaleffects/graphicaleffects.html
  4624. share/doc/qt5/qtgraphicaleffects/images/Blend_bug_and_butterfly.png
  4625. share/doc/qt5/qtgraphicaleffects/images/Blend_mode1.png
  4626. share/doc/qt5/qtgraphicaleffects/images/Blend_mode10.png
  4627. share/doc/qt5/qtgraphicaleffects/images/Blend_mode11.png
  4628. share/doc/qt5/qtgraphicaleffects/images/Blend_mode12.png
  4629. share/doc/qt5/qtgraphicaleffects/images/Blend_mode13.png
  4630. share/doc/qt5/qtgraphicaleffects/images/Blend_mode14.png
  4631. share/doc/qt5/qtgraphicaleffects/images/Blend_mode15.png
  4632. share/doc/qt5/qtgraphicaleffects/images/Blend_mode16.png
  4633. share/doc/qt5/qtgraphicaleffects/images/Blend_mode17.png
  4634. share/doc/qt5/qtgraphicaleffects/images/Blend_mode18.png
  4635. share/doc/qt5/qtgraphicaleffects/images/Blend_mode19.png
  4636. share/doc/qt5/qtgraphicaleffects/images/Blend_mode2.png
  4637. share/doc/qt5/qtgraphicaleffects/images/Blend_mode20.png
  4638. share/doc/qt5/qtgraphicaleffects/images/Blend_mode21.png
  4639. share/doc/qt5/qtgraphicaleffects/images/Blend_mode22.png
  4640. share/doc/qt5/qtgraphicaleffects/images/Blend_mode3.png
  4641. share/doc/qt5/qtgraphicaleffects/images/Blend_mode4.png
  4642. share/doc/qt5/qtgraphicaleffects/images/Blend_mode5.png
  4643. share/doc/qt5/qtgraphicaleffects/images/Blend_mode6.png
  4644. share/doc/qt5/qtgraphicaleffects/images/Blend_mode7.png
  4645. share/doc/qt5/qtgraphicaleffects/images/Blend_mode8.png
  4646. share/doc/qt5/qtgraphicaleffects/images/Blend_mode9.png
  4647. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness1.png
  4648. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness2.png
  4649. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness3.png
  4650. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_bug.png
  4651. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast1.png
  4652. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast2.png
  4653. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast3.png
  4654. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast_graph.png
  4655. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_butterfly.png
  4656. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color1.png
  4657. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color2.png
  4658. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color3.png
  4659. share/doc/qt5/qtgraphicaleffects/images/Colorize_bug.png
  4660. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue1.png
  4661. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue2.png
  4662. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue3.png
  4663. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue_scale.png
  4664. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness1.png
  4665. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness2.png
  4666. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness3.png
  4667. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation1.png
  4668. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation2.png
  4669. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation3.png
  4670. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient.png
  4671. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle1.png
  4672. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle2.png
  4673. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle3.png
  4674. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient1.png
  4675. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient2.png
  4676. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient3.png
  4677. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset1.png
  4678. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset2.png
  4679. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset3.png
  4680. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_maskSource1.png
  4681. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_maskSource2.png
  4682. share/doc/qt5/qtgraphicaleffects/images/Desaturate_bug.png
  4683. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation1.png
  4684. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation2.png
  4685. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation3.png
  4686. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle1.png
  4687. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle2.png
  4688. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle3.png
  4689. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_bug.png
  4690. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length1.png
  4691. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length2.png
  4692. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length3.png
  4693. share/doc/qt5/qtgraphicaleffects/images/Displace_bug.png
  4694. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement1.png
  4695. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement2.png
  4696. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement3.png
  4697. share/doc/qt5/qtgraphicaleffects/images/Displace_map.png
  4698. share/doc/qt5/qtgraphicaleffects/images/DropShadow-transparentBorder.png
  4699. share/doc/qt5/qtgraphicaleffects/images/DropShadow_butterfly.png
  4700. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color1.png
  4701. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color2.png
  4702. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color3.png
  4703. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset1.png
  4704. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset2.png
  4705. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset3.png
  4706. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius1.png
  4707. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius2.png
  4708. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius3.png
  4709. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread1.png
  4710. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread2.png
  4711. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread3.png
  4712. share/doc/qt5/qtgraphicaleffects/images/FastBlur_bug.png
  4713. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius1.png
  4714. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius2.png
  4715. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius3.png
  4716. share/doc/qt5/qtgraphicaleffects/images/FastBlur_transparentBorder1.png
  4717. share/doc/qt5/qtgraphicaleffects/images/FastBlur_transparentBorder2.png
  4718. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_bug.png
  4719. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma1.png
  4720. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma1_graph.png
  4721. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma2.png
  4722. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma2_graph.png
  4723. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma3.png
  4724. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma3_graph.png
  4725. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_bug.png
  4726. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation1.png
  4727. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation2.png
  4728. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation3.png
  4729. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation_graph.png
  4730. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius1.png
  4731. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius2.png
  4732. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius3.png
  4733. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_transparentBorder1.png
  4734. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_transparentBorder2.png
  4735. share/doc/qt5/qtgraphicaleffects/images/Glow-transparentBorder.png
  4736. share/doc/qt5/qtgraphicaleffects/images/Glow_butterfly.png
  4737. share/doc/qt5/qtgraphicaleffects/images/Glow_color1.png
  4738. share/doc/qt5/qtgraphicaleffects/images/Glow_color2.png
  4739. share/doc/qt5/qtgraphicaleffects/images/Glow_color3.png
  4740. share/doc/qt5/qtgraphicaleffects/images/Glow_radius1.png
  4741. share/doc/qt5/qtgraphicaleffects/images/Glow_radius2.png
  4742. share/doc/qt5/qtgraphicaleffects/images/Glow_radius3.png
  4743. share/doc/qt5/qtgraphicaleffects/images/Glow_spread1.png
  4744. share/doc/qt5/qtgraphicaleffects/images/Glow_spread2.png
  4745. share/doc/qt5/qtgraphicaleffects/images/Glow_spread3.png
  4746. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_bug.png
  4747. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue1.png
  4748. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue2.png
  4749. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue3.png
  4750. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness1.png
  4751. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness2.png
  4752. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness3.png
  4753. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation1.png
  4754. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation2.png
  4755. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation3.png
  4756. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_butterfly.png
  4757. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color1.png
  4758. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color2.png
  4759. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color3.png
  4760. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_fast1.png
  4761. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_fast2.png
  4762. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset1.png
  4763. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset2.png
  4764. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset3.png
  4765. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius1.png
  4766. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius2.png
  4767. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius3.png
  4768. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread1.png
  4769. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread2.png
  4770. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread3.png
  4771. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_butterfly.png
  4772. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_default_curve.png
  4773. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma1.png
  4774. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma2.png
  4775. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma2_curve.png
  4776. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma3.png
  4777. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma3_curve.png
  4778. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput1.png
  4779. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput2.png
  4780. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput2_curve.png
  4781. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput3.png
  4782. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput3_curve.png
  4783. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput1.png
  4784. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput2.png
  4785. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput2_curve.png
  4786. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput3.png
  4787. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput3_curve.png
  4788. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput1.png
  4789. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput2.png
  4790. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput2_curve.png
  4791. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput3.png
  4792. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput3_curve.png
  4793. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput1.png
  4794. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput2.png
  4795. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput2_curve.png
  4796. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput3.png
  4797. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput3_curve.png
  4798. share/doc/qt5/qtgraphicaleffects/images/LinearGradient.png
  4799. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end1.png
  4800. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end2.png
  4801. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end3.png
  4802. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient1.png
  4803. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient2.png
  4804. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient3.png
  4805. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_maskSource1.png
  4806. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_maskSource2.png
  4807. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start1.png
  4808. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start2.png
  4809. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start3.png
  4810. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_bug.png
  4811. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_mask.png
  4812. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius1.png
  4813. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius2.png
  4814. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius3.png
  4815. share/doc/qt5/qtgraphicaleffects/images/OpacityMask_bug.png
  4816. share/doc/qt5/qtgraphicaleffects/images/OpacityMask_mask.png
  4817. share/doc/qt5/qtgraphicaleffects/images/Original_bug.png
  4818. share/doc/qt5/qtgraphicaleffects/images/Original_butterfly.png
  4819. share/doc/qt5/qtgraphicaleffects/images/Original_butterfly_black.png
  4820. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle1.png
  4821. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle2.png
  4822. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle3.png
  4823. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_bug.png
  4824. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset1.png
  4825. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset2.png
  4826. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset3.png
  4827. share/doc/qt5/qtgraphicaleffects/images/RadialGradient.png
  4828. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle1.png
  4829. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle2.png
  4830. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle3.png
  4831. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient1.png
  4832. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient2.png
  4833. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient3.png
  4834. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset1.png
  4835. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset2.png
  4836. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset3.png
  4837. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalRadius1.png
  4838. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalRadius2.png
  4839. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_maskSource1.png
  4840. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_maskSource2.png
  4841. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_applied.png
  4842. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color1.png
  4843. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color2.png
  4844. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color3.png
  4845. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius1.png
  4846. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius2.png
  4847. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius3.png
  4848. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius1.png
  4849. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius2.png
  4850. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius3.png
  4851. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread1.png
  4852. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread2.png
  4853. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread3.png
  4854. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_bug.png
  4855. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops1.png
  4856. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops2.png
  4857. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops3.png
  4858. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius1.png
  4859. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius2.png
  4860. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius3.png
  4861. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_transparentBorder1.png
  4862. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_transparentBorder2.png
  4863. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_bug.png
  4864. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_mask.png
  4865. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread1.png
  4866. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread2.png
  4867. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread3.png
  4868. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold1.png
  4869. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold2.png
  4870. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold3.png
  4871. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_bug.png
  4872. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset1.png
  4873. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset2.png
  4874. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset3.png
  4875. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length1.png
  4876. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length2.png
  4877. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length3.png
  4878. share/doc/qt5/qtgraphicaleffects/images/arrow_bc.png
  4879. share/doc/qt5/qtgraphicaleffects/images/bgrContent.png
  4880. share/doc/qt5/qtgraphicaleffects/images/btn_next.png
  4881. share/doc/qt5/qtgraphicaleffects/images/btn_prev.png
  4882. share/doc/qt5/qtgraphicaleffects/images/bullet_dn.png
  4883. share/doc/qt5/qtgraphicaleffects/images/bullet_sq.png
  4884. share/doc/qt5/qtgraphicaleffects/images/home.png
  4885. share/doc/qt5/qtgraphicaleffects/images/ico_note.png
  4886. share/doc/qt5/qtgraphicaleffects/images/ico_note_attention.png
  4887. share/doc/qt5/qtgraphicaleffects/images/ico_out.png
  4888. share/doc/qt5/qtgraphicaleffects/images/logo.png
  4889. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-blend-members.html
  4890. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-blend.html
  4891. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast-members.html
  4892. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast.html
  4893. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-colorize-members.html
  4894. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-colorize.html
  4895. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay-members.html
  4896. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay.html
  4897. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient-members.html
  4898. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient.html
  4899. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate-members.html
  4900. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate.html
  4901. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur-members.html
  4902. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur.html
  4903. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-displace-members.html
  4904. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-displace.html
  4905. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow-members.html
  4906. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow.html
  4907. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur-members.html
  4908. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur.html
  4909. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust-members.html
  4910. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust.html
  4911. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur-members.html
  4912. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur.html
  4913. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-glow-members.html
  4914. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-glow.html
  4915. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation-members.html
  4916. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation.html
  4917. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow-members.html
  4918. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow.html
  4919. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust-members.html
  4920. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust.html
  4921. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient-members.html
  4922. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient.html
  4923. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur-members.html
  4924. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur.html
  4925. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask-members.html
  4926. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask.html
  4927. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur-members.html
  4928. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur.html
  4929. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient-members.html
  4930. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient.html
  4931. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow-members.html
  4932. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow.html
  4933. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur-members.html
  4934. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur.html
  4935. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask-members.html
  4936. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask.html
  4937. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur-members.html
  4938. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur.html
  4939. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects-index.html
  4940. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects-qmlmodule.html
  4941. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.index
  4942. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.qhp
  4943. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.qhp.sha1
  4944. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.tags
  4945. share/doc/qt5/qtgraphicaleffects/style/offline-simple.css
  4946. share/doc/qt5/qtgraphicaleffects/style/offline.css
  4947. share/doc/qt5/qtgui.qch
  4948. share/doc/qt5/qtgui/coordsys.html
  4949. share/doc/qt5/qtgui/dnd.html
  4950. share/doc/qt5/qtgui/examples-manifest.xml
  4951. share/doc/qt5/qtgui/images/alphafill.png
  4952. share/doc/qt5/qtgui/images/analogclock-window-example.png
  4953. share/doc/qt5/qtgui/images/analogclockwindow-viewport.png
  4954. share/doc/qt5/qtgui/images/arrow_bc.png
  4955. share/doc/qt5/qtgui/images/bearings.png
  4956. share/doc/qt5/qtgui/images/bgrContent.png
  4957. share/doc/qt5/qtgui/images/brush-outline.png
  4958. share/doc/qt5/qtgui/images/brush-styles.png
  4959. share/doc/qt5/qtgui/images/btn_next.png
  4960. share/doc/qt5/qtgui/images/btn_prev.png
  4961. share/doc/qt5/qtgui/images/bullet_dn.png
  4962. share/doc/qt5/qtgui/images/bullet_sq.png
  4963. share/doc/qt5/qtgui/images/coordinatesystem-analogclock.png
  4964. share/doc/qt5/qtgui/images/coordinatesystem-line-antialias.png
  4965. share/doc/qt5/qtgui/images/coordinatesystem-line-raster.png
  4966. share/doc/qt5/qtgui/images/coordinatesystem-line.png
  4967. share/doc/qt5/qtgui/images/coordinatesystem-rect-antialias.png
  4968. share/doc/qt5/qtgui/images/coordinatesystem-rect-raster.png
  4969. share/doc/qt5/qtgui/images/coordinatesystem-rect.png
  4970. share/doc/qt5/qtgui/images/coordinatesystem-transformations.png
  4971. share/doc/qt5/qtgui/images/cursor-arrow.png
  4972. share/doc/qt5/qtgui/images/cursor-busy.png
  4973. share/doc/qt5/qtgui/images/cursor-closedhand.png
  4974. share/doc/qt5/qtgui/images/cursor-cross.png
  4975. share/doc/qt5/qtgui/images/cursor-forbidden.png
  4976. share/doc/qt5/qtgui/images/cursor-hand.png
  4977. share/doc/qt5/qtgui/images/cursor-hsplit.png
  4978. share/doc/qt5/qtgui/images/cursor-ibeam.png
  4979. share/doc/qt5/qtgui/images/cursor-openhand.png
  4980. share/doc/qt5/qtgui/images/cursor-sizeall.png
  4981. share/doc/qt5/qtgui/images/cursor-sizeb.png
  4982. share/doc/qt5/qtgui/images/cursor-sizef.png
  4983. share/doc/qt5/qtgui/images/cursor-sizeh.png
  4984. share/doc/qt5/qtgui/images/cursor-sizev.png
  4985. share/doc/qt5/qtgui/images/cursor-uparrow.png
  4986. share/doc/qt5/qtgui/images/cursor-vsplit.png
  4987. share/doc/qt5/qtgui/images/cursor-wait.png
  4988. share/doc/qt5/qtgui/images/cursor-whatsthis.png
  4989. share/doc/qt5/qtgui/images/home.png
  4990. share/doc/qt5/qtgui/images/hoverevents.png
  4991. share/doc/qt5/qtgui/images/ico_note.png
  4992. share/doc/qt5/qtgui/images/ico_note_attention.png
  4993. share/doc/qt5/qtgui/images/ico_out.png
  4994. share/doc/qt5/qtgui/images/icon.png
  4995. share/doc/qt5/qtgui/images/logo.png
  4996. share/doc/qt5/qtgui/images/openglwindow-example.png
  4997. share/doc/qt5/qtgui/images/paintsystem-antialiasing.png
  4998. share/doc/qt5/qtgui/images/paintsystem-core.png
  4999. share/doc/qt5/qtgui/images/paintsystem-fancygradient.png
  5000. share/doc/qt5/qtgui/images/paintsystem-gradients.png
  5001. share/doc/qt5/qtgui/images/paintsystem-movie.png
  5002. share/doc/qt5/qtgui/images/paintsystem-painterpath.png
  5003. share/doc/qt5/qtgui/images/palette.png
  5004. share/doc/qt5/qtgui/images/plaintext-layout.png
  5005. share/doc/qt5/qtgui/images/qcolor-cmyk.png
  5006. share/doc/qt5/qtgui/images/qcolor-hsv.png
  5007. share/doc/qt5/qtgui/images/qcolor-hue.png
  5008. share/doc/qt5/qtgui/images/qcolor-rgb.png
  5009. share/doc/qt5/qtgui/images/qcolor-saturation.png
  5010. share/doc/qt5/qtgui/images/qcolor-value.png
  5011. share/doc/qt5/qtgui/images/qconicalgradient.png
  5012. share/doc/qt5/qtgui/images/qgradient-conical.png
  5013. share/doc/qt5/qtgui/images/qgradient-linear.png
  5014. share/doc/qt5/qtgui/images/qgradient-radial.png
  5015. share/doc/qt5/qtgui/images/qimage-32bit_scaled.png
  5016. share/doc/qt5/qtgui/images/qimage-8bit_scaled.png
  5017. share/doc/qt5/qtgui/images/qimage-scaling.png
  5018. share/doc/qt5/qtgui/images/qlineargradient-pad.png
  5019. share/doc/qt5/qtgui/images/qlineargradient-reflect.png
  5020. share/doc/qt5/qtgui/images/qlineargradient-repeat.png
  5021. share/doc/qt5/qtgui/images/qmatrix-combinedtransformation.png
  5022. share/doc/qt5/qtgui/images/qmatrix-representation.png
  5023. share/doc/qt5/qtgui/images/qmatrix-simpletransformation.png
  5024. share/doc/qt5/qtgui/images/qpainter-affinetransformations.png
  5025. share/doc/qt5/qtgui/images/qpainter-arc.png
  5026. share/doc/qt5/qtgui/images/qpainter-basicdrawing.png
  5027. share/doc/qt5/qtgui/images/qpainter-chord.png
  5028. share/doc/qt5/qtgui/images/qpainter-clock.png
  5029. share/doc/qt5/qtgui/images/qpainter-compositiondemo.png
  5030. share/doc/qt5/qtgui/images/qpainter-compositionmode1.png
  5031. share/doc/qt5/qtgui/images/qpainter-compositionmode2.png
  5032. share/doc/qt5/qtgui/images/qpainter-concentriccircles.png
  5033. share/doc/qt5/qtgui/images/qpainter-ellipse.png
  5034. share/doc/qt5/qtgui/images/qpainter-gradients.png
  5035. share/doc/qt5/qtgui/images/qpainter-line.png
  5036. share/doc/qt5/qtgui/images/qpainter-painterpaths.png
  5037. share/doc/qt5/qtgui/images/qpainter-path.png
  5038. share/doc/qt5/qtgui/images/qpainter-pathstroking.png
  5039. share/doc/qt5/qtgui/images/qpainter-pie.png
  5040. share/doc/qt5/qtgui/images/qpainter-polygon.png
  5041. share/doc/qt5/qtgui/images/qpainter-rectangle.png
  5042. share/doc/qt5/qtgui/images/qpainter-rotation.png
  5043. share/doc/qt5/qtgui/images/qpainter-roundrect.png
  5044. share/doc/qt5/qtgui/images/qpainter-scale.png
  5045. share/doc/qt5/qtgui/images/qpainter-text-bounds.png
  5046. share/doc/qt5/qtgui/images/qpainter-text.png
  5047. share/doc/qt5/qtgui/images/qpainter-translation.png
  5048. share/doc/qt5/qtgui/images/qpainter-vectordeformation.png
  5049. share/doc/qt5/qtgui/images/qpainterpath-addellipse.png
  5050. share/doc/qt5/qtgui/images/qpainterpath-addpolygon.png
  5051. share/doc/qt5/qtgui/images/qpainterpath-addrectangle.png
  5052. share/doc/qt5/qtgui/images/qpainterpath-addtext.png
  5053. share/doc/qt5/qtgui/images/qpainterpath-arcto.png
  5054. share/doc/qt5/qtgui/images/qpainterpath-construction.png
  5055. share/doc/qt5/qtgui/images/qpainterpath-cubicto.png
  5056. share/doc/qt5/qtgui/images/qpainterpath-demo.png
  5057. share/doc/qt5/qtgui/images/qpainterpath-example.png
  5058. share/doc/qt5/qtgui/images/qpen-bevel.png
  5059. share/doc/qt5/qtgui/images/qpen-custom.png
  5060. share/doc/qt5/qtgui/images/qpen-dash.png
  5061. share/doc/qt5/qtgui/images/qpen-dashdot.png
  5062. share/doc/qt5/qtgui/images/qpen-dashdotdot.png
  5063. share/doc/qt5/qtgui/images/qpen-dashpattern.png
  5064. share/doc/qt5/qtgui/images/qpen-demo.png
  5065. share/doc/qt5/qtgui/images/qpen-dot.png
  5066. share/doc/qt5/qtgui/images/qpen-flat.png
  5067. share/doc/qt5/qtgui/images/qpen-miter.png
  5068. share/doc/qt5/qtgui/images/qpen-miterlimit.png
  5069. share/doc/qt5/qtgui/images/qpen-roundcap.png
  5070. share/doc/qt5/qtgui/images/qpen-roundjoin.png
  5071. share/doc/qt5/qtgui/images/qpen-solid.png
  5072. share/doc/qt5/qtgui/images/qpen-square.png
  5073. share/doc/qt5/qtgui/images/qpixelformat-argb32buffer.png
  5074. share/doc/qt5/qtgui/images/qradialgradient-pad.png
  5075. share/doc/qt5/qtgui/images/qradialgradient-reflect.png
  5076. share/doc/qt5/qtgui/images/qradialgradient-repeat.png
  5077. share/doc/qt5/qtgui/images/qrect-diagram-zero.png
  5078. share/doc/qt5/qtgui/images/qrectf-diagram-one.png
  5079. share/doc/qt5/qtgui/images/qrectf-diagram-three.png
  5080. share/doc/qt5/qtgui/images/qrectf-diagram-two.png
  5081. share/doc/qt5/qtgui/images/qstatustipevent-action.png
  5082. share/doc/qt5/qtgui/images/qstatustipevent-widget.png
  5083. share/doc/qt5/qtgui/images/qt-colors.png
  5084. share/doc/qt5/qtgui/images/qt-fillrule-oddeven.png
  5085. share/doc/qt5/qtgui/images/qt-fillrule-winding.png
  5086. share/doc/qt5/qtgui/images/qtabletevent-tilt.png
  5087. share/doc/qt5/qtgui/images/qtextblock-sequence.png
  5088. share/doc/qt5/qtgui/images/qtextfragment-split.png
  5089. share/doc/qt5/qtgui/images/qtextframe-style.png
  5090. share/doc/qt5/qtgui/images/qtexttableformat-cell.png
  5091. share/doc/qt5/qtgui/images/qtransform-combinedtransformation.png
  5092. share/doc/qt5/qtgui/images/qtransform-combinedtransformation2.png
  5093. share/doc/qt5/qtgui/images/qtransform-representation.png
  5094. share/doc/qt5/qtgui/images/qtransform-simpletransformation.png
  5095. share/doc/qt5/qtgui/images/richtext-document.png
  5096. share/doc/qt5/qtgui/images/rintersect.png
  5097. share/doc/qt5/qtgui/images/rsubtract.png
  5098. share/doc/qt5/qtgui/images/runion.png
  5099. share/doc/qt5/qtgui/images/rxor.png
  5100. share/doc/qt5/qtgui/images/texttable-merge.png
  5101. share/doc/qt5/qtgui/images/texttable-split.png
  5102. share/doc/qt5/qtgui/images/touchpoint-metrics.png
  5103. share/doc/qt5/qtgui/painting-3d.html
  5104. share/doc/qt5/qtgui/painting.html
  5105. share/doc/qt5/qtgui/paintsystem-devices.html
  5106. share/doc/qt5/qtgui/paintsystem-drawing.html
  5107. share/doc/qt5/qtgui/paintsystem-images.html
  5108. share/doc/qt5/qtgui/paintsystem.html
  5109. share/doc/qt5/qtgui/qabstractopenglfunctions-members.html
  5110. share/doc/qt5/qtgui/qabstractopenglfunctions.html
  5111. share/doc/qt5/qtgui/qabstracttextdocumentlayout-members.html
  5112. share/doc/qt5/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
  5113. share/doc/qt5/qtgui/qabstracttextdocumentlayout-paintcontext.html
  5114. share/doc/qt5/qtgui/qabstracttextdocumentlayout-selection-members.html
  5115. share/doc/qt5/qtgui/qabstracttextdocumentlayout-selection.html
  5116. share/doc/qt5/qtgui/qabstracttextdocumentlayout.html
  5117. share/doc/qt5/qtgui/qaccessible-members.html
  5118. share/doc/qt5/qtgui/qaccessible-obsolete.html
  5119. share/doc/qt5/qtgui/qaccessible-state-members.html
  5120. share/doc/qt5/qtgui/qaccessible-state.html
  5121. share/doc/qt5/qtgui/qaccessible.html
  5122. share/doc/qt5/qtgui/qaccessibleactioninterface-members.html
  5123. share/doc/qt5/qtgui/qaccessibleactioninterface.html
  5124. share/doc/qt5/qtgui/qaccessibleeditabletextinterface-members.html
  5125. share/doc/qt5/qtgui/qaccessibleeditabletextinterface.html
  5126. share/doc/qt5/qtgui/qaccessibleevent-members.html
  5127. share/doc/qt5/qtgui/qaccessibleevent.html
  5128. share/doc/qt5/qtgui/qaccessibleinterface-members.html
  5129. share/doc/qt5/qtgui/qaccessibleinterface.html
  5130. share/doc/qt5/qtgui/qaccessibleobject-members.html
  5131. share/doc/qt5/qtgui/qaccessibleobject.html
  5132. share/doc/qt5/qtgui/qaccessibleplugin-members.html
  5133. share/doc/qt5/qtgui/qaccessibleplugin.html
  5134. share/doc/qt5/qtgui/qaccessiblestatechangeevent-members.html
  5135. share/doc/qt5/qtgui/qaccessiblestatechangeevent.html
  5136. share/doc/qt5/qtgui/qaccessibletablecellinterface-members.html
  5137. share/doc/qt5/qtgui/qaccessibletablecellinterface.html
  5138. share/doc/qt5/qtgui/qaccessibletableinterface-members.html
  5139. share/doc/qt5/qtgui/qaccessibletableinterface.html
  5140. share/doc/qt5/qtgui/qaccessibletablemodelchangeevent-members.html
  5141. share/doc/qt5/qtgui/qaccessibletablemodelchangeevent.html
  5142. share/doc/qt5/qtgui/qaccessibletextcursorevent-members.html
  5143. share/doc/qt5/qtgui/qaccessibletextcursorevent.html
  5144. share/doc/qt5/qtgui/qaccessibletextinsertevent-members.html
  5145. share/doc/qt5/qtgui/qaccessibletextinsertevent.html
  5146. share/doc/qt5/qtgui/qaccessibletextinterface-members.html
  5147. share/doc/qt5/qtgui/qaccessibletextinterface.html
  5148. share/doc/qt5/qtgui/qaccessibletextremoveevent-members.html
  5149. share/doc/qt5/qtgui/qaccessibletextremoveevent.html
  5150. share/doc/qt5/qtgui/qaccessibletextselectionevent-members.html
  5151. share/doc/qt5/qtgui/qaccessibletextselectionevent.html
  5152. share/doc/qt5/qtgui/qaccessibletextupdateevent-members.html
  5153. share/doc/qt5/qtgui/qaccessibletextupdateevent.html
  5154. share/doc/qt5/qtgui/qaccessiblevaluechangeevent-members.html
  5155. share/doc/qt5/qtgui/qaccessiblevaluechangeevent.html
  5156. share/doc/qt5/qtgui/qaccessiblevalueinterface-members.html
  5157. share/doc/qt5/qtgui/qaccessiblevalueinterface.html
  5158. share/doc/qt5/qtgui/qactionevent-members.html
  5159. share/doc/qt5/qtgui/qactionevent.html
  5160. share/doc/qt5/qtgui/qbackingstore-members.html
  5161. share/doc/qt5/qtgui/qbackingstore.html
  5162. share/doc/qt5/qtgui/qbitmap-members.html
  5163. share/doc/qt5/qtgui/qbitmap-obsolete.html
  5164. share/doc/qt5/qtgui/qbitmap.html
  5165. share/doc/qt5/qtgui/qbrush-members.html
  5166. share/doc/qt5/qtgui/qbrush.html
  5167. share/doc/qt5/qtgui/qclipboard-members.html
  5168. share/doc/qt5/qtgui/qclipboard.html
  5169. share/doc/qt5/qtgui/qcloseevent-members.html
  5170. share/doc/qt5/qtgui/qcloseevent.html
  5171. share/doc/qt5/qtgui/qcolor-members.html
  5172. share/doc/qt5/qtgui/qcolor-obsolete.html
  5173. share/doc/qt5/qtgui/qcolor.html
  5174. share/doc/qt5/qtgui/qconicalgradient-members.html
  5175. share/doc/qt5/qtgui/qconicalgradient.html
  5176. share/doc/qt5/qtgui/qcontextmenuevent-members.html
  5177. share/doc/qt5/qtgui/qcontextmenuevent.html
  5178. share/doc/qt5/qtgui/qcursor-members.html
  5179. share/doc/qt5/qtgui/qcursor.html
  5180. share/doc/qt5/qtgui/qdesktopservices-members.html
  5181. share/doc/qt5/qtgui/qdesktopservices-obsolete.html
  5182. share/doc/qt5/qtgui/qdesktopservices.html
  5183. share/doc/qt5/qtgui/qdoublevalidator-members.html
  5184. share/doc/qt5/qtgui/qdoublevalidator.html
  5185. share/doc/qt5/qtgui/qdrag-members.html
  5186. share/doc/qt5/qtgui/qdrag-obsolete.html
  5187. share/doc/qt5/qtgui/qdrag.html
  5188. share/doc/qt5/qtgui/qdragenterevent-members.html
  5189. share/doc/qt5/qtgui/qdragenterevent.html
  5190. share/doc/qt5/qtgui/qdragleaveevent-members.html
  5191. share/doc/qt5/qtgui/qdragleaveevent.html
  5192. share/doc/qt5/qtgui/qdragmoveevent-members.html
  5193. share/doc/qt5/qtgui/qdragmoveevent.html
  5194. share/doc/qt5/qtgui/qdropevent-members.html
  5195. share/doc/qt5/qtgui/qdropevent.html
  5196. share/doc/qt5/qtgui/qenterevent-members.html
  5197. share/doc/qt5/qtgui/qenterevent.html
  5198. share/doc/qt5/qtgui/qexposeevent-members.html
  5199. share/doc/qt5/qtgui/qexposeevent.html
  5200. share/doc/qt5/qtgui/qfileopenevent-members.html
  5201. share/doc/qt5/qtgui/qfileopenevent.html
  5202. share/doc/qt5/qtgui/qfocusevent-members.html
  5203. share/doc/qt5/qtgui/qfocusevent.html
  5204. share/doc/qt5/qtgui/qfont-members.html
  5205. share/doc/qt5/qtgui/qfont-obsolete.html
  5206. share/doc/qt5/qtgui/qfont.html
  5207. share/doc/qt5/qtgui/qfontdatabase-members.html
  5208. share/doc/qt5/qtgui/qfontdatabase-obsolete.html
  5209. share/doc/qt5/qtgui/qfontdatabase.html
  5210. share/doc/qt5/qtgui/qfontinfo-members.html
  5211. share/doc/qt5/qtgui/qfontinfo-obsolete.html
  5212. share/doc/qt5/qtgui/qfontinfo.html
  5213. share/doc/qt5/qtgui/qfontmetrics-members.html
  5214. share/doc/qt5/qtgui/qfontmetrics-obsolete.html
  5215. share/doc/qt5/qtgui/qfontmetrics.html
  5216. share/doc/qt5/qtgui/qfontmetricsf-members.html
  5217. share/doc/qt5/qtgui/qfontmetricsf.html
  5218. share/doc/qt5/qtgui/qgenericmatrix-members.html
  5219. share/doc/qt5/qtgui/qgenericmatrix.html
  5220. share/doc/qt5/qtgui/qgenericplugin-members.html
  5221. share/doc/qt5/qtgui/qgenericplugin.html
  5222. share/doc/qt5/qtgui/qgenericpluginfactory-members.html
  5223. share/doc/qt5/qtgui/qgenericpluginfactory.html
  5224. share/doc/qt5/qtgui/qglyphrun-members.html
  5225. share/doc/qt5/qtgui/qglyphrun.html
  5226. share/doc/qt5/qtgui/qgradient-members.html
  5227. share/doc/qt5/qtgui/qgradient.html
  5228. share/doc/qt5/qtgui/qguiapplication-members.html
  5229. share/doc/qt5/qtgui/qguiapplication.html
  5230. share/doc/qt5/qtgui/qhelpevent-members.html
  5231. share/doc/qt5/qtgui/qhelpevent.html
  5232. share/doc/qt5/qtgui/qhideevent-members.html
  5233. share/doc/qt5/qtgui/qhideevent.html
  5234. share/doc/qt5/qtgui/qhoverevent-members.html
  5235. share/doc/qt5/qtgui/qhoverevent.html
  5236. share/doc/qt5/qtgui/qicon-members.html
  5237. share/doc/qt5/qtgui/qicon-obsolete.html
  5238. share/doc/qt5/qtgui/qicon.html
  5239. share/doc/qt5/qtgui/qicondragevent-members.html
  5240. share/doc/qt5/qtgui/qicondragevent.html
  5241. share/doc/qt5/qtgui/qiconengine-availablesizesargument-members.html
  5242. share/doc/qt5/qtgui/qiconengine-availablesizesargument.html
  5243. share/doc/qt5/qtgui/qiconengine-members.html
  5244. share/doc/qt5/qtgui/qiconengine-scaledpixmapargument-members.html
  5245. share/doc/qt5/qtgui/qiconengine-scaledpixmapargument.html
  5246. share/doc/qt5/qtgui/qiconengine.html
  5247. share/doc/qt5/qtgui/qiconengineplugin-members.html
  5248. share/doc/qt5/qtgui/qiconengineplugin.html
  5249. share/doc/qt5/qtgui/qimage-members.html
  5250. share/doc/qt5/qtgui/qimage-obsolete.html
  5251. share/doc/qt5/qtgui/qimage.html
  5252. share/doc/qt5/qtgui/qimageiohandler-members.html
  5253. share/doc/qt5/qtgui/qimageiohandler-obsolete.html
  5254. share/doc/qt5/qtgui/qimageiohandler.html
  5255. share/doc/qt5/qtgui/qimageioplugin-members.html
  5256. share/doc/qt5/qtgui/qimageioplugin.html
  5257. share/doc/qt5/qtgui/qimagereader-members.html
  5258. share/doc/qt5/qtgui/qimagereader.html
  5259. share/doc/qt5/qtgui/qimagewriter-members.html
  5260. share/doc/qt5/qtgui/qimagewriter-obsolete.html
  5261. share/doc/qt5/qtgui/qimagewriter.html
  5262. share/doc/qt5/qtgui/qinputevent-members.html
  5263. share/doc/qt5/qtgui/qinputevent.html
  5264. share/doc/qt5/qtgui/qinputmethod-members.html
  5265. share/doc/qt5/qtgui/qinputmethod.html
  5266. share/doc/qt5/qtgui/qinputmethodevent-attribute-members.html
  5267. share/doc/qt5/qtgui/qinputmethodevent-attribute.html
  5268. share/doc/qt5/qtgui/qinputmethodevent-members.html
  5269. share/doc/qt5/qtgui/qinputmethodevent.html
  5270. share/doc/qt5/qtgui/qinputmethodqueryevent-members.html
  5271. share/doc/qt5/qtgui/qinputmethodqueryevent.html
  5272. share/doc/qt5/qtgui/qintvalidator-members.html
  5273. share/doc/qt5/qtgui/qintvalidator.html
  5274. share/doc/qt5/qtgui/qkeyevent-members.html
  5275. share/doc/qt5/qtgui/qkeyevent.html
  5276. share/doc/qt5/qtgui/qkeysequence-members.html
  5277. share/doc/qt5/qtgui/qkeysequence-obsolete.html
  5278. share/doc/qt5/qtgui/qkeysequence.html
  5279. share/doc/qt5/qtgui/qlineargradient-members.html
  5280. share/doc/qt5/qtgui/qlineargradient.html
  5281. share/doc/qt5/qtgui/qmatrix-members.html
  5282. share/doc/qt5/qtgui/qmatrix.html
  5283. share/doc/qt5/qtgui/qmatrix4x4-members.html
  5284. share/doc/qt5/qtgui/qmatrix4x4-obsolete.html
  5285. share/doc/qt5/qtgui/qmatrix4x4.html
  5286. share/doc/qt5/qtgui/qmouseevent-members.html
  5287. share/doc/qt5/qtgui/qmouseevent-obsolete.html
  5288. share/doc/qt5/qtgui/qmouseevent.html
  5289. share/doc/qt5/qtgui/qmoveevent-members.html
  5290. share/doc/qt5/qtgui/qmoveevent.html
  5291. share/doc/qt5/qtgui/qmovie-members.html
  5292. share/doc/qt5/qtgui/qmovie.html
  5293. share/doc/qt5/qtgui/qnativegestureevent-members.html
  5294. share/doc/qt5/qtgui/qnativegestureevent.html
  5295. share/doc/qt5/qtgui/qoffscreensurface-members.html
  5296. share/doc/qt5/qtgui/qoffscreensurface.html
  5297. share/doc/qt5/qtgui/qopenglbuffer-members.html
  5298. share/doc/qt5/qtgui/qopenglbuffer.html
  5299. share/doc/qt5/qtgui/qopenglcontext-members.html
  5300. share/doc/qt5/qtgui/qopenglcontext.html
  5301. share/doc/qt5/qtgui/qopenglcontextgroup-members.html
  5302. share/doc/qt5/qtgui/qopenglcontextgroup.html
  5303. share/doc/qt5/qtgui/qopengldebuglogger-members.html
  5304. share/doc/qt5/qtgui/qopengldebuglogger.html
  5305. share/doc/qt5/qtgui/qopengldebugmessage-members.html
  5306. share/doc/qt5/qtgui/qopengldebugmessage.html
  5307. share/doc/qt5/qtgui/qopenglextrafunctions-members.html
  5308. share/doc/qt5/qtgui/qopenglextrafunctions.html
  5309. share/doc/qt5/qtgui/qopenglframebufferobject-members.html
  5310. share/doc/qt5/qtgui/qopenglframebufferobject.html
  5311. share/doc/qt5/qtgui/qopenglframebufferobjectformat-members.html
  5312. share/doc/qt5/qtgui/qopenglframebufferobjectformat.html
  5313. share/doc/qt5/qtgui/qopenglfunctions-1-0-members.html
  5314. share/doc/qt5/qtgui/qopenglfunctions-1-0.html
  5315. share/doc/qt5/qtgui/qopenglfunctions-1-1-members.html
  5316. share/doc/qt5/qtgui/qopenglfunctions-1-1.html
  5317. share/doc/qt5/qtgui/qopenglfunctions-1-2-members.html
  5318. share/doc/qt5/qtgui/qopenglfunctions-1-2.html
  5319. share/doc/qt5/qtgui/qopenglfunctions-1-3-members.html
  5320. share/doc/qt5/qtgui/qopenglfunctions-1-3.html
  5321. share/doc/qt5/qtgui/qopenglfunctions-1-4-members.html
  5322. share/doc/qt5/qtgui/qopenglfunctions-1-4.html
  5323. share/doc/qt5/qtgui/qopenglfunctions-1-5-members.html
  5324. share/doc/qt5/qtgui/qopenglfunctions-1-5.html
  5325. share/doc/qt5/qtgui/qopenglfunctions-2-0-members.html
  5326. share/doc/qt5/qtgui/qopenglfunctions-2-0.html
  5327. share/doc/qt5/qtgui/qopenglfunctions-2-1-members.html
  5328. share/doc/qt5/qtgui/qopenglfunctions-2-1.html
  5329. share/doc/qt5/qtgui/qopenglfunctions-3-0-members.html
  5330. share/doc/qt5/qtgui/qopenglfunctions-3-0.html
  5331. share/doc/qt5/qtgui/qopenglfunctions-3-1-members.html
  5332. share/doc/qt5/qtgui/qopenglfunctions-3-1.html
  5333. share/doc/qt5/qtgui/qopenglfunctions-3-2-compatibility-members.html
  5334. share/doc/qt5/qtgui/qopenglfunctions-3-2-compatibility.html
  5335. share/doc/qt5/qtgui/qopenglfunctions-3-2-core-members.html
  5336. share/doc/qt5/qtgui/qopenglfunctions-3-2-core.html
  5337. share/doc/qt5/qtgui/qopenglfunctions-3-3-compatibility-members.html
  5338. share/doc/qt5/qtgui/qopenglfunctions-3-3-compatibility.html
  5339. share/doc/qt5/qtgui/qopenglfunctions-3-3-core-members.html
  5340. share/doc/qt5/qtgui/qopenglfunctions-3-3-core.html
  5341. share/doc/qt5/qtgui/qopenglfunctions-4-0-compatibility-members.html
  5342. share/doc/qt5/qtgui/qopenglfunctions-4-0-compatibility.html
  5343. share/doc/qt5/qtgui/qopenglfunctions-4-0-core-members.html
  5344. share/doc/qt5/qtgui/qopenglfunctions-4-0-core.html
  5345. share/doc/qt5/qtgui/qopenglfunctions-4-1-compatibility-members.html
  5346. share/doc/qt5/qtgui/qopenglfunctions-4-1-compatibility.html
  5347. share/doc/qt5/qtgui/qopenglfunctions-4-1-core-members.html
  5348. share/doc/qt5/qtgui/qopenglfunctions-4-1-core.html
  5349. share/doc/qt5/qtgui/qopenglfunctions-4-2-compatibility-members.html
  5350. share/doc/qt5/qtgui/qopenglfunctions-4-2-compatibility.html
  5351. share/doc/qt5/qtgui/qopenglfunctions-4-2-core-members.html
  5352. share/doc/qt5/qtgui/qopenglfunctions-4-2-core.html
  5353. share/doc/qt5/qtgui/qopenglfunctions-4-3-compatibility-members.html
  5354. share/doc/qt5/qtgui/qopenglfunctions-4-3-compatibility.html
  5355. share/doc/qt5/qtgui/qopenglfunctions-4-3-core-members.html
  5356. share/doc/qt5/qtgui/qopenglfunctions-4-3-core.html
  5357. share/doc/qt5/qtgui/qopenglfunctions-4-4-compatibility-members.html
  5358. share/doc/qt5/qtgui/qopenglfunctions-4-4-compatibility.html
  5359. share/doc/qt5/qtgui/qopenglfunctions-4-4-core-members.html
  5360. share/doc/qt5/qtgui/qopenglfunctions-4-4-core.html
  5361. share/doc/qt5/qtgui/qopenglfunctions-4-5-compatibility-members.html
  5362. share/doc/qt5/qtgui/qopenglfunctions-4-5-compatibility.html
  5363. share/doc/qt5/qtgui/qopenglfunctions-4-5-core-members.html
  5364. share/doc/qt5/qtgui/qopenglfunctions-4-5-core.html
  5365. share/doc/qt5/qtgui/qopenglfunctions-es2-members.html
  5366. share/doc/qt5/qtgui/qopenglfunctions-es2.html
  5367. share/doc/qt5/qtgui/qopenglfunctions-members.html
  5368. share/doc/qt5/qtgui/qopenglfunctions-obsolete.html
  5369. share/doc/qt5/qtgui/qopenglfunctions.html
  5370. share/doc/qt5/qtgui/qopenglpaintdevice-members.html
  5371. share/doc/qt5/qtgui/qopenglpaintdevice.html
  5372. share/doc/qt5/qtgui/qopenglpixeltransferoptions-members.html
  5373. share/doc/qt5/qtgui/qopenglpixeltransferoptions.html
  5374. share/doc/qt5/qtgui/qopenglshader-members.html
  5375. share/doc/qt5/qtgui/qopenglshader.html
  5376. share/doc/qt5/qtgui/qopenglshaderprogram-members.html
  5377. share/doc/qt5/qtgui/qopenglshaderprogram.html
  5378. share/doc/qt5/qtgui/qopengltexture-members.html
  5379. share/doc/qt5/qtgui/qopengltexture-obsolete.html
  5380. share/doc/qt5/qtgui/qopengltexture.html
  5381. share/doc/qt5/qtgui/qopengltextureblitter-members.html
  5382. share/doc/qt5/qtgui/qopengltextureblitter.html
  5383. share/doc/qt5/qtgui/qopengltimemonitor-members.html
  5384. share/doc/qt5/qtgui/qopengltimemonitor.html
  5385. share/doc/qt5/qtgui/qopengltimerquery-members.html
  5386. share/doc/qt5/qtgui/qopengltimerquery.html
  5387. share/doc/qt5/qtgui/qopenglversionprofile-members.html
  5388. share/doc/qt5/qtgui/qopenglversionprofile.html
  5389. share/doc/qt5/qtgui/qopenglvertexarrayobject-binder-members.html
  5390. share/doc/qt5/qtgui/qopenglvertexarrayobject-binder.html
  5391. share/doc/qt5/qtgui/qopenglvertexarrayobject-members.html
  5392. share/doc/qt5/qtgui/qopenglvertexarrayobject.html
  5393. share/doc/qt5/qtgui/qopenglwindow-members.html
  5394. share/doc/qt5/qtgui/qopenglwindow.html
  5395. share/doc/qt5/qtgui/qpagedpaintdevice-margins-members.html
  5396. share/doc/qt5/qtgui/qpagedpaintdevice-margins.html
  5397. share/doc/qt5/qtgui/qpagedpaintdevice-members.html
  5398. share/doc/qt5/qtgui/qpagedpaintdevice.html
  5399. share/doc/qt5/qtgui/qpagelayout-members.html
  5400. share/doc/qt5/qtgui/qpagelayout.html
  5401. share/doc/qt5/qtgui/qpagesize-members.html
  5402. share/doc/qt5/qtgui/qpagesize.html
  5403. share/doc/qt5/qtgui/qpaintdevice-members.html
  5404. share/doc/qt5/qtgui/qpaintdevice.html
  5405. share/doc/qt5/qtgui/qpaintdevicewindow-members.html
  5406. share/doc/qt5/qtgui/qpaintdevicewindow.html
  5407. share/doc/qt5/qtgui/qpaintengine-members.html
  5408. share/doc/qt5/qtgui/qpaintengine.html
  5409. share/doc/qt5/qtgui/qpaintenginestate-members.html
  5410. share/doc/qt5/qtgui/qpaintenginestate-obsolete.html
  5411. share/doc/qt5/qtgui/qpaintenginestate.html
  5412. share/doc/qt5/qtgui/qpainter-members.html
  5413. share/doc/qt5/qtgui/qpainter-obsolete.html
  5414. share/doc/qt5/qtgui/qpainter-pixmapfragment-members.html
  5415. share/doc/qt5/qtgui/qpainter-pixmapfragment.html
  5416. share/doc/qt5/qtgui/qpainter.html
  5417. share/doc/qt5/qtgui/qpainterpath-element-members.html
  5418. share/doc/qt5/qtgui/qpainterpath-element.html
  5419. share/doc/qt5/qtgui/qpainterpath-members.html
  5420. share/doc/qt5/qtgui/qpainterpath-obsolete.html
  5421. share/doc/qt5/qtgui/qpainterpath.html
  5422. share/doc/qt5/qtgui/qpainterpathstroker-members.html
  5423. share/doc/qt5/qtgui/qpainterpathstroker.html
  5424. share/doc/qt5/qtgui/qpaintevent-members.html
  5425. share/doc/qt5/qtgui/qpaintevent.html
  5426. share/doc/qt5/qtgui/qpalette-members.html
  5427. share/doc/qt5/qtgui/qpalette-obsolete.html
  5428. share/doc/qt5/qtgui/qpalette.html
  5429. share/doc/qt5/qtgui/qpdfwriter-members.html
  5430. share/doc/qt5/qtgui/qpdfwriter-obsolete.html
  5431. share/doc/qt5/qtgui/qpdfwriter.html
  5432. share/doc/qt5/qtgui/qpen-members.html
  5433. share/doc/qt5/qtgui/qpen.html
  5434. share/doc/qt5/qtgui/qpicture-members.html
  5435. share/doc/qt5/qtgui/qpicture-obsolete.html
  5436. share/doc/qt5/qtgui/qpicture.html
  5437. share/doc/qt5/qtgui/qpictureformatplugin-members.html
  5438. share/doc/qt5/qtgui/qpictureformatplugin.html
  5439. share/doc/qt5/qtgui/qpictureio-members.html
  5440. share/doc/qt5/qtgui/qpictureio.html
  5441. share/doc/qt5/qtgui/qpixelformat-members.html
  5442. share/doc/qt5/qtgui/qpixelformat.html
  5443. share/doc/qt5/qtgui/qpixmap-members.html
  5444. share/doc/qt5/qtgui/qpixmap-obsolete.html
  5445. share/doc/qt5/qtgui/qpixmap.html
  5446. share/doc/qt5/qtgui/qpixmapcache-key-members.html
  5447. share/doc/qt5/qtgui/qpixmapcache-key.html
  5448. share/doc/qt5/qtgui/qpixmapcache-keydata-members.html
  5449. share/doc/qt5/qtgui/qpixmapcache-keydata.html
  5450. share/doc/qt5/qtgui/qpixmapcache-members.html
  5451. share/doc/qt5/qtgui/qpixmapcache-obsolete.html
  5452. share/doc/qt5/qtgui/qpixmapcache.html
  5453. share/doc/qt5/qtgui/qplatformsurfaceevent-members.html
  5454. share/doc/qt5/qtgui/qplatformsurfaceevent.html
  5455. share/doc/qt5/qtgui/qpointingdeviceuniqueid-members.html
  5456. share/doc/qt5/qtgui/qpointingdeviceuniqueid.html
  5457. share/doc/qt5/qtgui/qpolygon-members.html
  5458. share/doc/qt5/qtgui/qpolygon.html
  5459. share/doc/qt5/qtgui/qpolygonf-members.html
  5460. share/doc/qt5/qtgui/qpolygonf.html
  5461. share/doc/qt5/qtgui/qquaternion-members.html
  5462. share/doc/qt5/qtgui/qquaternion-obsolete.html
  5463. share/doc/qt5/qtgui/qquaternion.html
  5464. share/doc/qt5/qtgui/qradialgradient-members.html
  5465. share/doc/qt5/qtgui/qradialgradient.html
  5466. share/doc/qt5/qtgui/qrasterpaintengine-members.html
  5467. share/doc/qt5/qtgui/qrasterpaintengine.html
  5468. share/doc/qt5/qtgui/qrasterwindow-members.html
  5469. share/doc/qt5/qtgui/qrasterwindow.html
  5470. share/doc/qt5/qtgui/qrawfont-members.html
  5471. share/doc/qt5/qtgui/qrawfont.html
  5472. share/doc/qt5/qtgui/qregexpvalidator-members.html
  5473. share/doc/qt5/qtgui/qregexpvalidator.html
  5474. share/doc/qt5/qtgui/qregion-members.html
  5475. share/doc/qt5/qtgui/qregion-obsolete.html
  5476. share/doc/qt5/qtgui/qregion.html
  5477. share/doc/qt5/qtgui/qregularexpressionvalidator-members.html
  5478. share/doc/qt5/qtgui/qregularexpressionvalidator.html
  5479. share/doc/qt5/qtgui/qresizeevent-members.html
  5480. share/doc/qt5/qtgui/qresizeevent.html
  5481. share/doc/qt5/qtgui/qrgba64-members.html
  5482. share/doc/qt5/qtgui/qrgba64.html
  5483. share/doc/qt5/qtgui/qscreen-members.html
  5484. share/doc/qt5/qtgui/qscreen.html
  5485. share/doc/qt5/qtgui/qscrollevent-members.html
  5486. share/doc/qt5/qtgui/qscrollevent.html
  5487. share/doc/qt5/qtgui/qscrollprepareevent-members.html
  5488. share/doc/qt5/qtgui/qscrollprepareevent.html
  5489. share/doc/qt5/qtgui/qsessionmanager-members.html
  5490. share/doc/qt5/qtgui/qsessionmanager.html
  5491. share/doc/qt5/qtgui/qshortcutevent-members.html
  5492. share/doc/qt5/qtgui/qshortcutevent.html
  5493. share/doc/qt5/qtgui/qshowevent-members.html
  5494. share/doc/qt5/qtgui/qshowevent.html
  5495. share/doc/qt5/qtgui/qstandarditem-members.html
  5496. share/doc/qt5/qtgui/qstandarditem-obsolete.html
  5497. share/doc/qt5/qtgui/qstandarditem.html
  5498. share/doc/qt5/qtgui/qstandarditemmodel-members.html
  5499. share/doc/qt5/qtgui/qstandarditemmodel.html
  5500. share/doc/qt5/qtgui/qstatictext-members.html
  5501. share/doc/qt5/qtgui/qstatictext.html
  5502. share/doc/qt5/qtgui/qstatustipevent-members.html
  5503. share/doc/qt5/qtgui/qstatustipevent.html
  5504. share/doc/qt5/qtgui/qstylehints-members.html
  5505. share/doc/qt5/qtgui/qstylehints.html
  5506. share/doc/qt5/qtgui/qsupportedwritingsystems-members.html
  5507. share/doc/qt5/qtgui/qsupportedwritingsystems.html
  5508. share/doc/qt5/qtgui/qsurface-members.html
  5509. share/doc/qt5/qtgui/qsurface.html
  5510. share/doc/qt5/qtgui/qsurfaceformat-members.html
  5511. share/doc/qt5/qtgui/qsurfaceformat-obsolete.html
  5512. share/doc/qt5/qtgui/qsurfaceformat.html
  5513. share/doc/qt5/qtgui/qsyntaxhighlighter-members.html
  5514. share/doc/qt5/qtgui/qsyntaxhighlighter.html
  5515. share/doc/qt5/qtgui/qtabletevent-members.html
  5516. share/doc/qt5/qtgui/qtabletevent-obsolete.html
  5517. share/doc/qt5/qtgui/qtabletevent.html
  5518. share/doc/qt5/qtgui/qtextblock-iterator-members.html
  5519. share/doc/qt5/qtgui/qtextblock-iterator.html
  5520. share/doc/qt5/qtgui/qtextblock-members.html
  5521. share/doc/qt5/qtgui/qtextblock.html
  5522. share/doc/qt5/qtgui/qtextblockformat-members.html
  5523. share/doc/qt5/qtgui/qtextblockformat.html
  5524. share/doc/qt5/qtgui/qtextblockgroup-members.html
  5525. share/doc/qt5/qtgui/qtextblockgroup.html
  5526. share/doc/qt5/qtgui/qtextblockuserdata-members.html
  5527. share/doc/qt5/qtgui/qtextblockuserdata.html
  5528. share/doc/qt5/qtgui/qtextcharformat-members.html
  5529. share/doc/qt5/qtgui/qtextcharformat-obsolete.html
  5530. share/doc/qt5/qtgui/qtextcharformat.html
  5531. share/doc/qt5/qtgui/qtextcursor-members.html
  5532. share/doc/qt5/qtgui/qtextcursor.html
  5533. share/doc/qt5/qtgui/qtextdocument-members.html
  5534. share/doc/qt5/qtgui/qtextdocument.html
  5535. share/doc/qt5/qtgui/qtextdocumentfragment-members.html
  5536. share/doc/qt5/qtgui/qtextdocumentfragment.html
  5537. share/doc/qt5/qtgui/qtextdocumentwriter-members.html
  5538. share/doc/qt5/qtgui/qtextdocumentwriter.html
  5539. share/doc/qt5/qtgui/qtextformat-members.html
  5540. share/doc/qt5/qtgui/qtextformat.html
  5541. share/doc/qt5/qtgui/qtextfragment-members.html
  5542. share/doc/qt5/qtgui/qtextfragment.html
  5543. share/doc/qt5/qtgui/qtextframe-iterator-members.html
  5544. share/doc/qt5/qtgui/qtextframe-iterator.html
  5545. share/doc/qt5/qtgui/qtextframe-members.html
  5546. share/doc/qt5/qtgui/qtextframe.html
  5547. share/doc/qt5/qtgui/qtextframeformat-members.html
  5548. share/doc/qt5/qtgui/qtextframeformat.html
  5549. share/doc/qt5/qtgui/qtextimageformat-members.html
  5550. share/doc/qt5/qtgui/qtextimageformat.html
  5551. share/doc/qt5/qtgui/qtextinlineobject-members.html
  5552. share/doc/qt5/qtgui/qtextinlineobject.html
  5553. share/doc/qt5/qtgui/qtextitem-members.html
  5554. share/doc/qt5/qtgui/qtextitem.html
  5555. share/doc/qt5/qtgui/qtextlayout-formatrange-members.html
  5556. share/doc/qt5/qtgui/qtextlayout-formatrange.html
  5557. share/doc/qt5/qtgui/qtextlayout-members.html
  5558. share/doc/qt5/qtgui/qtextlayout-obsolete.html
  5559. share/doc/qt5/qtgui/qtextlayout.html
  5560. share/doc/qt5/qtgui/qtextlength-members.html
  5561. share/doc/qt5/qtgui/qtextlength.html
  5562. share/doc/qt5/qtgui/qtextline-members.html
  5563. share/doc/qt5/qtgui/qtextline.html
  5564. share/doc/qt5/qtgui/qtextlist-members.html
  5565. share/doc/qt5/qtgui/qtextlist-obsolete.html
  5566. share/doc/qt5/qtgui/qtextlist.html
  5567. share/doc/qt5/qtgui/qtextlistformat-members.html
  5568. share/doc/qt5/qtgui/qtextlistformat.html
  5569. share/doc/qt5/qtgui/qtextobject-members.html
  5570. share/doc/qt5/qtgui/qtextobject.html
  5571. share/doc/qt5/qtgui/qtextobjectinterface-members.html
  5572. share/doc/qt5/qtgui/qtextobjectinterface.html
  5573. share/doc/qt5/qtgui/qtextoption-members.html
  5574. share/doc/qt5/qtgui/qtextoption-tab-members.html
  5575. share/doc/qt5/qtgui/qtextoption-tab.html
  5576. share/doc/qt5/qtgui/qtextoption.html
  5577. share/doc/qt5/qtgui/qtexttable-members.html
  5578. share/doc/qt5/qtgui/qtexttable.html
  5579. share/doc/qt5/qtgui/qtexttablecell-members.html
  5580. share/doc/qt5/qtgui/qtexttablecell.html
  5581. share/doc/qt5/qtgui/qtexttablecellformat-members.html
  5582. share/doc/qt5/qtgui/qtexttablecellformat.html
  5583. share/doc/qt5/qtgui/qtexttableformat-members.html
  5584. share/doc/qt5/qtgui/qtexttableformat.html
  5585. share/doc/qt5/qtgui/qtgui-analogclock-analogclock-pro.html
  5586. share/doc/qt5/qtgui/qtgui-analogclock-example.html
  5587. share/doc/qt5/qtgui/qtgui-analogclock-main-cpp.html
  5588. share/doc/qt5/qtgui/qtgui-attribution-android-native-style.html
  5589. share/doc/qt5/qtgui/qtgui-attribution-angle-arrayboundsclamper.html
  5590. share/doc/qt5/qtgui/qtgui-attribution-angle-murmurhash.html
  5591. share/doc/qt5/qtgui/qtgui-attribution-angle-systeminfo.html
  5592. share/doc/qt5/qtgui/qtgui-attribution-angle-trace-event.html
  5593. share/doc/qt5/qtgui/qtgui-attribution-angle.html
  5594. share/doc/qt5/qtgui/qtgui-attribution-cocoa-platform-plugin.html
  5595. share/doc/qt5/qtgui/qtgui-attribution-freetype-bdf.html
  5596. share/doc/qt5/qtgui/qtgui-attribution-freetype-pcf.html
  5597. share/doc/qt5/qtgui/qtgui-attribution-freetype-zlib.html
  5598. share/doc/qt5/qtgui/qtgui-attribution-freetype.html
  5599. share/doc/qt5/qtgui/qtgui-attribution-grayraster.html
  5600. share/doc/qt5/qtgui/qtgui-attribution-harfbuzz-ng.html
  5601. share/doc/qt5/qtgui/qtgui-attribution-harfbuzz.html
  5602. share/doc/qt5/qtgui/qtgui-attribution-iaccessible2.html
  5603. share/doc/qt5/qtgui/qtgui-attribution-libjpeg.html
  5604. share/doc/qt5/qtgui/qtgui-attribution-libpng.html
  5605. share/doc/qt5/qtgui/qtgui-attribution-opengl-es2-headers.html
  5606. share/doc/qt5/qtgui/qtgui-attribution-opengl-headers.html
  5607. share/doc/qt5/qtgui/qtgui-attribution-pixman.html
  5608. share/doc/qt5/qtgui/qtgui-attribution-smooth-scaling-algorithm.html
  5609. share/doc/qt5/qtgui/qtgui-attribution-wintab.html
  5610. share/doc/qt5/qtgui/qtgui-attribution-xcb.html
  5611. share/doc/qt5/qtgui/qtgui-attribution-xkbcommon.html
  5612. share/doc/qt5/qtgui/qtgui-index.html
  5613. share/doc/qt5/qtgui/qtgui-module.html
  5614. share/doc/qt5/qtgui/qtgui-openglwindow-example.html
  5615. share/doc/qt5/qtgui/qtgui-openglwindow-main-cpp.html
  5616. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-cpp.html
  5617. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-h.html
  5618. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-pro.html
  5619. share/doc/qt5/qtgui/qtgui-rasterwindow-example.html
  5620. share/doc/qt5/qtgui/qtgui-rasterwindow-main-cpp.html
  5621. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-cpp.html
  5622. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-h.html
  5623. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-pro.html
  5624. share/doc/qt5/qtgui/qtgui.index
  5625. share/doc/qt5/qtgui/qtgui.qhp
  5626. share/doc/qt5/qtgui/qtgui.qhp.sha1
  5627. share/doc/qt5/qtgui/qtgui.tags
  5628. share/doc/qt5/qtgui/qtouchdevice-members.html
  5629. share/doc/qt5/qtgui/qtouchdevice.html
  5630. share/doc/qt5/qtgui/qtouchevent-members.html
  5631. share/doc/qt5/qtgui/qtouchevent-obsolete.html
  5632. share/doc/qt5/qtgui/qtouchevent-touchpoint-members.html
  5633. share/doc/qt5/qtgui/qtouchevent-touchpoint-obsolete.html
  5634. share/doc/qt5/qtgui/qtouchevent-touchpoint.html
  5635. share/doc/qt5/qtgui/qtouchevent.html
  5636. share/doc/qt5/qtgui/qtransform-members.html
  5637. share/doc/qt5/qtgui/qtransform-obsolete.html
  5638. share/doc/qt5/qtgui/qtransform.html
  5639. share/doc/qt5/qtgui/qvalidator-members.html
  5640. share/doc/qt5/qtgui/qvalidator.html
  5641. share/doc/qt5/qtgui/qvector2d-members.html
  5642. share/doc/qt5/qtgui/qvector2d.html
  5643. share/doc/qt5/qtgui/qvector3d-members.html
  5644. share/doc/qt5/qtgui/qvector3d.html
  5645. share/doc/qt5/qtgui/qvector4d-members.html
  5646. share/doc/qt5/qtgui/qvector4d.html
  5647. share/doc/qt5/qtgui/qwhatsthisclickedevent-members.html
  5648. share/doc/qt5/qtgui/qwhatsthisclickedevent.html
  5649. share/doc/qt5/qtgui/qwheelevent-members.html
  5650. share/doc/qt5/qtgui/qwheelevent-obsolete.html
  5651. share/doc/qt5/qtgui/qwheelevent.html
  5652. share/doc/qt5/qtgui/qwindow-members.html
  5653. share/doc/qt5/qtgui/qwindow.html
  5654. share/doc/qt5/qtgui/qwindowstatechangeevent-members.html
  5655. share/doc/qt5/qtgui/qwindowstatechangeevent.html
  5656. share/doc/qt5/qtgui/richtext-advanced-processing.html
  5657. share/doc/qt5/qtgui/richtext-common-tasks.html
  5658. share/doc/qt5/qtgui/richtext-cursor.html
  5659. share/doc/qt5/qtgui/richtext-html-subset.html
  5660. share/doc/qt5/qtgui/richtext-layouts.html
  5661. share/doc/qt5/qtgui/richtext-processing.html
  5662. share/doc/qt5/qtgui/richtext-structure.html
  5663. share/doc/qt5/qtgui/richtext.html
  5664. share/doc/qt5/qtgui/style/offline-simple.css
  5665. share/doc/qt5/qtgui/style/offline.css
  5666. share/doc/qt5/qthelp.qch
  5667. share/doc/qt5/qthelp/examples-manifest.xml
  5668. share/doc/qt5/qthelp/examples-qthelp.html
  5669. share/doc/qt5/qthelp/helpsystem.html
  5670. share/doc/qt5/qthelp/images/arrow_bc.png
  5671. share/doc/qt5/qthelp/images/bgrContent.png
  5672. share/doc/qt5/qthelp/images/btn_next.png
  5673. share/doc/qt5/qthelp/images/btn_prev.png
  5674. share/doc/qt5/qthelp/images/bullet_dn.png
  5675. share/doc/qt5/qthelp/images/bullet_sq.png
  5676. share/doc/qt5/qthelp/images/home.png
  5677. share/doc/qt5/qthelp/images/ico_note.png
  5678. share/doc/qt5/qthelp/images/ico_note_attention.png
  5679. share/doc/qt5/qthelp/images/ico_out.png
  5680. share/doc/qt5/qthelp/images/logo.png
  5681. share/doc/qt5/qthelp/qhelpcontentitem-members.html
  5682. share/doc/qt5/qthelp/qhelpcontentitem.html
  5683. share/doc/qt5/qthelp/qhelpcontentmodel-members.html
  5684. share/doc/qt5/qthelp/qhelpcontentmodel.html
  5685. share/doc/qt5/qthelp/qhelpcontentwidget-members.html
  5686. share/doc/qt5/qthelp/qhelpcontentwidget.html
  5687. share/doc/qt5/qthelp/qhelpengine-members.html
  5688. share/doc/qt5/qthelp/qhelpengine.html
  5689. share/doc/qt5/qthelp/qhelpenginecore-members.html
  5690. share/doc/qt5/qthelp/qhelpenginecore.html
  5691. share/doc/qt5/qthelp/qhelpindexmodel-members.html
  5692. share/doc/qt5/qthelp/qhelpindexmodel-obsolete.html
  5693. share/doc/qt5/qthelp/qhelpindexmodel.html
  5694. share/doc/qt5/qthelp/qhelpindexwidget-members.html
  5695. share/doc/qt5/qthelp/qhelpindexwidget.html
  5696. share/doc/qt5/qthelp/qhelpsearchengine-members.html
  5697. share/doc/qt5/qthelp/qhelpsearchengine-obsolete.html
  5698. share/doc/qt5/qthelp/qhelpsearchengine.html
  5699. share/doc/qt5/qthelp/qhelpsearchquery-members.html
  5700. share/doc/qt5/qthelp/qhelpsearchquery-obsolete.html
  5701. share/doc/qt5/qthelp/qhelpsearchquery.html
  5702. share/doc/qt5/qthelp/qhelpsearchquerywidget-members.html
  5703. share/doc/qt5/qthelp/qhelpsearchquerywidget-obsolete.html
  5704. share/doc/qt5/qthelp/qhelpsearchquerywidget.html
  5705. share/doc/qt5/qthelp/qhelpsearchresult-members.html
  5706. share/doc/qt5/qthelp/qhelpsearchresult.html
  5707. share/doc/qt5/qthelp/qhelpsearchresultwidget-members.html
  5708. share/doc/qt5/qthelp/qhelpsearchresultwidget.html
  5709. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-contextsensitivehelp-pro.html
  5710. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhcp.html
  5711. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhp.html
  5712. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-example.html
  5713. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-helpbrowser-cpp.html
  5714. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-helpbrowser-h.html
  5715. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-main-cpp.html
  5716. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-cpp.html
  5717. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-h.html
  5718. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-ui.html
  5719. share/doc/qt5/qthelp/qthelp-framework.html
  5720. share/doc/qt5/qthelp/qthelp-index.html
  5721. share/doc/qt5/qthelp/qthelp-module.html
  5722. share/doc/qt5/qthelp/qthelp.index
  5723. share/doc/qt5/qthelp/qthelp.qhp
  5724. share/doc/qt5/qthelp/qthelp.qhp.sha1
  5725. share/doc/qt5/qthelp/qthelpproject.html
  5726. share/doc/qt5/qthelp/style/offline-simple.css
  5727. share/doc/qt5/qthelp/style/offline.css
  5728. share/doc/qt5/qtimageformats.qch
  5729. share/doc/qt5/qtimageformats/images/arrow_bc.png
  5730. share/doc/qt5/qtimageformats/images/bgrContent.png
  5731. share/doc/qt5/qtimageformats/images/btn_next.png
  5732. share/doc/qt5/qtimageformats/images/btn_prev.png
  5733. share/doc/qt5/qtimageformats/images/bullet_dn.png
  5734. share/doc/qt5/qtimageformats/images/bullet_sq.png
  5735. share/doc/qt5/qtimageformats/images/home.png
  5736. share/doc/qt5/qtimageformats/images/ico_note.png
  5737. share/doc/qt5/qtimageformats/images/ico_note_attention.png
  5738. share/doc/qt5/qtimageformats/images/ico_out.png
  5739. share/doc/qt5/qtimageformats/images/logo.png
  5740. share/doc/qt5/qtimageformats/qtimageformats-attribution-jasper.html
  5741. share/doc/qt5/qtimageformats/qtimageformats-attribution-libmng.html
  5742. share/doc/qt5/qtimageformats/qtimageformats-attribution-libtiff.html
  5743. share/doc/qt5/qtimageformats/qtimageformats-attribution-libwebp.html
  5744. share/doc/qt5/qtimageformats/qtimageformats-index.html
  5745. share/doc/qt5/qtimageformats/qtimageformats.index
  5746. share/doc/qt5/qtimageformats/qtimageformats.qhp
  5747. share/doc/qt5/qtimageformats/qtimageformats.qhp.sha1
  5748. share/doc/qt5/qtimageformats/style/offline-simple.css
  5749. share/doc/qt5/qtimageformats/style/offline.css
  5750. share/doc/qt5/qtlabscalendar.qch
  5751. share/doc/qt5/qtlabscalendar/images/arrow_bc.png
  5752. share/doc/qt5/qtlabscalendar/images/bgrContent.png
  5753. share/doc/qt5/qtlabscalendar/images/btn_next.png
  5754. share/doc/qt5/qtlabscalendar/images/btn_prev.png
  5755. share/doc/qt5/qtlabscalendar/images/bullet_dn.png
  5756. share/doc/qt5/qtlabscalendar/images/bullet_sq.png
  5757. share/doc/qt5/qtlabscalendar/images/home.png
  5758. share/doc/qt5/qtlabscalendar/images/ico_note.png
  5759. share/doc/qt5/qtlabscalendar/images/ico_note_attention.png
  5760. share/doc/qt5/qtlabscalendar/images/ico_out.png
  5761. share/doc/qt5/qtlabscalendar/images/logo.png
  5762. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-dayofweekrow-layout.png
  5763. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-dayofweekrow.png
  5764. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-monthgrid-layout.png
  5765. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-monthgrid.png
  5766. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn-layout.png
  5767. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn.png
  5768. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendar-members.html
  5769. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendar.html
  5770. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendarmodel-members.html
  5771. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendarmodel.html
  5772. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow-members.html
  5773. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow.html
  5774. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-monthgrid-members.html
  5775. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-monthgrid.html
  5776. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn-members.html
  5777. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn.html
  5778. share/doc/qt5/qtlabscalendar/qt-labs-calendar-qmlmodule.html
  5779. share/doc/qt5/qtlabscalendar/qtlabscalendar-index.html
  5780. share/doc/qt5/qtlabscalendar/qtlabscalendar.index
  5781. share/doc/qt5/qtlabscalendar/qtlabscalendar.qhp
  5782. share/doc/qt5/qtlabscalendar/qtlabscalendar.qhp.sha1
  5783. share/doc/qt5/qtlabscalendar/qtlabscalendar.tags
  5784. share/doc/qt5/qtlabscalendar/style/offline-simple.css
  5785. share/doc/qt5/qtlabscalendar/style/offline.css
  5786. share/doc/qt5/qtlabsplatform.qch
  5787. share/doc/qt5/qtlabsplatform/images/arrow_bc.png
  5788. share/doc/qt5/qtlabsplatform/images/bgrContent.png
  5789. share/doc/qt5/qtlabsplatform/images/btn_next.png
  5790. share/doc/qt5/qtlabsplatform/images/btn_prev.png
  5791. share/doc/qt5/qtlabsplatform/images/bullet_dn.png
  5792. share/doc/qt5/qtlabsplatform/images/bullet_sq.png
  5793. share/doc/qt5/qtlabsplatform/images/home.png
  5794. share/doc/qt5/qtlabsplatform/images/ico_note.png
  5795. share/doc/qt5/qtlabsplatform/images/ico_note_attention.png
  5796. share/doc/qt5/qtlabsplatform/images/ico_out.png
  5797. share/doc/qt5/qtlabsplatform/images/logo.png
  5798. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-colordialog-gtk.png
  5799. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-filedialog-gtk.png
  5800. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-folderdialog-gtk.png
  5801. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-fontdialog-gtk.png
  5802. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-menu.png
  5803. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-menubar.png
  5804. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-messagedialog-android.png
  5805. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-messagedialog-informative-android.png
  5806. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon-menu.png
  5807. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon-message.png
  5808. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon.png
  5809. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-colordialog-members.html
  5810. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-colordialog.html
  5811. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-dialog-members.html
  5812. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-dialog.html
  5813. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-filedialog-members.html
  5814. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-filedialog.html
  5815. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-folderdialog-members.html
  5816. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-folderdialog.html
  5817. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-fontdialog-members.html
  5818. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-fontdialog.html
  5819. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu-members.html
  5820. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu.html
  5821. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menubar-members.html
  5822. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menubar.html
  5823. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem-members.html
  5824. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem.html
  5825. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitemgroup-members.html
  5826. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitemgroup.html
  5827. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuseparator-members.html
  5828. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuseparator.html
  5829. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-messagedialog-members.html
  5830. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-messagedialog.html
  5831. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-standardpaths-members.html
  5832. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-standardpaths.html
  5833. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-members.html
  5834. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon.html
  5835. share/doc/qt5/qtlabsplatform/qt-labs-platform-qmlmodule.html
  5836. share/doc/qt5/qtlabsplatform/qtlabsplatform-index.html
  5837. share/doc/qt5/qtlabsplatform/qtlabsplatform.index
  5838. share/doc/qt5/qtlabsplatform/qtlabsplatform.qhp
  5839. share/doc/qt5/qtlabsplatform/qtlabsplatform.qhp.sha1
  5840. share/doc/qt5/qtlabsplatform/qtlabsplatform.tags
  5841. share/doc/qt5/qtlabsplatform/style/offline-simple.css
  5842. share/doc/qt5/qtlabsplatform/style/offline.css
  5843. share/doc/qt5/qtlinguist.qch
  5844. share/doc/qt5/qtlinguist/examples-linguist.html
  5845. share/doc/qt5/qtlinguist/examples-manifest.xml
  5846. share/doc/qt5/qtlinguist/images/arrow_bc.png
  5847. share/doc/qt5/qtlinguist/images/bgrContent.png
  5848. share/doc/qt5/qtlinguist/images/btn_next.png
  5849. share/doc/qt5/qtlinguist/images/btn_prev.png
  5850. share/doc/qt5/qtlinguist/images/bullet_dn.png
  5851. share/doc/qt5/qtlinguist/images/bullet_sq.png
  5852. share/doc/qt5/qtlinguist/images/home.png
  5853. share/doc/qt5/qtlinguist/images/ico_note.png
  5854. share/doc/qt5/qtlinguist/images/ico_note_attention.png
  5855. share/doc/qt5/qtlinguist/images/ico_out.png
  5856. share/doc/qt5/qtlinguist/images/linguist-arrowpad_en.png
  5857. share/doc/qt5/qtlinguist/images/linguist-arrowpad_fr.png
  5858. share/doc/qt5/qtlinguist/images/linguist-arrowpad_nl.png
  5859. share/doc/qt5/qtlinguist/images/linguist-batchtranslation.png
  5860. share/doc/qt5/qtlinguist/images/linguist-check-empty.png
  5861. share/doc/qt5/qtlinguist/images/linguist-check-obsolete.png
  5862. share/doc/qt5/qtlinguist/images/linguist-check-off.png
  5863. share/doc/qt5/qtlinguist/images/linguist-check-on.png
  5864. share/doc/qt5/qtlinguist/images/linguist-check-warning.png
  5865. share/doc/qt5/qtlinguist/images/linguist-danger.png
  5866. share/doc/qt5/qtlinguist/images/linguist-doneandnext.png
  5867. share/doc/qt5/qtlinguist/images/linguist-hellotr_en.png
  5868. share/doc/qt5/qtlinguist/images/linguist-hellotr_la.png
  5869. share/doc/qt5/qtlinguist/images/linguist-linguist.png
  5870. share/doc/qt5/qtlinguist/images/linguist-linguist_2.png
  5871. share/doc/qt5/qtlinguist/images/linguist-phrasebookdialog.png
  5872. share/doc/qt5/qtlinguist/images/linguist-translationfilesettings.png
  5873. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_en.png
  5874. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_pt_bad.png
  5875. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_pt_good.png
  5876. share/doc/qt5/qtlinguist/images/linguist-trollprint_11_en.png
  5877. share/doc/qt5/qtlinguist/images/linguist-trollprint_11_pt.png
  5878. share/doc/qt5/qtlinguist/images/logo.png
  5879. share/doc/qt5/qtlinguist/linguist-id-based-i18n.html
  5880. share/doc/qt5/qtlinguist/linguist-manager.html
  5881. share/doc/qt5/qtlinguist/linguist-overview.html
  5882. share/doc/qt5/qtlinguist/linguist-programmers.html
  5883. share/doc/qt5/qtlinguist/linguist-translators.html
  5884. share/doc/qt5/qtlinguist/linguist-ts-file-format.html
  5885. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-cpp.html
  5886. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-h.html
  5887. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-pro.html
  5888. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-example.html
  5889. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-main-cpp.html
  5890. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-mainwindow-cpp.html
  5891. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-mainwindow-h.html
  5892. share/doc/qt5/qtlinguist/qtlinguist-hellotr-example.html
  5893. share/doc/qt5/qtlinguist/qtlinguist-hellotr-hellotr-pro.html
  5894. share/doc/qt5/qtlinguist/qtlinguist-hellotr-main-cpp.html
  5895. share/doc/qt5/qtlinguist/qtlinguist-index.html
  5896. share/doc/qt5/qtlinguist/qtlinguist-trollprint-example.html
  5897. share/doc/qt5/qtlinguist/qtlinguist-trollprint-main-cpp.html
  5898. share/doc/qt5/qtlinguist/qtlinguist-trollprint-mainwindow-cpp.html
  5899. share/doc/qt5/qtlinguist/qtlinguist-trollprint-mainwindow-h.html
  5900. share/doc/qt5/qtlinguist/qtlinguist-trollprint-printpanel-cpp.html
  5901. share/doc/qt5/qtlinguist/qtlinguist-trollprint-printpanel-h.html
  5902. share/doc/qt5/qtlinguist/qtlinguist-trollprint-trollprint-pro.html
  5903. share/doc/qt5/qtlinguist/qtlinguist.index
  5904. share/doc/qt5/qtlinguist/qtlinguist.qhp
  5905. share/doc/qt5/qtlinguist/qtlinguist.qhp.sha1
  5906. share/doc/qt5/qtlinguist/style/offline-simple.css
  5907. share/doc/qt5/qtlinguist/style/offline.css
  5908. share/doc/qt5/qtlocation.qch
  5909. share/doc/qt5/qtlocation/examples-manifest.xml
  5910. share/doc/qt5/qtlocation/images/api-mapcircle.png
  5911. share/doc/qt5/qtlocation/images/api-mapitemgroup.png
  5912. share/doc/qt5/qtlocation/images/api-mappolygon.png
  5913. share/doc/qt5/qtlocation/images/api-mappolyline.png
  5914. share/doc/qt5/qtlocation/images/api-mapquickitem-anchor.png
  5915. share/doc/qt5/qtlocation/images/api-mapquickitem.png
  5916. share/doc/qt5/qtlocation/images/api-maprectangle.png
  5917. share/doc/qt5/qtlocation/images/arrow_bc.png
  5918. share/doc/qt5/qtlocation/images/bgrContent.png
  5919. share/doc/qt5/qtlocation/images/btn_next.png
  5920. share/doc/qt5/qtlocation/images/btn_prev.png
  5921. share/doc/qt5/qtlocation/images/bullet_dn.png
  5922. share/doc/qt5/qtlocation/images/bullet_sq.png
  5923. share/doc/qt5/qtlocation/images/home.png
  5924. share/doc/qt5/qtlocation/images/ico_note.png
  5925. share/doc/qt5/qtlocation/images/ico_note_attention.png
  5926. share/doc/qt5/qtlocation/images/ico_out.png
  5927. share/doc/qt5/qtlocation/images/logo.png
  5928. share/doc/qt5/qtlocation/images/mapviewer.png
  5929. share/doc/qt5/qtlocation/images/minimal_map.png
  5930. share/doc/qt5/qtlocation/images/places.png
  5931. share/doc/qt5/qtlocation/images/places_list.png
  5932. share/doc/qt5/qtlocation/images/places_map.png
  5933. share/doc/qt5/qtlocation/images/planespotter.png
  5934. share/doc/qt5/qtlocation/location-cpp-qml.html
  5935. share/doc/qt5/qtlocation/location-maps-cpp.html
  5936. share/doc/qt5/qtlocation/location-maps-qml.html
  5937. share/doc/qt5/qtlocation/location-places-backend.html
  5938. share/doc/qt5/qtlocation/location-places-cpp.html
  5939. share/doc/qt5/qtlocation/location-places-qml.html
  5940. share/doc/qt5/qtlocation/location-plugin-esri.html
  5941. share/doc/qt5/qtlocation/location-plugin-here.html
  5942. share/doc/qt5/qtlocation/location-plugin-itemsoverlay.html
  5943. share/doc/qt5/qtlocation/location-plugin-mapbox.html
  5944. share/doc/qt5/qtlocation/location-plugin-mapboxgl.html
  5945. share/doc/qt5/qtlocation/location-plugin-osm.html
  5946. share/doc/qt5/qtlocation/qgeocodereply-members.html
  5947. share/doc/qt5/qtlocation/qgeocodereply.html
  5948. share/doc/qt5/qtlocation/qgeocodingmanager-members.html
  5949. share/doc/qt5/qtlocation/qgeocodingmanager.html
  5950. share/doc/qt5/qtlocation/qgeocodingmanagerengine-members.html
  5951. share/doc/qt5/qtlocation/qgeocodingmanagerengine.html
  5952. share/doc/qt5/qtlocation/qgeomaneuver-members.html
  5953. share/doc/qt5/qtlocation/qgeomaneuver.html
  5954. share/doc/qt5/qtlocation/qgeoroute-members.html
  5955. share/doc/qt5/qtlocation/qgeoroute.html
  5956. share/doc/qt5/qtlocation/qgeoroutereply-members.html
  5957. share/doc/qt5/qtlocation/qgeoroutereply.html
  5958. share/doc/qt5/qtlocation/qgeorouterequest-members.html
  5959. share/doc/qt5/qtlocation/qgeorouterequest.html
  5960. share/doc/qt5/qtlocation/qgeoroutesegment-members.html
  5961. share/doc/qt5/qtlocation/qgeoroutesegment.html
  5962. share/doc/qt5/qtlocation/qgeoroutingmanager-members.html
  5963. share/doc/qt5/qtlocation/qgeoroutingmanager.html
  5964. share/doc/qt5/qtlocation/qgeoroutingmanagerengine-members.html
  5965. share/doc/qt5/qtlocation/qgeoroutingmanagerengine.html
  5966. share/doc/qt5/qtlocation/qgeoserviceprovider-members.html
  5967. share/doc/qt5/qtlocation/qgeoserviceprovider.html
  5968. share/doc/qt5/qtlocation/qgeoserviceproviderfactory-members.html
  5969. share/doc/qt5/qtlocation/qgeoserviceproviderfactory.html
  5970. share/doc/qt5/qtlocation/qlocation.html
  5971. share/doc/qt5/qtlocation/qml-location5-maps.html
  5972. share/doc/qt5/qtlocation/qml-qtlocation-category-members.html
  5973. share/doc/qt5/qtlocation/qml-qtlocation-category.html
  5974. share/doc/qt5/qtlocation/qml-qtlocation-categorymodel-members.html
  5975. share/doc/qt5/qtlocation/qml-qtlocation-categorymodel.html
  5976. share/doc/qt5/qtlocation/qml-qtlocation-contactdetail-members.html
  5977. share/doc/qt5/qtlocation/qml-qtlocation-contactdetail.html
  5978. share/doc/qt5/qtlocation/qml-qtlocation-contactdetails-members.html
  5979. share/doc/qt5/qtlocation/qml-qtlocation-contactdetails.html
  5980. share/doc/qt5/qtlocation/qml-qtlocation-editorialmodel-members.html
  5981. share/doc/qt5/qtlocation/qml-qtlocation-editorialmodel.html
  5982. share/doc/qt5/qtlocation/qml-qtlocation-extendedattributes-members.html
  5983. share/doc/qt5/qtlocation/qml-qtlocation-extendedattributes.html
  5984. share/doc/qt5/qtlocation/qml-qtlocation-geocodemodel-members.html
  5985. share/doc/qt5/qtlocation/qml-qtlocation-geocodemodel.html
  5986. share/doc/qt5/qtlocation/qml-qtlocation-icon-members.html
  5987. share/doc/qt5/qtlocation/qml-qtlocation-icon.html
  5988. share/doc/qt5/qtlocation/qml-qtlocation-imagemodel-members.html
  5989. share/doc/qt5/qtlocation/qml-qtlocation-imagemodel.html
  5990. share/doc/qt5/qtlocation/qml-qtlocation-map-members.html
  5991. share/doc/qt5/qtlocation/qml-qtlocation-map.html
  5992. share/doc/qt5/qtlocation/qml-qtlocation-mapcircle-members.html
  5993. share/doc/qt5/qtlocation/qml-qtlocation-mapcircle.html
  5994. share/doc/qt5/qtlocation/qml-qtlocation-mapcopyrightnotice-members.html
  5995. share/doc/qt5/qtlocation/qml-qtlocation-mapcopyrightnotice.html
  5996. share/doc/qt5/qtlocation/qml-qtlocation-mapgesturearea-members.html
  5997. share/doc/qt5/qtlocation/qml-qtlocation-mapgesturearea.html
  5998. share/doc/qt5/qtlocation/qml-qtlocation-mapitemgroup-members.html
  5999. share/doc/qt5/qtlocation/qml-qtlocation-mapitemgroup.html
  6000. share/doc/qt5/qtlocation/qml-qtlocation-mapitemview-members.html
  6001. share/doc/qt5/qtlocation/qml-qtlocation-mapitemview.html
  6002. share/doc/qt5/qtlocation/qml-qtlocation-mapparameter-members.html
  6003. share/doc/qt5/qtlocation/qml-qtlocation-mapparameter.html
  6004. share/doc/qt5/qtlocation/qml-qtlocation-mappinchevent-members.html
  6005. share/doc/qt5/qtlocation/qml-qtlocation-mappinchevent.html
  6006. share/doc/qt5/qtlocation/qml-qtlocation-mappolygon-members.html
  6007. share/doc/qt5/qtlocation/qml-qtlocation-mappolygon.html
  6008. share/doc/qt5/qtlocation/qml-qtlocation-mappolyline-members.html
  6009. share/doc/qt5/qtlocation/qml-qtlocation-mappolyline.html
  6010. share/doc/qt5/qtlocation/qml-qtlocation-mapquickitem-members.html
  6011. share/doc/qt5/qtlocation/qml-qtlocation-mapquickitem.html
  6012. share/doc/qt5/qtlocation/qml-qtlocation-maprectangle-members.html
  6013. share/doc/qt5/qtlocation/qml-qtlocation-maprectangle.html
  6014. share/doc/qt5/qtlocation/qml-qtlocation-maproute-members.html
  6015. share/doc/qt5/qtlocation/qml-qtlocation-maproute.html
  6016. share/doc/qt5/qtlocation/qml-qtlocation-maptype-members.html
  6017. share/doc/qt5/qtlocation/qml-qtlocation-maptype.html
  6018. share/doc/qt5/qtlocation/qml-qtlocation-place-members.html
  6019. share/doc/qt5/qtlocation/qml-qtlocation-place.html
  6020. share/doc/qt5/qtlocation/qml-qtlocation-placeattribute-members.html
  6021. share/doc/qt5/qtlocation/qml-qtlocation-placeattribute.html
  6022. share/doc/qt5/qtlocation/qml-qtlocation-placesearchmodel-members.html
  6023. share/doc/qt5/qtlocation/qml-qtlocation-placesearchmodel.html
  6024. share/doc/qt5/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
  6025. share/doc/qt5/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
  6026. share/doc/qt5/qtlocation/qml-qtlocation-plugin-members.html
  6027. share/doc/qt5/qtlocation/qml-qtlocation-plugin.html
  6028. share/doc/qt5/qtlocation/qml-qtlocation-pluginparameter-members.html
  6029. share/doc/qt5/qtlocation/qml-qtlocation-pluginparameter.html
  6030. share/doc/qt5/qtlocation/qml-qtlocation-ratings-members.html
  6031. share/doc/qt5/qtlocation/qml-qtlocation-ratings.html
  6032. share/doc/qt5/qtlocation/qml-qtlocation-reviewmodel-members.html
  6033. share/doc/qt5/qtlocation/qml-qtlocation-reviewmodel.html
  6034. share/doc/qt5/qtlocation/qml-qtlocation-route-members.html
  6035. share/doc/qt5/qtlocation/qml-qtlocation-route.html
  6036. share/doc/qt5/qtlocation/qml-qtlocation-routemaneuver-members.html
  6037. share/doc/qt5/qtlocation/qml-qtlocation-routemaneuver.html
  6038. share/doc/qt5/qtlocation/qml-qtlocation-routemodel-members.html
  6039. share/doc/qt5/qtlocation/qml-qtlocation-routemodel.html
  6040. share/doc/qt5/qtlocation/qml-qtlocation-routequery-members.html
  6041. share/doc/qt5/qtlocation/qml-qtlocation-routequery.html
  6042. share/doc/qt5/qtlocation/qml-qtlocation-routesegment-members.html
  6043. share/doc/qt5/qtlocation/qml-qtlocation-routesegment.html
  6044. share/doc/qt5/qtlocation/qml-qtlocation-supplier-members.html
  6045. share/doc/qt5/qtlocation/qml-qtlocation-supplier.html
  6046. share/doc/qt5/qtlocation/qml-qtlocation-user-members.html
  6047. share/doc/qt5/qtlocation/qml-qtlocation-user.html
  6048. share/doc/qt5/qtlocation/qml-qtlocation5-maps.html
  6049. share/doc/qt5/qtlocation/qplace-members.html
  6050. share/doc/qt5/qtlocation/qplace.html
  6051. share/doc/qt5/qtlocation/qplaceattribute-members.html
  6052. share/doc/qt5/qtlocation/qplaceattribute.html
  6053. share/doc/qt5/qtlocation/qplacecategory-members.html
  6054. share/doc/qt5/qtlocation/qplacecategory.html
  6055. share/doc/qt5/qtlocation/qplacecontactdetail-members.html
  6056. share/doc/qt5/qtlocation/qplacecontactdetail.html
  6057. share/doc/qt5/qtlocation/qplacecontent-members.html
  6058. share/doc/qt5/qtlocation/qplacecontent.html
  6059. share/doc/qt5/qtlocation/qplacecontentreply-members.html
  6060. share/doc/qt5/qtlocation/qplacecontentreply.html
  6061. share/doc/qt5/qtlocation/qplacecontentrequest-members.html
  6062. share/doc/qt5/qtlocation/qplacecontentrequest.html
  6063. share/doc/qt5/qtlocation/qplacedetailsreply-members.html
  6064. share/doc/qt5/qtlocation/qplacedetailsreply.html
  6065. share/doc/qt5/qtlocation/qplaceeditorial-members.html
  6066. share/doc/qt5/qtlocation/qplaceeditorial.html
  6067. share/doc/qt5/qtlocation/qplaceicon-members.html
  6068. share/doc/qt5/qtlocation/qplaceicon.html
  6069. share/doc/qt5/qtlocation/qplaceidreply-members.html
  6070. share/doc/qt5/qtlocation/qplaceidreply.html
  6071. share/doc/qt5/qtlocation/qplaceimage-members.html
  6072. share/doc/qt5/qtlocation/qplaceimage.html
  6073. share/doc/qt5/qtlocation/qplacemanager-members.html
  6074. share/doc/qt5/qtlocation/qplacemanager.html
  6075. share/doc/qt5/qtlocation/qplacemanagerengine-members.html
  6076. share/doc/qt5/qtlocation/qplacemanagerengine.html
  6077. share/doc/qt5/qtlocation/qplacematchreply-members.html
  6078. share/doc/qt5/qtlocation/qplacematchreply.html
  6079. share/doc/qt5/qtlocation/qplacematchrequest-members.html
  6080. share/doc/qt5/qtlocation/qplacematchrequest.html
  6081. share/doc/qt5/qtlocation/qplaceproposedsearchresult-members.html
  6082. share/doc/qt5/qtlocation/qplaceproposedsearchresult.html
  6083. share/doc/qt5/qtlocation/qplaceratings-members.html
  6084. share/doc/qt5/qtlocation/qplaceratings.html
  6085. share/doc/qt5/qtlocation/qplacereply-members.html
  6086. share/doc/qt5/qtlocation/qplacereply.html
  6087. share/doc/qt5/qtlocation/qplaceresult-members.html
  6088. share/doc/qt5/qtlocation/qplaceresult.html
  6089. share/doc/qt5/qtlocation/qplacereview-members.html
  6090. share/doc/qt5/qtlocation/qplacereview.html
  6091. share/doc/qt5/qtlocation/qplacesearchreply-members.html
  6092. share/doc/qt5/qtlocation/qplacesearchreply.html
  6093. share/doc/qt5/qtlocation/qplacesearchrequest-members.html
  6094. share/doc/qt5/qtlocation/qplacesearchrequest.html
  6095. share/doc/qt5/qtlocation/qplacesearchresult-members.html
  6096. share/doc/qt5/qtlocation/qplacesearchresult.html
  6097. share/doc/qt5/qtlocation/qplacesearchsuggestionreply-members.html
  6098. share/doc/qt5/qtlocation/qplacesearchsuggestionreply.html
  6099. share/doc/qt5/qtlocation/qplacesupplier-members.html
  6100. share/doc/qt5/qtlocation/qplacesupplier.html
  6101. share/doc/qt5/qtlocation/qplaceuser-members.html
  6102. share/doc/qt5/qtlocation/qplaceuser.html
  6103. share/doc/qt5/qtlocation/qtlocation-attribution-clip2tri.html
  6104. share/doc/qt5/qtlocation/qtlocation-attribution-clipper.html
  6105. share/doc/qt5/qtlocation/qtlocation-attribution-earcut.html
  6106. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-boost.html
  6107. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-css-color-parser.html
  6108. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-earcut.html
  6109. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geojson.html
  6110. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geojsonvt.html
  6111. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geometry.html
  6112. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-kdbush.html
  6113. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-libcxx.html
  6114. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-parsedate.html
  6115. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-polylabel.html
  6116. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-protozero.html
  6117. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-rapidjson.html
  6118. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-shelfpack.html
  6119. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-supercluster.html
  6120. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-unique-resource.html
  6121. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-variant.html
  6122. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-vectortile.html
  6123. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-wagyu.html
  6124. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl.html
  6125. share/doc/qt5/qtlocation/qtlocation-attribution-poly2tri.html
  6126. share/doc/qt5/qtlocation/qtlocation-changes.html
  6127. share/doc/qt5/qtlocation/qtlocation-cpp.html
  6128. share/doc/qt5/qtlocation/qtlocation-examples.html
  6129. share/doc/qt5/qtlocation/qtlocation-geoservices.html
  6130. share/doc/qt5/qtlocation/qtlocation-index.html
  6131. share/doc/qt5/qtlocation/qtlocation-mapviewer-example.html
  6132. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-geocode-qml.html
  6133. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-geocodeform-ui-qml.html
  6134. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-locale-qml.html
  6135. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-localeform-ui-qml.html
  6136. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-message-qml.html
  6137. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-messageform-ui-qml.html
  6138. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-reversegeocode-qml.html
  6139. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-reversegeocodeform-ui-qml.html
  6140. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routeaddress-qml.html
  6141. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routeaddressform-ui-qml.html
  6142. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routecoordinate-qml.html
  6143. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routecoordinateform-ui-qml.html
  6144. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelist-qml.html
  6145. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelistdelegate-qml.html
  6146. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelistheader-qml.html
  6147. share/doc/qt5/qtlocation/qtlocation-mapviewer-helper-js.html
  6148. share/doc/qt5/qtlocation/qtlocation-mapviewer-main-cpp.html
  6149. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-circleitem-qml.html
  6150. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-imageitem-qml.html
  6151. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-mapcomponent-qml.html
  6152. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-mapsliders-qml.html
  6153. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-marker-qml.html
  6154. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-minimap-qml.html
  6155. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-polygonitem-qml.html
  6156. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-polylineitem-qml.html
  6157. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-rectangleitem-qml.html
  6158. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-pro.html
  6159. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-qml.html
  6160. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-qrc.html
  6161. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-itempopupmenu-qml.html
  6162. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-mainmenu-qml.html
  6163. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-mappopupmenu-qml.html
  6164. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-markerpopupmenu-qml.html
  6165. share/doc/qt5/qtlocation/qtlocation-minimal-map-example.html
  6166. share/doc/qt5/qtlocation/qtlocation-minimal-map-main-cpp.html
  6167. share/doc/qt5/qtlocation/qtlocation-minimal-map-main-qml.html
  6168. share/doc/qt5/qtlocation/qtlocation-minimal-map-minimal-map-pro.html
  6169. share/doc/qt5/qtlocation/qtlocation-minimal-map-qml-qrc.html
  6170. share/doc/qt5/qtlocation/qtlocation-module.html
  6171. share/doc/qt5/qtlocation/qtlocation-places-example.html
  6172. share/doc/qt5/qtlocation/qtlocation-places-forms-message-qml.html
  6173. share/doc/qt5/qtlocation/qtlocation-places-forms-messageform-ui-qml.html
  6174. share/doc/qt5/qtlocation/qtlocation-places-forms-placedetails-qml.html
  6175. share/doc/qt5/qtlocation/qtlocation-places-forms-placedetailsform-ui-qml.html
  6176. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingbox-qml.html
  6177. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingboxform-ui-qml.html
  6178. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingcircle-qml.html
  6179. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingcircleform-ui-qml.html
  6180. share/doc/qt5/qtlocation/qtlocation-places-forms-searchcenter-qml.html
  6181. share/doc/qt5/qtlocation/qtlocation-places-forms-searchcenterform-ui-qml.html
  6182. share/doc/qt5/qtlocation/qtlocation-places-forms-searchoptions-qml.html
  6183. share/doc/qt5/qtlocation/qtlocation-places-forms-searchoptionsform-ui-qml.html
  6184. share/doc/qt5/qtlocation/qtlocation-places-helper-js.html
  6185. share/doc/qt5/qtlocation/qtlocation-places-items-mainmenu-qml.html
  6186. share/doc/qt5/qtlocation/qtlocation-places-items-mapcomponent-qml.html
  6187. share/doc/qt5/qtlocation/qtlocation-places-items-searchbar-qml.html
  6188. share/doc/qt5/qtlocation/qtlocation-places-list-example.html
  6189. share/doc/qt5/qtlocation/qtlocation-places-list-main-cpp.html
  6190. share/doc/qt5/qtlocation/qtlocation-places-list-marker-qml.html
  6191. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-pro.html
  6192. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-qml.html
  6193. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-qrc.html
  6194. share/doc/qt5/qtlocation/qtlocation-places-main-cpp.html
  6195. share/doc/qt5/qtlocation/qtlocation-places-map-example.html
  6196. share/doc/qt5/qtlocation/qtlocation-places-map-main-cpp.html
  6197. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-pro.html
  6198. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-qml.html
  6199. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-qrc.html
  6200. share/doc/qt5/qtlocation/qtlocation-places-places-pro.html
  6201. share/doc/qt5/qtlocation/qtlocation-places-places-qml.html
  6202. share/doc/qt5/qtlocation/qtlocation-places-places-qrc.html
  6203. share/doc/qt5/qtlocation/qtlocation-places-views-categorydelegate-qml.html
  6204. share/doc/qt5/qtlocation/qtlocation-places-views-categoryview-qml.html
  6205. share/doc/qt5/qtlocation/qtlocation-places-views-editorialdelegate-qml.html
  6206. share/doc/qt5/qtlocation/qtlocation-places-views-editorialpage-qml.html
  6207. share/doc/qt5/qtlocation/qtlocation-places-views-editorialview-qml.html
  6208. share/doc/qt5/qtlocation/qtlocation-places-views-imageview-qml.html
  6209. share/doc/qt5/qtlocation/qtlocation-places-views-ratingview-qml.html
  6210. share/doc/qt5/qtlocation/qtlocation-places-views-reviewdelegate-qml.html
  6211. share/doc/qt5/qtlocation/qtlocation-places-views-reviewpage-qml.html
  6212. share/doc/qt5/qtlocation/qtlocation-places-views-reviewview-qml.html
  6213. share/doc/qt5/qtlocation/qtlocation-places-views-searchresultdelegate-qml.html
  6214. share/doc/qt5/qtlocation/qtlocation-places-views-searchresultview-qml.html
  6215. share/doc/qt5/qtlocation/qtlocation-places-views-suggestionview-qml.html
  6216. share/doc/qt5/qtlocation/qtlocation-planespotter-example.html
  6217. share/doc/qt5/qtlocation/qtlocation-planespotter-main-cpp.html
  6218. share/doc/qt5/qtlocation/qtlocation-planespotter-plane-qml.html
  6219. share/doc/qt5/qtlocation/qtlocation-planespotter-planespotter-pro.html
  6220. share/doc/qt5/qtlocation/qtlocation-planespotter-planespotter-qml.html
  6221. share/doc/qt5/qtlocation/qtlocation-planespotter-qml-qrc.html
  6222. share/doc/qt5/qtlocation/qtlocation-qmlmodule.html
  6223. share/doc/qt5/qtlocation/qtlocation.index
  6224. share/doc/qt5/qtlocation/qtlocation.qhp
  6225. share/doc/qt5/qtlocation/qtlocation.qhp.sha1
  6226. share/doc/qt5/qtlocation/qtlocation.tags
  6227. share/doc/qt5/qtlocation/style/offline-simple.css
  6228. share/doc/qt5/qtlocation/style/offline.css
  6229. share/doc/qt5/qtmacextras.qch
  6230. share/doc/qt5/qtmacextras/examples-manifest.xml
  6231. share/doc/qt5/qtmacextras/examples-qtmacextras.html
  6232. share/doc/qt5/qtmacextras/images/arrow_bc.png
  6233. share/doc/qt5/qtmacextras/images/bgrContent.png
  6234. share/doc/qt5/qtmacextras/images/btn_next.png
  6235. share/doc/qt5/qtmacextras/images/btn_prev.png
  6236. share/doc/qt5/qtmacextras/images/bullet_dn.png
  6237. share/doc/qt5/qtmacextras/images/bullet_sq.png
  6238. share/doc/qt5/qtmacextras/images/home.png
  6239. share/doc/qt5/qtmacextras/images/ico_note.png
  6240. share/doc/qt5/qtmacextras/images/ico_note_attention.png
  6241. share/doc/qt5/qtmacextras/images/ico_out.png
  6242. share/doc/qt5/qtmacextras/images/logo.png
  6243. share/doc/qt5/qtmacextras/qmacpasteboardmime-members.html
  6244. share/doc/qt5/qtmacextras/qmacpasteboardmime.html
  6245. share/doc/qt5/qtmacextras/qmactoolbar-members.html
  6246. share/doc/qt5/qtmacextras/qmactoolbar.html
  6247. share/doc/qt5/qtmacextras/qmactoolbaritem-members.html
  6248. share/doc/qt5/qtmacextras/qmactoolbaritem.html
  6249. share/doc/qt5/qtmacextras/qtmac-obsolete.html
  6250. share/doc/qt5/qtmacextras/qtmac.html
  6251. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-embeddedqwindow-pro.html
  6252. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-example.html
  6253. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-window-cpp.html
  6254. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-window-h.html
  6255. share/doc/qt5/qtmacextras/qtmacextras-index.html
  6256. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-example.html
  6257. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-macfunctions-pro.html
  6258. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-macfunctions-qrc.html
  6259. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-main-cpp.html
  6260. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-example.html
  6261. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-macpasteboardmime-pro.html
  6262. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-main-cpp.html
  6263. share/doc/qt5/qtmacextras/qtmacextras-module.html
  6264. share/doc/qt5/qtmacextras/qtmacextras.index
  6265. share/doc/qt5/qtmacextras/qtmacextras.qhp
  6266. share/doc/qt5/qtmacextras/qtmacextras.qhp.sha1
  6267. share/doc/qt5/qtmacextras/style/offline-simple.css
  6268. share/doc/qt5/qtmacextras/style/offline.css
  6269. share/doc/qt5/qtmultimedia.qch
  6270. share/doc/qt5/qtmultimedia/audiooverview.html
  6271. share/doc/qt5/qtmultimedia/cameraoverview.html
  6272. share/doc/qt5/qtmultimedia/changes.html
  6273. share/doc/qt5/qtmultimedia/examples-manifest.xml
  6274. share/doc/qt5/qtmultimedia/images/arrow_bc.png
  6275. share/doc/qt5/qtmultimedia/images/audiodevices.png
  6276. share/doc/qt5/qtmultimedia/images/audioinput-example.png
  6277. share/doc/qt5/qtmultimedia/images/audiooutput-example.png
  6278. share/doc/qt5/qtmultimedia/images/audiorecorder.png
  6279. share/doc/qt5/qtmultimedia/images/bgrContent.png
  6280. share/doc/qt5/qtmultimedia/images/btn_next.png
  6281. share/doc/qt5/qtmultimedia/images/btn_prev.png
  6282. share/doc/qt5/qtmultimedia/images/bullet_dn.png
  6283. share/doc/qt5/qtmultimedia/images/bullet_sq.png
  6284. share/doc/qt5/qtmultimedia/images/camera-example.png
  6285. share/doc/qt5/qtmultimedia/images/declarative-radio-example.png
  6286. share/doc/qt5/qtmultimedia/images/home.png
  6287. share/doc/qt5/qtmultimedia/images/ico_note.png
  6288. share/doc/qt5/qtmultimedia/images/ico_note_attention.png
  6289. share/doc/qt5/qtmultimedia/images/ico_out.png
  6290. share/doc/qt5/qtmultimedia/images/logo.png
  6291. share/doc/qt5/qtmultimedia/images/mediaplayerex.jpg
  6292. share/doc/qt5/qtmultimedia/images/qml-camera.png
  6293. share/doc/qt5/qtmultimedia/images/qmlvideo-menu.jpg
  6294. share/doc/qt5/qtmultimedia/images/qmlvideo-overlay.jpg
  6295. share/doc/qt5/qtmultimedia/images/qmlvideofx-camera-glow.jpg
  6296. share/doc/qt5/qtmultimedia/images/qmlvideofx-camera-wobble.jpg
  6297. share/doc/qt5/qtmultimedia/images/qmlvideofx-effects-menu.jpg
  6298. share/doc/qt5/qtmultimedia/images/qmlvideofx-video-edgedetection.jpg
  6299. share/doc/qt5/qtmultimedia/images/qmlvideofx-video-pagecurl.jpg
  6300. share/doc/qt5/qtmultimedia/images/radio-example.png
  6301. share/doc/qt5/qtmultimedia/images/spectrum-demo.png
  6302. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_auto_mode.png
  6303. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_camera_setting.png
  6304. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_auto.png
  6305. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_fill.png
  6306. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_off.png
  6307. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_redeye.png
  6308. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_cloudy.png
  6309. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_flourescent.png
  6310. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_incandescent.png
  6311. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_sunny.png
  6312. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/toolbutton.png
  6313. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/folder.png
  6314. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/leaves.jpg
  6315. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/up.png
  6316. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Dropdown_arrows.png
  6317. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_bar.png
  6318. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_handle.png
  6319. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_Top.png
  6320. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_bottom.png
  6321. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_BackArrow.png
  6322. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Folder.png
  6323. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Menu.png
  6324. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/qt-logo.png
  6325. share/doc/qt5/qtmultimedia/images/video-qml-paint-rate.png
  6326. share/doc/qt5/qtmultimedia/images/video-videographicsitem.png
  6327. share/doc/qt5/qtmultimedia/images/video-videowidget.png
  6328. share/doc/qt5/qtmultimedia/multimedia-examples.html
  6329. share/doc/qt5/qtmultimedia/multimediabackend.html
  6330. share/doc/qt5/qtmultimedia/multimediaoverview.html
  6331. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo-members.html
  6332. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo.html
  6333. share/doc/qt5/qtmultimedia/qabstractaudioinput-members.html
  6334. share/doc/qt5/qtmultimedia/qabstractaudioinput.html
  6335. share/doc/qt5/qtmultimedia/qabstractaudiooutput-members.html
  6336. share/doc/qt5/qtmultimedia/qabstractaudiooutput.html
  6337. share/doc/qt5/qtmultimedia/qabstractplanarvideobuffer-members.html
  6338. share/doc/qt5/qtmultimedia/qabstractplanarvideobuffer.html
  6339. share/doc/qt5/qtmultimedia/qabstractvideobuffer-members.html
  6340. share/doc/qt5/qtmultimedia/qabstractvideobuffer.html
  6341. share/doc/qt5/qtmultimedia/qabstractvideofilter-members.html
  6342. share/doc/qt5/qtmultimedia/qabstractvideofilter.html
  6343. share/doc/qt5/qtmultimedia/qabstractvideosurface-members.html
  6344. share/doc/qt5/qtmultimedia/qabstractvideosurface.html
  6345. share/doc/qt5/qtmultimedia/qaudio.html
  6346. share/doc/qt5/qtmultimedia/qaudiobuffer-members.html
  6347. share/doc/qt5/qtmultimedia/qaudiobuffer-stereoframe-members.html
  6348. share/doc/qt5/qtmultimedia/qaudiobuffer-stereoframe.html
  6349. share/doc/qt5/qtmultimedia/qaudiobuffer.html
  6350. share/doc/qt5/qtmultimedia/qaudiodecoder-members.html
  6351. share/doc/qt5/qtmultimedia/qaudiodecoder.html
  6352. share/doc/qt5/qtmultimedia/qaudiodecodercontrol-members.html
  6353. share/doc/qt5/qtmultimedia/qaudiodecodercontrol.html
  6354. share/doc/qt5/qtmultimedia/qaudiodeviceinfo-members.html
  6355. share/doc/qt5/qtmultimedia/qaudiodeviceinfo.html
  6356. share/doc/qt5/qtmultimedia/qaudioencodersettings-members.html
  6357. share/doc/qt5/qtmultimedia/qaudioencodersettings.html
  6358. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol-members.html
  6359. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol.html
  6360. share/doc/qt5/qtmultimedia/qaudioformat-members.html
  6361. share/doc/qt5/qtmultimedia/qaudioformat.html
  6362. share/doc/qt5/qtmultimedia/qaudioinput-members.html
  6363. share/doc/qt5/qtmultimedia/qaudioinput.html
  6364. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol-members.html
  6365. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol.html
  6366. share/doc/qt5/qtmultimedia/qaudiooutput-members.html
  6367. share/doc/qt5/qtmultimedia/qaudiooutput.html
  6368. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol-members.html
  6369. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol.html
  6370. share/doc/qt5/qtmultimedia/qaudioprobe-members.html
  6371. share/doc/qt5/qtmultimedia/qaudioprobe.html
  6372. share/doc/qt5/qtmultimedia/qaudiorecorder-members.html
  6373. share/doc/qt5/qtmultimedia/qaudiorecorder.html
  6374. share/doc/qt5/qtmultimedia/qaudiorolecontrol-members.html
  6375. share/doc/qt5/qtmultimedia/qaudiorolecontrol.html
  6376. share/doc/qt5/qtmultimedia/qaudiosystemplugin-members.html
  6377. share/doc/qt5/qtmultimedia/qaudiosystemplugin.html
  6378. share/doc/qt5/qtmultimedia/qcamera-frameraterange-members.html
  6379. share/doc/qt5/qtmultimedia/qcamera-frameraterange.html
  6380. share/doc/qt5/qtmultimedia/qcamera-members.html
  6381. share/doc/qt5/qtmultimedia/qcamera-obsolete.html
  6382. share/doc/qt5/qtmultimedia/qcamera.html
  6383. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol-members.html
  6384. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol.html
  6385. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol-members.html
  6386. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol.html
  6387. share/doc/qt5/qtmultimedia/qcameracontrol-members.html
  6388. share/doc/qt5/qtmultimedia/qcameracontrol.html
  6389. share/doc/qt5/qtmultimedia/qcameraexposure-members.html
  6390. share/doc/qt5/qtmultimedia/qcameraexposure.html
  6391. share/doc/qt5/qtmultimedia/qcameraexposurecontrol-members.html
  6392. share/doc/qt5/qtmultimedia/qcameraexposurecontrol.html
  6393. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol-members.html
  6394. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol.html
  6395. share/doc/qt5/qtmultimedia/qcameraflashcontrol-members.html
  6396. share/doc/qt5/qtmultimedia/qcameraflashcontrol.html
  6397. share/doc/qt5/qtmultimedia/qcamerafocus-members.html
  6398. share/doc/qt5/qtmultimedia/qcamerafocus.html
  6399. share/doc/qt5/qtmultimedia/qcamerafocuscontrol-members.html
  6400. share/doc/qt5/qtmultimedia/qcamerafocuscontrol.html
  6401. share/doc/qt5/qtmultimedia/qcamerafocuszone-members.html
  6402. share/doc/qt5/qtmultimedia/qcamerafocuszone.html
  6403. share/doc/qt5/qtmultimedia/qcameraimagecapture-members.html
  6404. share/doc/qt5/qtmultimedia/qcameraimagecapture.html
  6405. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol-members.html
  6406. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol.html
  6407. share/doc/qt5/qtmultimedia/qcameraimageprocessing-members.html
  6408. share/doc/qt5/qtmultimedia/qcameraimageprocessing.html
  6409. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol-members.html
  6410. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol.html
  6411. share/doc/qt5/qtmultimedia/qcamerainfo-members.html
  6412. share/doc/qt5/qtmultimedia/qcamerainfo.html
  6413. share/doc/qt5/qtmultimedia/qcamerainfocontrol-members.html
  6414. share/doc/qt5/qtmultimedia/qcamerainfocontrol.html
  6415. share/doc/qt5/qtmultimedia/qcameralockscontrol-members.html
  6416. share/doc/qt5/qtmultimedia/qcameralockscontrol.html
  6417. share/doc/qt5/qtmultimedia/qcameraviewfinder-members.html
  6418. share/doc/qt5/qtmultimedia/qcameraviewfinder.html
  6419. share/doc/qt5/qtmultimedia/qcameraviewfindersettings-members.html
  6420. share/doc/qt5/qtmultimedia/qcameraviewfindersettings.html
  6421. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol-members.html
  6422. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol.html
  6423. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2-members.html
  6424. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2.html
  6425. share/doc/qt5/qtmultimedia/qcamerazoomcontrol-members.html
  6426. share/doc/qt5/qtmultimedia/qcamerazoomcontrol.html
  6427. share/doc/qt5/qtmultimedia/qgraphicsvideoitem-members.html
  6428. share/doc/qt5/qtmultimedia/qgraphicsvideoitem.html
  6429. share/doc/qt5/qtmultimedia/qimageencodercontrol-members.html
  6430. share/doc/qt5/qtmultimedia/qimageencodercontrol.html
  6431. share/doc/qt5/qtmultimedia/qimageencodersettings-members.html
  6432. share/doc/qt5/qtmultimedia/qimageencodersettings.html
  6433. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol-members.html
  6434. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol.html
  6435. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol-members.html
  6436. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol.html
  6437. share/doc/qt5/qtmultimedia/qmediabindableinterface-members.html
  6438. share/doc/qt5/qtmultimedia/qmediabindableinterface.html
  6439. share/doc/qt5/qtmultimedia/qmediacontainercontrol-members.html
  6440. share/doc/qt5/qtmultimedia/qmediacontainercontrol.html
  6441. share/doc/qt5/qtmultimedia/qmediacontent-members.html
  6442. share/doc/qt5/qtmultimedia/qmediacontent.html
  6443. share/doc/qt5/qtmultimedia/qmediacontrol-members.html
  6444. share/doc/qt5/qtmultimedia/qmediacontrol.html
  6445. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol-members.html
  6446. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol.html
  6447. share/doc/qt5/qtmultimedia/qmediametadata.html
  6448. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol-members.html
  6449. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol.html
  6450. share/doc/qt5/qtmultimedia/qmediaobject-members.html
  6451. share/doc/qt5/qtmultimedia/qmediaobject.html
  6452. share/doc/qt5/qtmultimedia/qmediaplayer-members.html
  6453. share/doc/qt5/qtmultimedia/qmediaplayer-obsolete.html
  6454. share/doc/qt5/qtmultimedia/qmediaplayer.html
  6455. share/doc/qt5/qtmultimedia/qmediaplayercontrol-members.html
  6456. share/doc/qt5/qtmultimedia/qmediaplayercontrol.html
  6457. share/doc/qt5/qtmultimedia/qmediaplaylist-members.html
  6458. share/doc/qt5/qtmultimedia/qmediaplaylist.html
  6459. share/doc/qt5/qtmultimedia/qmediarecorder-members.html
  6460. share/doc/qt5/qtmultimedia/qmediarecorder.html
  6461. share/doc/qt5/qtmultimedia/qmediarecordercontrol-members.html
  6462. share/doc/qt5/qtmultimedia/qmediarecordercontrol.html
  6463. share/doc/qt5/qtmultimedia/qmediaresource-members.html
  6464. share/doc/qt5/qtmultimedia/qmediaresource.html
  6465. share/doc/qt5/qtmultimedia/qmediaservice-members.html
  6466. share/doc/qt5/qtmultimedia/qmediaservice.html
  6467. share/doc/qt5/qtmultimedia/qmediaservicecamerainfointerface-members.html
  6468. share/doc/qt5/qtmultimedia/qmediaservicecamerainfointerface.html
  6469. share/doc/qt5/qtmultimedia/qmediaservicedefaultdeviceinterface-members.html
  6470. share/doc/qt5/qtmultimedia/qmediaservicedefaultdeviceinterface.html
  6471. share/doc/qt5/qtmultimedia/qmediaservicefeaturesinterface-members.html
  6472. share/doc/qt5/qtmultimedia/qmediaservicefeaturesinterface.html
  6473. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin-members.html
  6474. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin.html
  6475. share/doc/qt5/qtmultimedia/qmediaservicesupporteddevicesinterface-members.html
  6476. share/doc/qt5/qtmultimedia/qmediaservicesupporteddevicesinterface.html
  6477. share/doc/qt5/qtmultimedia/qmediaservicesupportedformatsinterface-members.html
  6478. share/doc/qt5/qtmultimedia/qmediaservicesupportedformatsinterface.html
  6479. share/doc/qt5/qtmultimedia/qmediastreamscontrol-members.html
  6480. share/doc/qt5/qtmultimedia/qmediastreamscontrol.html
  6481. share/doc/qt5/qtmultimedia/qmediatimeinterval-members.html
  6482. share/doc/qt5/qtmultimedia/qmediatimeinterval.html
  6483. share/doc/qt5/qtmultimedia/qmediatimerange-members.html
  6484. share/doc/qt5/qtmultimedia/qmediatimerange.html
  6485. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol-members.html
  6486. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol.html
  6487. share/doc/qt5/qtmultimedia/qmetadatareadercontrol-members.html
  6488. share/doc/qt5/qtmultimedia/qmetadatareadercontrol.html
  6489. share/doc/qt5/qtmultimedia/qmetadatawritercontrol-members.html
  6490. share/doc/qt5/qtmultimedia/qmetadatawritercontrol.html
  6491. share/doc/qt5/qtmultimedia/qml-multimedia.html
  6492. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse-members.html
  6493. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse.html
  6494. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodellinear-members.html
  6495. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodellinear.html
  6496. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiocategory-members.html
  6497. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiocategory.html
  6498. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audioengine-members.html
  6499. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audioengine.html
  6500. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiolistener-members.html
  6501. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiolistener.html
  6502. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiosample-members.html
  6503. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiosample.html
  6504. share/doc/qt5/qtmultimedia/qml-qtaudioengine-playvariation-members.html
  6505. share/doc/qt5/qtmultimedia/qml-qtaudioengine-playvariation.html
  6506. share/doc/qt5/qtmultimedia/qml-qtaudioengine-sound-members.html
  6507. share/doc/qt5/qtmultimedia/qml-qtaudioengine-sound.html
  6508. share/doc/qt5/qtmultimedia/qml-qtaudioengine-soundinstance-members.html
  6509. share/doc/qt5/qtmultimedia/qml-qtaudioengine-soundinstance.html
  6510. share/doc/qt5/qtmultimedia/qml-qtmultimedia-audio-members.html
  6511. share/doc/qt5/qtmultimedia/qml-qtmultimedia-audio.html
  6512. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camera-members.html
  6513. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camera.html
  6514. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameracapture-members.html
  6515. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameracapture.html
  6516. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraexposure-members.html
  6517. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraexposure.html
  6518. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraflash-members.html
  6519. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraflash.html
  6520. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerafocus-members.html
  6521. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerafocus.html
  6522. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraimageprocessing-members.html
  6523. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraimageprocessing.html
  6524. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerarecorder-members.html
  6525. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerarecorder.html
  6526. share/doc/qt5/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
  6527. share/doc/qt5/qtmultimedia/qml-qtmultimedia-mediaplayer.html
  6528. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlist-members.html
  6529. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlist.html
  6530. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlistitem-members.html
  6531. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlistitem.html
  6532. share/doc/qt5/qtmultimedia/qml-qtmultimedia-qtmultimedia-members.html
  6533. share/doc/qt5/qtmultimedia/qml-qtmultimedia-qtmultimedia.html
  6534. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radio-members.html
  6535. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radio.html
  6536. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radiodata-members.html
  6537. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radiodata.html
  6538. share/doc/qt5/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
  6539. share/doc/qt5/qtmultimedia/qml-qtmultimedia-soundeffect.html
  6540. share/doc/qt5/qtmultimedia/qml-qtmultimedia-torch-members.html
  6541. share/doc/qt5/qtmultimedia/qml-qtmultimedia-torch.html
  6542. share/doc/qt5/qtmultimedia/qml-qtmultimedia-video-members.html
  6543. share/doc/qt5/qtmultimedia/qml-qtmultimedia-video.html
  6544. share/doc/qt5/qtmultimedia/qml-qtmultimedia-videooutput-members.html
  6545. share/doc/qt5/qtmultimedia/qml-qtmultimedia-videooutput.html
  6546. share/doc/qt5/qtmultimedia/qmultimedia.html
  6547. share/doc/qt5/qtmultimedia/qradiodata-members.html
  6548. share/doc/qt5/qtmultimedia/qradiodata.html
  6549. share/doc/qt5/qtmultimedia/qradiodatacontrol-members.html
  6550. share/doc/qt5/qtmultimedia/qradiodatacontrol.html
  6551. share/doc/qt5/qtmultimedia/qradiotuner-members.html
  6552. share/doc/qt5/qtmultimedia/qradiotuner.html
  6553. share/doc/qt5/qtmultimedia/qradiotunercontrol-members.html
  6554. share/doc/qt5/qtmultimedia/qradiotunercontrol.html
  6555. share/doc/qt5/qtmultimedia/qsound-members.html
  6556. share/doc/qt5/qtmultimedia/qsound.html
  6557. share/doc/qt5/qtmultimedia/qsoundeffect-members.html
  6558. share/doc/qt5/qtmultimedia/qsoundeffect.html
  6559. share/doc/qt5/qtmultimedia/qtaudioengine-qmlmodule.html
  6560. share/doc/qt5/qtmultimedia/qtmultimedia-index.html
  6561. share/doc/qt5/qtmultimedia/qtmultimedia-ios.html
  6562. share/doc/qt5/qtmultimedia/qtmultimedia-module.html
  6563. share/doc/qt5/qtmultimedia/qtmultimedia-modules.html
  6564. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-cpp.html
  6565. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-h.html
  6566. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-pro.html
  6567. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevicesbase-ui.html
  6568. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-example.html
  6569. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-main-cpp.html
  6570. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-audioengine-pro.html
  6571. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-example.html
  6572. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qml.html
  6573. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qmlproject.html
  6574. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-content-myaudioengine-qml.html
  6575. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-cpp.html
  6576. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-h.html
  6577. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-pro.html
  6578. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-example.html
  6579. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-main-cpp.html
  6580. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-cpp.html
  6581. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-h.html
  6582. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-pro.html
  6583. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-example.html
  6584. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-main-cpp.html
  6585. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-cpp.html
  6586. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-h.html
  6587. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-pro.html
  6588. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-ui.html
  6589. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-example.html
  6590. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-main-cpp.html
  6591. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerabutton-qml.html
  6592. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistbutton-qml.html
  6593. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistpopup-qml.html
  6594. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertybutton-qml.html
  6595. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertypopup-qml.html
  6596. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-pro.html
  6597. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qml.html
  6598. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qmlproject.html
  6599. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qrc.html
  6600. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-example.html
  6601. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-focusbutton-qml.html
  6602. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photocapturecontrols-qml.html
  6603. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photopreview-qml.html
  6604. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-popup-qml.html
  6605. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-qmlcamera-cpp.html
  6606. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videocapturecontrols-qml.html
  6607. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videopreview-qml.html
  6608. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-zoomcontrol-qml.html
  6609. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-pro.html
  6610. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-qrc.html
  6611. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-example.html
  6612. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-main-cpp.html
  6613. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-view-qml.html
  6614. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-array-h.html
  6615. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-def-h.html
  6616. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-dynarray-h.html
  6617. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-h.html
  6618. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-pro.html
  6619. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-cpp.html
  6620. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-h.html
  6621. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlen-h.html
  6622. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlenparam-h.html
  6623. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassdirect-h.html
  6624. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassinverse-h.html
  6625. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealselect-h.html
  6626. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealusetrigo-h.html
  6627. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-oscsincos-h.html
  6628. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-cpp.html
  6629. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-h.html
  6630. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-def-h.html
  6631. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-fnc-h.html
  6632. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-int64-h.html
  6633. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-cpp.html
  6634. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-h.html
  6635. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-cpp.html
  6636. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-fnc-h.html
  6637. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-settings-h.html
  6638. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testaccuracy-h.html
  6639. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelperfixlen-h.html
  6640. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelpernormal-h.html
  6641. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testspeed-h.html
  6642. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testwhitenoisegen-h.html
  6643. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-app-pro.html
  6644. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-cpp.html
  6645. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-h.html
  6646. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-cpp.html
  6647. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-h.html
  6648. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-cpp.html
  6649. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-h.html
  6650. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-main-cpp.html
  6651. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-cpp.html
  6652. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-h.html
  6653. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-cpp.html
  6654. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-h.html
  6655. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-cpp.html
  6656. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-h.html
  6657. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-cpp.html
  6658. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-h.html
  6659. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-h.html
  6660. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-qrc.html
  6661. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-cpp.html
  6662. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-h.html
  6663. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-cpp.html
  6664. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-h.html
  6665. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-cpp.html
  6666. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-h.html
  6667. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-cpp.html
  6668. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-h.html
  6669. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-cpp.html
  6670. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-h.html
  6671. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-cpp.html
  6672. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-h.html
  6673. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-example.html
  6674. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-spectrum-pro.html
  6675. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-example.html
  6676. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-main-cpp.html
  6677. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-button-qml.html
  6678. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerabasic-qml.html
  6679. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradrag-qml.html
  6680. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradummy-qml.html
  6681. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreen-qml.html
  6682. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreeninverted-qml.html
  6683. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraitem-qml.html
  6684. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameramove-qml.html
  6685. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraoverlay-qml.html
  6686. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraresize-qml.html
  6687. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerarotate-qml.html
  6688. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraspin-qml.html
  6689. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-content-qml.html
  6690. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-errordialog-qml.html
  6691. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-filebrowser-qml.html
  6692. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-main-qml.html
  6693. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scene-qml.html
  6694. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenebasic-qml.html
  6695. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenedrag-qml.html
  6696. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreen-qml.html
  6697. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreeninverted-qml.html
  6698. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemove-qml.html
  6699. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemulti-qml.html
  6700. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneoverlay-qml.html
  6701. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneresize-qml.html
  6702. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenerotate-qml.html
  6703. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneselectionpanel-qml.html
  6704. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenespin-qml.html
  6705. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-seekcontrol-qml.html
  6706. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videobasic-qml.html
  6707. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodrag-qml.html
  6708. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodummy-qml.html
  6709. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofillmode-qml.html
  6710. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreen-qml.html
  6711. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreeninverted-qml.html
  6712. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoitem-qml.html
  6713. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videometadata-qml.html
  6714. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videomove-qml.html
  6715. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videooverlay-qml.html
  6716. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoplaybackrate-qml.html
  6717. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoresize-qml.html
  6718. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videorotate-qml.html
  6719. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoseek-qml.html
  6720. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videospin-qml.html
  6721. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-pro.html
  6722. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-qrc.html
  6723. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-svg.html
  6724. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-trace-h.html
  6725. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-example.html
  6726. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-cpp.html
  6727. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-h.html
  6728. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-main-cpp.html
  6729. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-button-qml.html
  6730. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-content-qml.html
  6731. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentcamera-qml.html
  6732. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentimage-qml.html
  6733. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentvideo-qml.html
  6734. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-curtain-qml.html
  6735. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-divider-qml.html
  6736. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effect-qml.html
  6737. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectbillboard-qml.html
  6738. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectblackandwhite-qml.html
  6739. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectemboss-qml.html
  6740. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectgaussianblur-qml.html
  6741. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectglow-qml.html
  6742. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectisolate-qml.html
  6743. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectmagnify-qml.html
  6744. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpagecurl-qml.html
  6745. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpassthrough-qml.html
  6746. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpixelate-qml.html
  6747. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectposterize-qml.html
  6748. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectripple-qml.html
  6749. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectselectionlist-qml.html
  6750. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsepia-qml.html
  6751. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsharpen-qml.html
  6752. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectshockwave-qml.html
  6753. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsobeledgedetection1-qml.html
  6754. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttiltshift-qml.html
  6755. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttoon-qml.html
  6756. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectvignette-qml.html
  6757. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwarhol-qml.html
  6758. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwobble-qml.html
  6759. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-filebrowser-qml.html
  6760. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-fileopen-qml.html
  6761. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-hintedmousearea-qml.html
  6762. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-main-qml.html
  6763. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-parameterpanel-qml.html
  6764. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-slider-qml.html
  6765. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-cpp.html
  6766. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-h.html
  6767. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-pro.html
  6768. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-qrc.html
  6769. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-svg.html
  6770. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-trace-h.html
  6771. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-cpp.html
  6772. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-h.html
  6773. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-pro.html
  6774. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-qrc.html
  6775. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-ui.html
  6776. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-example.html
  6777. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-images-shutter-svg.html
  6778. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-cpp.html
  6779. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-h.html
  6780. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-ui.html
  6781. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-main-cpp.html
  6782. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-cpp.html
  6783. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-h.html
  6784. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-ui.html
  6785. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-example.html
  6786. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-cpp.html
  6787. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-h.html
  6788. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-main-cpp.html
  6789. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-cpp.html
  6790. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-h.html
  6791. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-pro.html
  6792. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-cpp.html
  6793. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-h.html
  6794. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-cpp.html
  6795. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-h.html
  6796. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-cpp.html
  6797. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-h.html
  6798. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-example.html
  6799. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-main-cpp.html
  6800. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videographicsitem-pro.html
  6801. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-cpp.html
  6802. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-h.html
  6803. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-example.html
  6804. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-main-cpp.html
  6805. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-cpp.html
  6806. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-h.html
  6807. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videowidget-pro.html
  6808. share/doc/qt5/qtmultimedia/qtmultimedia-qmlmodule.html
  6809. share/doc/qt5/qtmultimedia/qtmultimedia-windows.html
  6810. share/doc/qt5/qtmultimedia/qtmultimedia.index
  6811. share/doc/qt5/qtmultimedia/qtmultimedia.qhp
  6812. share/doc/qt5/qtmultimedia/qtmultimedia.qhp.sha1
  6813. share/doc/qt5/qtmultimedia/qtmultimediawidgets-index.html
  6814. share/doc/qt5/qtmultimedia/qtmultimediawidgets-module.html
  6815. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol-members.html
  6816. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol.html
  6817. share/doc/qt5/qtmultimedia/qvideoencodersettings-members.html
  6818. share/doc/qt5/qtmultimedia/qvideoencodersettings.html
  6819. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol-members.html
  6820. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol.html
  6821. share/doc/qt5/qtmultimedia/qvideofilterrunnable-members.html
  6822. share/doc/qt5/qtmultimedia/qvideofilterrunnable.html
  6823. share/doc/qt5/qtmultimedia/qvideoframe-members.html
  6824. share/doc/qt5/qtmultimedia/qvideoframe.html
  6825. share/doc/qt5/qtmultimedia/qvideoprobe-members.html
  6826. share/doc/qt5/qtmultimedia/qvideoprobe.html
  6827. share/doc/qt5/qtmultimedia/qvideorenderercontrol-members.html
  6828. share/doc/qt5/qtmultimedia/qvideorenderercontrol.html
  6829. share/doc/qt5/qtmultimedia/qvideosurfaceformat-members.html
  6830. share/doc/qt5/qtmultimedia/qvideosurfaceformat.html
  6831. share/doc/qt5/qtmultimedia/qvideowidget-members.html
  6832. share/doc/qt5/qtmultimedia/qvideowidget.html
  6833. share/doc/qt5/qtmultimedia/qvideowidgetcontrol-members.html
  6834. share/doc/qt5/qtmultimedia/qvideowidgetcontrol.html
  6835. share/doc/qt5/qtmultimedia/qvideowindowcontrol-members.html
  6836. share/doc/qt5/qtmultimedia/qvideowindowcontrol.html
  6837. share/doc/qt5/qtmultimedia/radiooverview.html
  6838. share/doc/qt5/qtmultimedia/style/offline-simple.css
  6839. share/doc/qt5/qtmultimedia/style/offline.css
  6840. share/doc/qt5/qtmultimedia/videooverview.html
  6841. share/doc/qt5/qtnetwork.qch
  6842. share/doc/qt5/qtnetwork/bearer-management.html
  6843. share/doc/qt5/qtnetwork/examples-manifest.xml
  6844. share/doc/qt5/qtnetwork/examples-network.html
  6845. share/doc/qt5/qtnetwork/images/arrow_bc.png
  6846. share/doc/qt5/qtnetwork/images/bgrContent.png
  6847. share/doc/qt5/qtnetwork/images/blockingfortuneclient-example.png
  6848. share/doc/qt5/qtnetwork/images/broadcastreceiver-example.png
  6849. share/doc/qt5/qtnetwork/images/broadcastsender-example.png
  6850. share/doc/qt5/qtnetwork/images/btn_next.png
  6851. share/doc/qt5/qtnetwork/images/btn_prev.png
  6852. share/doc/qt5/qtnetwork/images/bullet_dn.png
  6853. share/doc/qt5/qtnetwork/images/bullet_sq.png
  6854. share/doc/qt5/qtnetwork/images/fortuneclient-example.png
  6855. share/doc/qt5/qtnetwork/images/fortuneserver-example.png
  6856. share/doc/qt5/qtnetwork/images/googlesuggest-example.png
  6857. share/doc/qt5/qtnetwork/images/home.png
  6858. share/doc/qt5/qtnetwork/images/http-example.png
  6859. share/doc/qt5/qtnetwork/images/ico_note.png
  6860. share/doc/qt5/qtnetwork/images/ico_note_attention.png
  6861. share/doc/qt5/qtnetwork/images/ico_out.png
  6862. share/doc/qt5/qtnetwork/images/logo.png
  6863. share/doc/qt5/qtnetwork/images/loopback-example.png
  6864. share/doc/qt5/qtnetwork/images/multicastreceiver-example.png
  6865. share/doc/qt5/qtnetwork/images/multicastsender-example.png
  6866. share/doc/qt5/qtnetwork/images/network-chat-example.png
  6867. share/doc/qt5/qtnetwork/images/network-examples.png
  6868. share/doc/qt5/qtnetwork/images/roaming-states.png
  6869. share/doc/qt5/qtnetwork/images/securesocketclient.png
  6870. share/doc/qt5/qtnetwork/images/securesocketclient2.png
  6871. share/doc/qt5/qtnetwork/images/tcpstream.png
  6872. share/doc/qt5/qtnetwork/images/threadedfortuneserver-example.png
  6873. share/doc/qt5/qtnetwork/images/torrent-example.png
  6874. share/doc/qt5/qtnetwork/images/udppackets.png
  6875. share/doc/qt5/qtnetwork/network.html
  6876. share/doc/qt5/qtnetwork/qabstractnetworkcache-members.html
  6877. share/doc/qt5/qtnetwork/qabstractnetworkcache.html
  6878. share/doc/qt5/qtnetwork/qabstractsocket-members.html
  6879. share/doc/qt5/qtnetwork/qabstractsocket.html
  6880. share/doc/qt5/qtnetwork/qauthenticator-members.html
  6881. share/doc/qt5/qtnetwork/qauthenticator.html
  6882. share/doc/qt5/qtnetwork/qdnsdomainnamerecord-members.html
  6883. share/doc/qt5/qtnetwork/qdnsdomainnamerecord.html
  6884. share/doc/qt5/qtnetwork/qdnshostaddressrecord-members.html
  6885. share/doc/qt5/qtnetwork/qdnshostaddressrecord.html
  6886. share/doc/qt5/qtnetwork/qdnslookup-members.html
  6887. share/doc/qt5/qtnetwork/qdnslookup.html
  6888. share/doc/qt5/qtnetwork/qdnsmailexchangerecord-members.html
  6889. share/doc/qt5/qtnetwork/qdnsmailexchangerecord.html
  6890. share/doc/qt5/qtnetwork/qdnsservicerecord-members.html
  6891. share/doc/qt5/qtnetwork/qdnsservicerecord.html
  6892. share/doc/qt5/qtnetwork/qdnstextrecord-members.html
  6893. share/doc/qt5/qtnetwork/qdnstextrecord.html
  6894. share/doc/qt5/qtnetwork/qhostaddress-members.html
  6895. share/doc/qt5/qtnetwork/qhostaddress.html
  6896. share/doc/qt5/qtnetwork/qhostinfo-members.html
  6897. share/doc/qt5/qtnetwork/qhostinfo.html
  6898. share/doc/qt5/qtnetwork/qhstspolicy-members.html
  6899. share/doc/qt5/qtnetwork/qhstspolicy.html
  6900. share/doc/qt5/qtnetwork/qhttpmultipart-members.html
  6901. share/doc/qt5/qtnetwork/qhttpmultipart.html
  6902. share/doc/qt5/qtnetwork/qhttppart-members.html
  6903. share/doc/qt5/qtnetwork/qhttppart.html
  6904. share/doc/qt5/qtnetwork/qlocalserver-members.html
  6905. share/doc/qt5/qtnetwork/qlocalserver.html
  6906. share/doc/qt5/qtnetwork/qlocalsocket-members.html
  6907. share/doc/qt5/qtnetwork/qlocalsocket.html
  6908. share/doc/qt5/qtnetwork/qnetworkaccessmanager-members.html
  6909. share/doc/qt5/qtnetwork/qnetworkaccessmanager.html
  6910. share/doc/qt5/qtnetwork/qnetworkaddressentry-members.html
  6911. share/doc/qt5/qtnetwork/qnetworkaddressentry.html
  6912. share/doc/qt5/qtnetwork/qnetworkcachemetadata-members.html
  6913. share/doc/qt5/qtnetwork/qnetworkcachemetadata.html
  6914. share/doc/qt5/qtnetwork/qnetworkconfiguration-members.html
  6915. share/doc/qt5/qtnetwork/qnetworkconfiguration.html
  6916. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager-members.html
  6917. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager.html
  6918. share/doc/qt5/qtnetwork/qnetworkcookie-members.html
  6919. share/doc/qt5/qtnetwork/qnetworkcookie.html
  6920. share/doc/qt5/qtnetwork/qnetworkcookiejar-members.html
  6921. share/doc/qt5/qtnetwork/qnetworkcookiejar.html
  6922. share/doc/qt5/qtnetwork/qnetworkdatagram-members.html
  6923. share/doc/qt5/qtnetwork/qnetworkdatagram.html
  6924. share/doc/qt5/qtnetwork/qnetworkdiskcache-members.html
  6925. share/doc/qt5/qtnetwork/qnetworkdiskcache.html
  6926. share/doc/qt5/qtnetwork/qnetworkinterface-members.html
  6927. share/doc/qt5/qtnetwork/qnetworkinterface.html
  6928. share/doc/qt5/qtnetwork/qnetworkproxy-members.html
  6929. share/doc/qt5/qtnetwork/qnetworkproxy.html
  6930. share/doc/qt5/qtnetwork/qnetworkproxyfactory-members.html
  6931. share/doc/qt5/qtnetwork/qnetworkproxyfactory.html
  6932. share/doc/qt5/qtnetwork/qnetworkproxyquery-members.html
  6933. share/doc/qt5/qtnetwork/qnetworkproxyquery.html
  6934. share/doc/qt5/qtnetwork/qnetworkreply-members.html
  6935. share/doc/qt5/qtnetwork/qnetworkreply.html
  6936. share/doc/qt5/qtnetwork/qnetworkrequest-members.html
  6937. share/doc/qt5/qtnetwork/qnetworkrequest.html
  6938. share/doc/qt5/qtnetwork/qnetworksession-members.html
  6939. share/doc/qt5/qtnetwork/qnetworksession.html
  6940. share/doc/qt5/qtnetwork/qsctpserver-members.html
  6941. share/doc/qt5/qtnetwork/qsctpserver.html
  6942. share/doc/qt5/qtnetwork/qsctpsocket-members.html
  6943. share/doc/qt5/qtnetwork/qsctpsocket.html
  6944. share/doc/qt5/qtnetwork/qssl-obsolete.html
  6945. share/doc/qt5/qtnetwork/qssl.html
  6946. share/doc/qt5/qtnetwork/qsslcertificate-members.html
  6947. share/doc/qt5/qtnetwork/qsslcertificate-obsolete.html
  6948. share/doc/qt5/qtnetwork/qsslcertificate.html
  6949. share/doc/qt5/qtnetwork/qsslcertificateextension-members.html
  6950. share/doc/qt5/qtnetwork/qsslcertificateextension.html
  6951. share/doc/qt5/qtnetwork/qsslcipher-members.html
  6952. share/doc/qt5/qtnetwork/qsslcipher.html
  6953. share/doc/qt5/qtnetwork/qsslconfiguration-members.html
  6954. share/doc/qt5/qtnetwork/qsslconfiguration.html
  6955. share/doc/qt5/qtnetwork/qssldiffiehellmanparameters-members.html
  6956. share/doc/qt5/qtnetwork/qssldiffiehellmanparameters.html
  6957. share/doc/qt5/qtnetwork/qsslellipticcurve-members.html
  6958. share/doc/qt5/qtnetwork/qsslellipticcurve.html
  6959. share/doc/qt5/qtnetwork/qsslerror-members.html
  6960. share/doc/qt5/qtnetwork/qsslerror.html
  6961. share/doc/qt5/qtnetwork/qsslkey-members.html
  6962. share/doc/qt5/qtnetwork/qsslkey.html
  6963. share/doc/qt5/qtnetwork/qsslpresharedkeyauthenticator-members.html
  6964. share/doc/qt5/qtnetwork/qsslpresharedkeyauthenticator.html
  6965. share/doc/qt5/qtnetwork/qsslsocket-members.html
  6966. share/doc/qt5/qtnetwork/qsslsocket-obsolete.html
  6967. share/doc/qt5/qtnetwork/qsslsocket.html
  6968. share/doc/qt5/qtnetwork/qtcpserver-members.html
  6969. share/doc/qt5/qtnetwork/qtcpserver.html
  6970. share/doc/qt5/qtnetwork/qtcpsocket-members.html
  6971. share/doc/qt5/qtnetwork/qtcpsocket.html
  6972. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-cpp.html
  6973. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-h.html
  6974. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingfortuneclient-pro.html
  6975. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-example.html
  6976. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-cpp.html
  6977. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-h.html
  6978. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-main-cpp.html
  6979. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-broadcastreceiver-pro.html
  6980. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-example.html
  6981. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-main-cpp.html
  6982. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-receiver-cpp.html
  6983. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-receiver-h.html
  6984. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-broadcastsender-pro.html
  6985. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-example.html
  6986. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-main-cpp.html
  6987. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-sender-cpp.html
  6988. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-sender-h.html
  6989. share/doc/qt5/qtnetwork/qtnetwork-download-download-pro.html
  6990. share/doc/qt5/qtnetwork/qtnetwork-download-example.html
  6991. share/doc/qt5/qtnetwork/qtnetwork-download-main-cpp.html
  6992. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-cpp.html
  6993. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-h.html
  6994. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-pro.html
  6995. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-example.html
  6996. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-main-cpp.html
  6997. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-textprogressbar-cpp.html
  6998. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-textprogressbar-h.html
  6999. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-client-cpp.html
  7000. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-client-h.html
  7001. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-example.html
  7002. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-fortuneclient-pro.html
  7003. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-main-cpp.html
  7004. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-example.html
  7005. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-fortuneserver-pro.html
  7006. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-main-cpp.html
  7007. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-server-cpp.html
  7008. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-server-h.html
  7009. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-example.html
  7010. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-cpp.html
  7011. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-h.html
  7012. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-pro.html
  7013. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-main-cpp.html
  7014. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-searchbox-cpp.html
  7015. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-searchbox-h.html
  7016. share/doc/qt5/qtnetwork/qtnetwork-http-authenticationdialog-ui.html
  7017. share/doc/qt5/qtnetwork/qtnetwork-http-example.html
  7018. share/doc/qt5/qtnetwork/qtnetwork-http-http-pro.html
  7019. share/doc/qt5/qtnetwork/qtnetwork-http-httpwindow-cpp.html
  7020. share/doc/qt5/qtnetwork/qtnetwork-http-httpwindow-h.html
  7021. share/doc/qt5/qtnetwork/qtnetwork-http-main-cpp.html
  7022. share/doc/qt5/qtnetwork/qtnetwork-index.html
  7023. share/doc/qt5/qtnetwork/qtnetwork-loopback-dialog-cpp.html
  7024. share/doc/qt5/qtnetwork/qtnetwork-loopback-dialog-h.html
  7025. share/doc/qt5/qtnetwork/qtnetwork-loopback-example.html
  7026. share/doc/qt5/qtnetwork/qtnetwork-loopback-loopback-pro.html
  7027. share/doc/qt5/qtnetwork/qtnetwork-loopback-main-cpp.html
  7028. share/doc/qt5/qtnetwork/qtnetwork-module.html
  7029. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-example.html
  7030. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-main-cpp.html
  7031. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-multicastreceiver-pro.html
  7032. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-receiver-cpp.html
  7033. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-receiver-h.html
  7034. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-example.html
  7035. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-main-cpp.html
  7036. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-multicastsender-pro.html
  7037. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-sender-cpp.html
  7038. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-sender-h.html
  7039. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-cpp.html
  7040. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-h.html
  7041. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-ui.html
  7042. share/doc/qt5/qtnetwork/qtnetwork-network-chat-client-cpp.html
  7043. share/doc/qt5/qtnetwork/qtnetwork-network-chat-client-h.html
  7044. share/doc/qt5/qtnetwork/qtnetwork-network-chat-connection-cpp.html
  7045. share/doc/qt5/qtnetwork/qtnetwork-network-chat-connection-h.html
  7046. share/doc/qt5/qtnetwork/qtnetwork-network-chat-example.html
  7047. share/doc/qt5/qtnetwork/qtnetwork-network-chat-main-cpp.html
  7048. share/doc/qt5/qtnetwork/qtnetwork-network-chat-network-chat-pro.html
  7049. share/doc/qt5/qtnetwork/qtnetwork-network-chat-peermanager-cpp.html
  7050. share/doc/qt5/qtnetwork/qtnetwork-network-chat-peermanager-h.html
  7051. share/doc/qt5/qtnetwork/qtnetwork-network-chat-server-cpp.html
  7052. share/doc/qt5/qtnetwork/qtnetwork-network-chat-server-h.html
  7053. share/doc/qt5/qtnetwork/qtnetwork-programming.html
  7054. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-cpp.html
  7055. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-h.html
  7056. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-ui.html
  7057. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-example.html
  7058. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-main-cpp.html
  7059. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-securesocketclient-pro.html
  7060. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-securesocketclient-qrc.html
  7061. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-cpp.html
  7062. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-h.html
  7063. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-ui.html
  7064. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslerrors-ui.html
  7065. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-dialog-cpp.html
  7066. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-dialog-h.html
  7067. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-example.html
  7068. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-cpp.html
  7069. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-h.html
  7070. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-cpp.html
  7071. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-h.html
  7072. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-main-cpp.html
  7073. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-threadedfortuneserver-pro.html
  7074. share/doc/qt5/qtnetwork/qtnetwork-torrent-addtorrentdialog-cpp.html
  7075. share/doc/qt5/qtnetwork/qtnetwork-torrent-addtorrentdialog-h.html
  7076. share/doc/qt5/qtnetwork/qtnetwork-torrent-bencodeparser-cpp.html
  7077. share/doc/qt5/qtnetwork/qtnetwork-torrent-bencodeparser-h.html
  7078. share/doc/qt5/qtnetwork/qtnetwork-torrent-connectionmanager-cpp.html
  7079. share/doc/qt5/qtnetwork/qtnetwork-torrent-connectionmanager-h.html
  7080. share/doc/qt5/qtnetwork/qtnetwork-torrent-example.html
  7081. share/doc/qt5/qtnetwork/qtnetwork-torrent-filemanager-cpp.html
  7082. share/doc/qt5/qtnetwork/qtnetwork-torrent-filemanager-h.html
  7083. share/doc/qt5/qtnetwork/qtnetwork-torrent-forms-addtorrentform-ui.html
  7084. share/doc/qt5/qtnetwork/qtnetwork-torrent-icons-qrc.html
  7085. share/doc/qt5/qtnetwork/qtnetwork-torrent-main-cpp.html
  7086. share/doc/qt5/qtnetwork/qtnetwork-torrent-mainwindow-cpp.html
  7087. share/doc/qt5/qtnetwork/qtnetwork-torrent-mainwindow-h.html
  7088. share/doc/qt5/qtnetwork/qtnetwork-torrent-metainfo-cpp.html
  7089. share/doc/qt5/qtnetwork/qtnetwork-torrent-metainfo-h.html
  7090. share/doc/qt5/qtnetwork/qtnetwork-torrent-peerwireclient-cpp.html
  7091. share/doc/qt5/qtnetwork/qtnetwork-torrent-peerwireclient-h.html
  7092. share/doc/qt5/qtnetwork/qtnetwork-torrent-ratecontroller-cpp.html
  7093. share/doc/qt5/qtnetwork/qtnetwork-torrent-ratecontroller-h.html
  7094. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrent-pro.html
  7095. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentclient-cpp.html
  7096. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentclient-h.html
  7097. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentserver-cpp.html
  7098. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentserver-h.html
  7099. share/doc/qt5/qtnetwork/qtnetwork-torrent-trackerclient-cpp.html
  7100. share/doc/qt5/qtnetwork/qtnetwork-torrent-trackerclient-h.html
  7101. share/doc/qt5/qtnetwork/qtnetwork.index
  7102. share/doc/qt5/qtnetwork/qtnetwork.qhp
  7103. share/doc/qt5/qtnetwork/qtnetwork.qhp.sha1
  7104. share/doc/qt5/qtnetwork/qtnetwork.tags
  7105. share/doc/qt5/qtnetwork/qudpsocket-members.html
  7106. share/doc/qt5/qtnetwork/qudpsocket.html
  7107. share/doc/qt5/qtnetwork/ssl.html
  7108. share/doc/qt5/qtnetwork/style/offline-simple.css
  7109. share/doc/qt5/qtnetwork/style/offline.css
  7110. share/doc/qt5/qtnfc.qch
  7111. share/doc/qt5/qtnfc/examples-manifest.xml
  7112. share/doc/qt5/qtnfc/images/annotatedurl.png
  7113. share/doc/qt5/qtnfc/images/arrow_bc.png
  7114. share/doc/qt5/qtnfc/images/bgrContent.png
  7115. share/doc/qt5/qtnfc/images/btn_next.png
  7116. share/doc/qt5/qtnfc/images/btn_prev.png
  7117. share/doc/qt5/qtnfc/images/bullet_dn.png
  7118. share/doc/qt5/qtnfc/images/bullet_sq.png
  7119. share/doc/qt5/qtnfc/images/corkboard.png
  7120. share/doc/qt5/qtnfc/images/home.png
  7121. share/doc/qt5/qtnfc/images/ico_note.png
  7122. share/doc/qt5/qtnfc/images/ico_note_attention.png
  7123. share/doc/qt5/qtnfc/images/ico_out.png
  7124. share/doc/qt5/qtnfc/images/logo.png
  7125. share/doc/qt5/qtnfc/images/ndefeditor.png
  7126. share/doc/qt5/qtnfc/images/qml-poster-example.png
  7127. share/doc/qt5/qtnfc/nfc-android.html
  7128. share/doc/qt5/qtnfc/nfc-examples.html
  7129. share/doc/qt5/qtnfc/qml-qtnfc-ndeffilter-members.html
  7130. share/doc/qt5/qtnfc/qml-qtnfc-ndeffilter.html
  7131. share/doc/qt5/qtnfc/qml-qtnfc-ndefmimerecord-members.html
  7132. share/doc/qt5/qtnfc/qml-qtnfc-ndefmimerecord.html
  7133. share/doc/qt5/qtnfc/qml-qtnfc-ndefrecord-members.html
  7134. share/doc/qt5/qtnfc/qml-qtnfc-ndefrecord.html
  7135. share/doc/qt5/qtnfc/qml-qtnfc-ndeftextrecord-members.html
  7136. share/doc/qt5/qtnfc/qml-qtnfc-ndeftextrecord.html
  7137. share/doc/qt5/qtnfc/qml-qtnfc-ndefurirecord-members.html
  7138. share/doc/qt5/qtnfc/qml-qtnfc-ndefurirecord.html
  7139. share/doc/qt5/qtnfc/qml-qtnfc-nearfield-members.html
  7140. share/doc/qt5/qtnfc/qml-qtnfc-nearfield.html
  7141. share/doc/qt5/qtnfc/qndeffilter-members.html
  7142. share/doc/qt5/qtnfc/qndeffilter-record-members.html
  7143. share/doc/qt5/qtnfc/qndeffilter-record.html
  7144. share/doc/qt5/qtnfc/qndeffilter.html
  7145. share/doc/qt5/qtnfc/qndefmessage-members.html
  7146. share/doc/qt5/qtnfc/qndefmessage.html
  7147. share/doc/qt5/qtnfc/qndefnfcsmartposterrecord-members.html
  7148. share/doc/qt5/qtnfc/qndefnfcsmartposterrecord.html
  7149. share/doc/qt5/qtnfc/qndefnfctextrecord-members.html
  7150. share/doc/qt5/qtnfc/qndefnfctextrecord.html
  7151. share/doc/qt5/qtnfc/qndefnfcurirecord-members.html
  7152. share/doc/qt5/qtnfc/qndefnfcurirecord.html
  7153. share/doc/qt5/qtnfc/qndefrecord-members.html
  7154. share/doc/qt5/qtnfc/qndefrecord.html
  7155. share/doc/qt5/qtnfc/qnearfieldmanager-members.html
  7156. share/doc/qt5/qtnfc/qnearfieldmanager.html
  7157. share/doc/qt5/qtnfc/qnearfieldsharemanager-members.html
  7158. share/doc/qt5/qtnfc/qnearfieldsharemanager.html
  7159. share/doc/qt5/qtnfc/qnearfieldsharetarget-members.html
  7160. share/doc/qt5/qtnfc/qnearfieldsharetarget.html
  7161. share/doc/qt5/qtnfc/qnearfieldtarget-members.html
  7162. share/doc/qt5/qtnfc/qnearfieldtarget-requestid-members.html
  7163. share/doc/qt5/qtnfc/qnearfieldtarget-requestid.html
  7164. share/doc/qt5/qtnfc/qnearfieldtarget-requestidprivate.html
  7165. share/doc/qt5/qtnfc/qnearfieldtarget.html
  7166. share/doc/qt5/qtnfc/qqmlndefrecord-members.html
  7167. share/doc/qt5/qtnfc/qqmlndefrecord.html
  7168. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-cpp.html
  7169. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-h.html
  7170. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-pro.html
  7171. share/doc/qt5/qtnfc/qtnfc-annotatedurl-example.html
  7172. share/doc/qt5/qtnfc/qtnfc-annotatedurl-main-cpp.html
  7173. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-cpp.html
  7174. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-h.html
  7175. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-ui.html
  7176. share/doc/qt5/qtnfc/qtnfc-corkboard-android-androidmanifest-xml.html
  7177. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboard-pro.html
  7178. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboard-qrc.html
  7179. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboards-qml.html
  7180. share/doc/qt5/qtnfc/qtnfc-corkboard-example.html
  7181. share/doc/qt5/qtnfc/qtnfc-corkboard-main-cpp.html
  7182. share/doc/qt5/qtnfc/qtnfc-corkboard-mode-qml.html
  7183. share/doc/qt5/qtnfc/qtnfc-index.html
  7184. share/doc/qt5/qtnfc/qtnfc-module.html
  7185. share/doc/qt5/qtnfc/qtnfc-ndefeditor-example.html
  7186. share/doc/qt5/qtnfc/qtnfc-ndefeditor-main-cpp.html
  7187. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-cpp.html
  7188. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-h.html
  7189. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-ui.html
  7190. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-cpp.html
  7191. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-h.html
  7192. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-ui.html
  7193. share/doc/qt5/qtnfc/qtnfc-ndefeditor-ndefeditor-pro.html
  7194. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-cpp.html
  7195. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-h.html
  7196. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-ui.html
  7197. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-cpp.html
  7198. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-h.html
  7199. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-ui.html
  7200. share/doc/qt5/qtnfc/qtnfc-overview.html
  7201. share/doc/qt5/qtnfc/qtnfc-poster-example.html
  7202. share/doc/qt5/qtnfc/qtnfc-poster-poster-pro.html
  7203. share/doc/qt5/qtnfc/qtnfc-poster-poster-qml.html
  7204. share/doc/qt5/qtnfc/qtnfc-poster-poster-qrc.html
  7205. share/doc/qt5/qtnfc/qtnfc-poster-qmlposter-cpp.html
  7206. share/doc/qt5/qtnfc/qtnfc-qmlmodule.html
  7207. share/doc/qt5/qtnfc/qtnfc.index
  7208. share/doc/qt5/qtnfc/qtnfc.qhp
  7209. share/doc/qt5/qtnfc/qtnfc.qhp.sha1
  7210. share/doc/qt5/qtnfc/qtnfc.tags
  7211. share/doc/qt5/qtnfc/style/offline-simple.css
  7212. share/doc/qt5/qtnfc/style/offline.css
  7213. share/doc/qt5/qtopengl.qch
  7214. share/doc/qt5/qtopengl/examples-manifest.xml
  7215. share/doc/qt5/qtopengl/examples-widgets-opengl.html
  7216. share/doc/qt5/qtopengl/images/2dpainting-example.png
  7217. share/doc/qt5/qtopengl/images/arrow_bc.png
  7218. share/doc/qt5/qtopengl/images/bgrContent.png
  7219. share/doc/qt5/qtopengl/images/btn_next.png
  7220. share/doc/qt5/qtopengl/images/btn_prev.png
  7221. share/doc/qt5/qtopengl/images/bullet_dn.png
  7222. share/doc/qt5/qtopengl/images/bullet_sq.png
  7223. share/doc/qt5/qtopengl/images/cube.png
  7224. share/doc/qt5/qtopengl/images/cube_faces.png
  7225. share/doc/qt5/qtopengl/images/hellogl2-example.png
  7226. share/doc/qt5/qtopengl/images/home.png
  7227. share/doc/qt5/qtopengl/images/ico_note.png
  7228. share/doc/qt5/qtopengl/images/ico_note_attention.png
  7229. share/doc/qt5/qtopengl/images/ico_out.png
  7230. share/doc/qt5/qtopengl/images/logo.png
  7231. share/doc/qt5/qtopengl/images/opengl-examples.png
  7232. share/doc/qt5/qtopengl/images/textures-example.png
  7233. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side1.png
  7234. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side2.png
  7235. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side3.png
  7236. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side4.png
  7237. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side5.png
  7238. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side6.png
  7239. share/doc/qt5/qtopengl/qgl.html
  7240. share/doc/qt5/qtopengl/qglbuffer-members.html
  7241. share/doc/qt5/qtopengl/qglbuffer.html
  7242. share/doc/qt5/qtopengl/qglcolormap-members.html
  7243. share/doc/qt5/qtopengl/qglcolormap.html
  7244. share/doc/qt5/qtopengl/qglcontext-members.html
  7245. share/doc/qt5/qtopengl/qglcontext-obsolete.html
  7246. share/doc/qt5/qtopengl/qglcontext.html
  7247. share/doc/qt5/qtopengl/qglformat-members.html
  7248. share/doc/qt5/qtopengl/qglformat.html
  7249. share/doc/qt5/qtopengl/qglframebufferobject-members.html
  7250. share/doc/qt5/qtopengl/qglframebufferobject.html
  7251. share/doc/qt5/qtopengl/qglframebufferobjectformat-members.html
  7252. share/doc/qt5/qtopengl/qglframebufferobjectformat.html
  7253. share/doc/qt5/qtopengl/qglfunctions-members.html
  7254. share/doc/qt5/qtopengl/qglfunctions.html
  7255. share/doc/qt5/qtopengl/qglpixelbuffer-members.html
  7256. share/doc/qt5/qtopengl/qglpixelbuffer.html
  7257. share/doc/qt5/qtopengl/qglshader-members.html
  7258. share/doc/qt5/qtopengl/qglshader.html
  7259. share/doc/qt5/qtopengl/qglshaderprogram-members.html
  7260. share/doc/qt5/qtopengl/qglshaderprogram.html
  7261. share/doc/qt5/qtopengl/qglwidget-members.html
  7262. share/doc/qt5/qtopengl/qglwidget-obsolete.html
  7263. share/doc/qt5/qtopengl/qglwidget.html
  7264. share/doc/qt5/qtopengl/qtopengl-2dpainting-2dpainting-pro.html
  7265. share/doc/qt5/qtopengl/qtopengl-2dpainting-example.html
  7266. share/doc/qt5/qtopengl/qtopengl-2dpainting-glwidget-cpp.html
  7267. share/doc/qt5/qtopengl/qtopengl-2dpainting-glwidget-h.html
  7268. share/doc/qt5/qtopengl/qtopengl-2dpainting-helper-cpp.html
  7269. share/doc/qt5/qtopengl/qtopengl-2dpainting-helper-h.html
  7270. share/doc/qt5/qtopengl/qtopengl-2dpainting-main-cpp.html
  7271. share/doc/qt5/qtopengl/qtopengl-2dpainting-widget-cpp.html
  7272. share/doc/qt5/qtopengl/qtopengl-2dpainting-widget-h.html
  7273. share/doc/qt5/qtopengl/qtopengl-2dpainting-window-cpp.html
  7274. share/doc/qt5/qtopengl/qtopengl-2dpainting-window-h.html
  7275. share/doc/qt5/qtopengl/qtopengl-cube-cube-pro.html
  7276. share/doc/qt5/qtopengl/qtopengl-cube-example.html
  7277. share/doc/qt5/qtopengl/qtopengl-cube-fshader-glsl.html
  7278. share/doc/qt5/qtopengl/qtopengl-cube-geometryengine-cpp.html
  7279. share/doc/qt5/qtopengl/qtopengl-cube-geometryengine-h.html
  7280. share/doc/qt5/qtopengl/qtopengl-cube-main-cpp.html
  7281. share/doc/qt5/qtopengl/qtopengl-cube-mainwidget-cpp.html
  7282. share/doc/qt5/qtopengl/qtopengl-cube-mainwidget-h.html
  7283. share/doc/qt5/qtopengl/qtopengl-cube-shaders-qrc.html
  7284. share/doc/qt5/qtopengl/qtopengl-cube-textures-qrc.html
  7285. share/doc/qt5/qtopengl/qtopengl-cube-vshader-glsl.html
  7286. share/doc/qt5/qtopengl/qtopengl-hellogl2-example.html
  7287. share/doc/qt5/qtopengl/qtopengl-hellogl2-glwidget-cpp.html
  7288. share/doc/qt5/qtopengl/qtopengl-hellogl2-glwidget-h.html
  7289. share/doc/qt5/qtopengl/qtopengl-hellogl2-hellogl2-pro.html
  7290. share/doc/qt5/qtopengl/qtopengl-hellogl2-logo-cpp.html
  7291. share/doc/qt5/qtopengl/qtopengl-hellogl2-logo-h.html
  7292. share/doc/qt5/qtopengl/qtopengl-hellogl2-main-cpp.html
  7293. share/doc/qt5/qtopengl/qtopengl-hellogl2-mainwindow-cpp.html
  7294. share/doc/qt5/qtopengl/qtopengl-hellogl2-mainwindow-h.html
  7295. share/doc/qt5/qtopengl/qtopengl-hellogl2-window-cpp.html
  7296. share/doc/qt5/qtopengl/qtopengl-hellogl2-window-h.html
  7297. share/doc/qt5/qtopengl/qtopengl-index.html
  7298. share/doc/qt5/qtopengl/qtopengl-module.html
  7299. share/doc/qt5/qtopengl/qtopengl-textures-example.html
  7300. share/doc/qt5/qtopengl/qtopengl-textures-glwidget-cpp.html
  7301. share/doc/qt5/qtopengl/qtopengl-textures-glwidget-h.html
  7302. share/doc/qt5/qtopengl/qtopengl-textures-main-cpp.html
  7303. share/doc/qt5/qtopengl/qtopengl-textures-textures-pro.html
  7304. share/doc/qt5/qtopengl/qtopengl-textures-textures-qrc.html
  7305. share/doc/qt5/qtopengl/qtopengl-textures-window-cpp.html
  7306. share/doc/qt5/qtopengl/qtopengl-textures-window-h.html
  7307. share/doc/qt5/qtopengl/qtopengl.index
  7308. share/doc/qt5/qtopengl/qtopengl.qhp
  7309. share/doc/qt5/qtopengl/qtopengl.qhp.sha1
  7310. share/doc/qt5/qtopengl/style/offline-simple.css
  7311. share/doc/qt5/qtopengl/style/offline.css
  7312. share/doc/qt5/qtplatformheaders.qch
  7313. share/doc/qt5/qtplatformheaders/images/arrow_bc.png
  7314. share/doc/qt5/qtplatformheaders/images/bgrContent.png
  7315. share/doc/qt5/qtplatformheaders/images/btn_next.png
  7316. share/doc/qt5/qtplatformheaders/images/btn_prev.png
  7317. share/doc/qt5/qtplatformheaders/images/bullet_dn.png
  7318. share/doc/qt5/qtplatformheaders/images/bullet_sq.png
  7319. share/doc/qt5/qtplatformheaders/images/home.png
  7320. share/doc/qt5/qtplatformheaders/images/ico_note.png
  7321. share/doc/qt5/qtplatformheaders/images/ico_note_attention.png
  7322. share/doc/qt5/qtplatformheaders/images/ico_out.png
  7323. share/doc/qt5/qtplatformheaders/images/logo.png
  7324. share/doc/qt5/qtplatformheaders/qcocoanativecontext-members.html
  7325. share/doc/qt5/qtplatformheaders/qcocoanativecontext.html
  7326. share/doc/qt5/qtplatformheaders/qcocoawindowfunctions-members.html
  7327. share/doc/qt5/qtplatformheaders/qcocoawindowfunctions.html
  7328. share/doc/qt5/qtplatformheaders/qeglfsfunctions-members.html
  7329. share/doc/qt5/qtplatformheaders/qeglfsfunctions.html
  7330. share/doc/qt5/qtplatformheaders/qeglnativecontext-members.html
  7331. share/doc/qt5/qtplatformheaders/qeglnativecontext.html
  7332. share/doc/qt5/qtplatformheaders/qglxnativecontext-members.html
  7333. share/doc/qt5/qtplatformheaders/qglxnativecontext.html
  7334. share/doc/qt5/qtplatformheaders/qtplatformheaders-index.html
  7335. share/doc/qt5/qtplatformheaders/qtplatformheaders-module.html
  7336. share/doc/qt5/qtplatformheaders/qtplatformheaders.index
  7337. share/doc/qt5/qtplatformheaders/qtplatformheaders.qhp
  7338. share/doc/qt5/qtplatformheaders/qtplatformheaders.qhp.sha1
  7339. share/doc/qt5/qtplatformheaders/qwglnativecontext-members.html
  7340. share/doc/qt5/qtplatformheaders/qwglnativecontext.html
  7341. share/doc/qt5/qtplatformheaders/qwindowswindowfunctions-members.html
  7342. share/doc/qt5/qtplatformheaders/qwindowswindowfunctions.html
  7343. share/doc/qt5/qtplatformheaders/qxcbwindowfunctions-members.html
  7344. share/doc/qt5/qtplatformheaders/qxcbwindowfunctions.html
  7345. share/doc/qt5/qtplatformheaders/style/offline-simple.css
  7346. share/doc/qt5/qtplatformheaders/style/offline.css
  7347. share/doc/qt5/qtpositioning.qch
  7348. share/doc/qt5/qtpositioning/examples-manifest.xml
  7349. share/doc/qt5/qtpositioning/images/arrow_bc.png
  7350. share/doc/qt5/qtpositioning/images/bgrContent.png
  7351. share/doc/qt5/qtpositioning/images/btn_next.png
  7352. share/doc/qt5/qtpositioning/images/btn_prev.png
  7353. share/doc/qt5/qtpositioning/images/bullet_dn.png
  7354. share/doc/qt5/qtpositioning/images/bullet_sq.png
  7355. share/doc/qt5/qtpositioning/images/example-satelliteinfo.png
  7356. share/doc/qt5/qtpositioning/images/example-weatherinfo.png
  7357. share/doc/qt5/qtpositioning/images/home.png
  7358. share/doc/qt5/qtpositioning/images/ico_note.png
  7359. share/doc/qt5/qtpositioning/images/ico_note_attention.png
  7360. share/doc/qt5/qtpositioning/images/ico_out.png
  7361. share/doc/qt5/qtpositioning/images/logo.png
  7362. share/doc/qt5/qtpositioning/images/qml-flickr-1.jpg
  7363. share/doc/qt5/qtpositioning/location-positioning-cpp.html
  7364. share/doc/qt5/qtpositioning/location-positioning-qml.html
  7365. share/doc/qt5/qtpositioning/positioning-cpp-qml.html
  7366. share/doc/qt5/qtpositioning/qgeoaddress-members.html
  7367. share/doc/qt5/qtpositioning/qgeoaddress.html
  7368. share/doc/qt5/qtpositioning/qgeoareamonitorinfo-members.html
  7369. share/doc/qt5/qtpositioning/qgeoareamonitorinfo.html
  7370. share/doc/qt5/qtpositioning/qgeoareamonitorsource-members.html
  7371. share/doc/qt5/qtpositioning/qgeoareamonitorsource.html
  7372. share/doc/qt5/qtpositioning/qgeocircle-members.html
  7373. share/doc/qt5/qtpositioning/qgeocircle.html
  7374. share/doc/qt5/qtpositioning/qgeocoordinate-members.html
  7375. share/doc/qt5/qtpositioning/qgeocoordinate.html
  7376. share/doc/qt5/qtpositioning/qgeolocation-members.html
  7377. share/doc/qt5/qtpositioning/qgeolocation.html
  7378. share/doc/qt5/qtpositioning/qgeopath-members.html
  7379. share/doc/qt5/qtpositioning/qgeopath.html
  7380. share/doc/qt5/qtpositioning/qgeopositioninfo-members.html
  7381. share/doc/qt5/qtpositioning/qgeopositioninfo.html
  7382. share/doc/qt5/qtpositioning/qgeopositioninfosource-members.html
  7383. share/doc/qt5/qtpositioning/qgeopositioninfosource.html
  7384. share/doc/qt5/qtpositioning/qgeopositioninfosourcefactory-members.html
  7385. share/doc/qt5/qtpositioning/qgeopositioninfosourcefactory.html
  7386. share/doc/qt5/qtpositioning/qgeorectangle-members.html
  7387. share/doc/qt5/qtpositioning/qgeorectangle.html
  7388. share/doc/qt5/qtpositioning/qgeosatelliteinfo-members.html
  7389. share/doc/qt5/qtpositioning/qgeosatelliteinfo.html
  7390. share/doc/qt5/qtpositioning/qgeosatelliteinfosource-members.html
  7391. share/doc/qt5/qtpositioning/qgeosatelliteinfosource.html
  7392. share/doc/qt5/qtpositioning/qgeoshape-members.html
  7393. share/doc/qt5/qtpositioning/qgeoshape-obsolete.html
  7394. share/doc/qt5/qtpositioning/qgeoshape.html
  7395. share/doc/qt5/qtpositioning/qml-coordinate.html
  7396. share/doc/qt5/qtpositioning/qml-geocircle.html
  7397. share/doc/qt5/qtpositioning/qml-geopath.html
  7398. share/doc/qt5/qtpositioning/qml-georectangle.html
  7399. share/doc/qt5/qtpositioning/qml-geoshape.html
  7400. share/doc/qt5/qtpositioning/qml-qtpositioning-address-members.html
  7401. share/doc/qt5/qtpositioning/qml-qtpositioning-address.html
  7402. share/doc/qt5/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
  7403. share/doc/qt5/qtpositioning/qml-qtpositioning-coordinateanimation.html
  7404. share/doc/qt5/qtpositioning/qml-qtpositioning-location-members.html
  7405. share/doc/qt5/qtpositioning/qml-qtpositioning-location.html
  7406. share/doc/qt5/qtpositioning/qml-qtpositioning-position-members.html
  7407. share/doc/qt5/qtpositioning/qml-qtpositioning-position.html
  7408. share/doc/qt5/qtpositioning/qml-qtpositioning-positionsource-members.html
  7409. share/doc/qt5/qtpositioning/qml-qtpositioning-positionsource.html
  7410. share/doc/qt5/qtpositioning/qml-qtpositioning-qtpositioning-members.html
  7411. share/doc/qt5/qtpositioning/qml-qtpositioning-qtpositioning.html
  7412. share/doc/qt5/qtpositioning/qnmeapositioninfosource-members.html
  7413. share/doc/qt5/qtpositioning/qnmeapositioninfosource.html
  7414. share/doc/qt5/qtpositioning/qtpositioning-examples.html
  7415. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-example.html
  7416. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-90-qml.html
  7417. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-qml.html
  7418. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-qrc.html
  7419. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-progress-qml.html
  7420. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-restmodel-qml.html
  7421. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-scrollbar-qml.html
  7422. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-slider-qml.html
  7423. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-button-qml.html
  7424. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-geotab-qml.html
  7425. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-griddelegate-qml.html
  7426. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-imagedetails-qml.html
  7427. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-listdelegate-qml.html
  7428. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-titlebar-qml.html
  7429. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-toolbar-qml.html
  7430. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-geoflickr-pro.html
  7431. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-geoflickr-qmlproject.html
  7432. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-qmllocationflickr-cpp.html
  7433. share/doc/qt5/qtpositioning/qtpositioning-index.html
  7434. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-cpp.html
  7435. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-h.html
  7436. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-example.html
  7437. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfile-qrc.html
  7438. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-cpp.html
  7439. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-h.html
  7440. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-pro.html
  7441. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-main-cpp.html
  7442. share/doc/qt5/qtpositioning/qtpositioning-module.html
  7443. share/doc/qt5/qtpositioning/qtpositioning-plugins.html
  7444. share/doc/qt5/qtpositioning/qtpositioning-qmlmodule.html
  7445. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-example.html
  7446. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-main-cpp.html
  7447. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-pro.html
  7448. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qml.html
  7449. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qrc.html
  7450. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-cpp.html
  7451. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-h.html
  7452. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-appmodel-cpp.html
  7453. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-appmodel-h.html
  7454. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-bigforecasticon-qml.html
  7455. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-forecasticon-qml.html
  7456. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-weathericon-qml.html
  7457. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-example.html
  7458. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-main-cpp.html
  7459. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-pro.html
  7460. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qml.html
  7461. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qrc.html
  7462. share/doc/qt5/qtpositioning/qtpositioning.index
  7463. share/doc/qt5/qtpositioning/qtpositioning.qhp
  7464. share/doc/qt5/qtpositioning/qtpositioning.qhp.sha1
  7465. share/doc/qt5/qtpositioning/qtpositioning.tags
  7466. share/doc/qt5/qtpositioning/style/offline-simple.css
  7467. share/doc/qt5/qtpositioning/style/offline.css
  7468. share/doc/qt5/qtprintsupport.qch
  7469. share/doc/qt5/qtprintsupport/images/arrow_bc.png
  7470. share/doc/qt5/qtprintsupport/images/bgrContent.png
  7471. share/doc/qt5/qtprintsupport/images/btn_next.png
  7472. share/doc/qt5/qtprintsupport/images/btn_prev.png
  7473. share/doc/qt5/qtprintsupport/images/bullet_dn.png
  7474. share/doc/qt5/qtprintsupport/images/bullet_sq.png
  7475. share/doc/qt5/qtprintsupport/images/home.png
  7476. share/doc/qt5/qtprintsupport/images/ico_note.png
  7477. share/doc/qt5/qtprintsupport/images/ico_note_attention.png
  7478. share/doc/qt5/qtprintsupport/images/ico_out.png
  7479. share/doc/qt5/qtprintsupport/images/logo.png
  7480. share/doc/qt5/qtprintsupport/images/plastique-printdialog-properties.png
  7481. share/doc/qt5/qtprintsupport/images/plastique-printdialog.png
  7482. share/doc/qt5/qtprintsupport/images/printer-rects.png
  7483. share/doc/qt5/qtprintsupport/pdf-licensing.html
  7484. share/doc/qt5/qtprintsupport/printing.html
  7485. share/doc/qt5/qtprintsupport/qabstractprintdialog-members.html
  7486. share/doc/qt5/qtprintsupport/qabstractprintdialog-obsolete.html
  7487. share/doc/qt5/qtprintsupport/qabstractprintdialog.html
  7488. share/doc/qt5/qtprintsupport/qpagesetupdialog-members.html
  7489. share/doc/qt5/qtprintsupport/qpagesetupdialog.html
  7490. share/doc/qt5/qtprintsupport/qprintdialog-members.html
  7491. share/doc/qt5/qtprintsupport/qprintdialog.html
  7492. share/doc/qt5/qtprintsupport/qprintengine-members.html
  7493. share/doc/qt5/qtprintsupport/qprintengine.html
  7494. share/doc/qt5/qtprintsupport/qprinter-members.html
  7495. share/doc/qt5/qtprintsupport/qprinter-obsolete.html
  7496. share/doc/qt5/qtprintsupport/qprinter.html
  7497. share/doc/qt5/qtprintsupport/qprinterinfo-members.html
  7498. share/doc/qt5/qtprintsupport/qprinterinfo-obsolete.html
  7499. share/doc/qt5/qtprintsupport/qprinterinfo.html
  7500. share/doc/qt5/qtprintsupport/qprintpreviewdialog-members.html
  7501. share/doc/qt5/qtprintsupport/qprintpreviewdialog.html
  7502. share/doc/qt5/qtprintsupport/qprintpreviewwidget-members.html
  7503. share/doc/qt5/qtprintsupport/qprintpreviewwidget.html
  7504. share/doc/qt5/qtprintsupport/qtprintsupport-index.html
  7505. share/doc/qt5/qtprintsupport/qtprintsupport-module.html
  7506. share/doc/qt5/qtprintsupport/qtprintsupport.index
  7507. share/doc/qt5/qtprintsupport/qtprintsupport.qhp
  7508. share/doc/qt5/qtprintsupport/qtprintsupport.qhp.sha1
  7509. share/doc/qt5/qtprintsupport/qtprintsupport.tags
  7510. share/doc/qt5/qtprintsupport/style/offline-simple.css
  7511. share/doc/qt5/qtprintsupport/style/offline.css
  7512. share/doc/qt5/qtqml.qch
  7513. share/doc/qt5/qtqml/examples-manifest.xml
  7514. share/doc/qt5/qtqml/images/arrow_bc.png
  7515. share/doc/qt5/qtqml/images/bgrContent.png
  7516. share/doc/qt5/qtqml/images/btn_next.png
  7517. share/doc/qt5/qtqml/images/btn_prev.png
  7518. share/doc/qt5/qtqml/images/bullet_dn.png
  7519. share/doc/qt5/qtqml/images/bullet_sq.png
  7520. share/doc/qt5/qtqml/images/button-types.png
  7521. share/doc/qt5/qtqml/images/cppintegration-ex.png
  7522. share/doc/qt5/qtqml/images/declarative-rect_tint.png
  7523. share/doc/qt5/qtqml/images/documents-definetypes-attributes.png
  7524. share/doc/qt5/qtqml/images/documents-definetypes-simple.png
  7525. share/doc/qt5/qtqml/images/extending-tutorial-chapter1.png
  7526. share/doc/qt5/qtqml/images/extending-tutorial-chapter2.png
  7527. share/doc/qt5/qtqml/images/extending-tutorial-chapter3.png
  7528. share/doc/qt5/qtqml/images/extending-tutorial-chapter5.png
  7529. share/doc/qt5/qtqml/images/home.png
  7530. share/doc/qt5/qtqml/images/ico_note.png
  7531. share/doc/qt5/qtqml/images/ico_note_attention.png
  7532. share/doc/qt5/qtqml/images/ico_out.png
  7533. share/doc/qt5/qtqml/images/listmodel-nested.png
  7534. share/doc/qt5/qtqml/images/listmodel.png
  7535. share/doc/qt5/qtqml/images/logo.png
  7536. share/doc/qt5/qtqml/images/qml-dynamicscene-example.png
  7537. share/doc/qt5/qtqml/images/qml-i18n-example.png
  7538. share/doc/qt5/qtqml/images/qml-plugins-example.png
  7539. share/doc/qt5/qtqml/images/qml-xmlhttprequest-example.png
  7540. share/doc/qt5/qtqml/images/qtqml-syntax-basics-object-declaration.png
  7541. share/doc/qt5/qtqml/images/statemachine-button-history.png
  7542. share/doc/qt5/qtqml/images/statemachine-button-nested.png
  7543. share/doc/qt5/qtqml/images/statemachine-button.png
  7544. share/doc/qt5/qtqml/images/statemachine-finished.png
  7545. share/doc/qt5/qtqml/images/statemachine-nonparallel.png
  7546. share/doc/qt5/qtqml/images/statemachine-parallel.png
  7547. share/doc/qt5/qtqml/images/visualitemmodel.png
  7548. share/doc/qt5/qtqml/qjsengine-members.html
  7549. share/doc/qt5/qtqml/qjsengine-obsolete.html
  7550. share/doc/qt5/qtqml/qjsengine.html
  7551. share/doc/qt5/qtqml/qjsvalue-members.html
  7552. share/doc/qt5/qtqml/qjsvalue-obsolete.html
  7553. share/doc/qt5/qtqml/qjsvalue.html
  7554. share/doc/qt5/qtqml/qjsvalueiterator-members.html
  7555. share/doc/qt5/qtqml/qjsvalueiterator.html
  7556. share/doc/qt5/qtqml/qml-bool.html
  7557. share/doc/qt5/qtqml/qml-date.html
  7558. share/doc/qt5/qtqml/qml-double.html
  7559. share/doc/qt5/qtqml/qml-enumeration.html
  7560. share/doc/qt5/qtqml/qml-int.html
  7561. share/doc/qt5/qtqml/qml-list.html
  7562. share/doc/qt5/qtqml/qml-package-members.html
  7563. share/doc/qt5/qtqml/qml-package.html
  7564. share/doc/qt5/qtqml/qml-point.html
  7565. share/doc/qt5/qtqml/qml-qtqml-binding-members.html
  7566. share/doc/qt5/qtqml/qml-qtqml-binding.html
  7567. share/doc/qt5/qtqml/qml-qtqml-component-members.html
  7568. share/doc/qt5/qtqml/qml-qtqml-component.html
  7569. share/doc/qt5/qtqml/qml-qtqml-connections-members.html
  7570. share/doc/qt5/qtqml/qml-qtqml-connections.html
  7571. share/doc/qt5/qtqml/qml-qtqml-date-members.html
  7572. share/doc/qt5/qtqml/qml-qtqml-date.html
  7573. share/doc/qt5/qtqml/qml-qtqml-instantiator-members.html
  7574. share/doc/qt5/qtqml/qml-qtqml-instantiator.html
  7575. share/doc/qt5/qtqml/qml-qtqml-locale-members.html
  7576. share/doc/qt5/qtqml/qml-qtqml-locale.html
  7577. share/doc/qt5/qtqml/qml-qtqml-loggingcategory-members.html
  7578. share/doc/qt5/qtqml/qml-qtqml-loggingcategory.html
  7579. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodel-members.html
  7580. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodel.html
  7581. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodelgroup-members.html
  7582. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodelgroup.html
  7583. share/doc/qt5/qtqml/qml-qtqml-models-itemselectionmodel-members.html
  7584. share/doc/qt5/qtqml/qml-qtqml-models-itemselectionmodel.html
  7585. share/doc/qt5/qtqml/qml-qtqml-models-listelement-members.html
  7586. share/doc/qt5/qtqml/qml-qtqml-models-listelement.html
  7587. share/doc/qt5/qtqml/qml-qtqml-models-listmodel-members.html
  7588. share/doc/qt5/qtqml/qml-qtqml-models-listmodel.html
  7589. share/doc/qt5/qtqml/qml-qtqml-models-objectmodel-members.html
  7590. share/doc/qt5/qtqml/qml-qtqml-models-objectmodel.html
  7591. share/doc/qt5/qtqml/qml-qtqml-number-members.html
  7592. share/doc/qt5/qtqml/qml-qtqml-number.html
  7593. share/doc/qt5/qtqml/qml-qtqml-qt-members.html
  7594. share/doc/qt5/qtqml/qml-qtqml-qt.html
  7595. share/doc/qt5/qtqml/qml-qtqml-qtobject-members.html
  7596. share/doc/qt5/qtqml/qml-qtqml-qtobject.html
  7597. share/doc/qt5/qtqml/qml-qtqml-statemachine-finalstate-members.html
  7598. share/doc/qt5/qtqml/qml-qtqml-statemachine-finalstate.html
  7599. share/doc/qt5/qtqml/qml-qtqml-statemachine-historystate-members.html
  7600. share/doc/qt5/qtqml/qml-qtqml-statemachine-historystate.html
  7601. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstractstate-members.html
  7602. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstractstate.html
  7603. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstracttransition-members.html
  7604. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstracttransition.html
  7605. share/doc/qt5/qtqml/qml-qtqml-statemachine-qsignaltransition-members.html
  7606. share/doc/qt5/qtqml/qml-qtqml-statemachine-qsignaltransition.html
  7607. share/doc/qt5/qtqml/qml-qtqml-statemachine-signaltransition-members.html
  7608. share/doc/qt5/qtqml/qml-qtqml-statemachine-signaltransition.html
  7609. share/doc/qt5/qtqml/qml-qtqml-statemachine-state-members.html
  7610. share/doc/qt5/qtqml/qml-qtqml-statemachine-state.html
  7611. share/doc/qt5/qtqml/qml-qtqml-statemachine-statemachine-members.html
  7612. share/doc/qt5/qtqml/qml-qtqml-statemachine-statemachine.html
  7613. share/doc/qt5/qtqml/qml-qtqml-statemachine-timeouttransition-members.html
  7614. share/doc/qt5/qtqml/qml-qtqml-statemachine-timeouttransition.html
  7615. share/doc/qt5/qtqml/qml-qtqml-string-members.html
  7616. share/doc/qt5/qtqml/qml-qtqml-string.html
  7617. share/doc/qt5/qtqml/qml-qtqml-timer-members.html
  7618. share/doc/qt5/qtqml/qml-qtqml-timer.html
  7619. share/doc/qt5/qtqml/qml-real.html
  7620. share/doc/qt5/qtqml/qml-rect.html
  7621. share/doc/qt5/qtqml/qml-size.html
  7622. share/doc/qt5/qtqml/qml-string.html
  7623. share/doc/qt5/qtqml/qml-url.html
  7624. share/doc/qt5/qtqml/qml-var.html
  7625. share/doc/qt5/qtqml/qml-variant.html
  7626. share/doc/qt5/qtqml/qml-visualdatagroup-members.html
  7627. share/doc/qt5/qtqml/qml-visualdatagroup.html
  7628. share/doc/qt5/qtqml/qml-visualdatamodel-members.html
  7629. share/doc/qt5/qtqml/qml-visualdatamodel.html
  7630. share/doc/qt5/qtqml/qml-visualitemmodel-members.html
  7631. share/doc/qt5/qtqml/qml-visualitemmodel.html
  7632. share/doc/qt5/qtqml/qml-workerscript-members.html
  7633. share/doc/qt5/qtqml/qml-workerscript.html
  7634. share/doc/qt5/qtqml/qmlextendingexamples.html
  7635. share/doc/qt5/qtqml/qmlreference.html
  7636. share/doc/qt5/qtqml/qmlstatemachine.html
  7637. share/doc/qt5/qtqml/qmodelindex-and-related-classes-in-qml.html
  7638. share/doc/qt5/qtqml/qqmlabstracturlinterceptor-members.html
  7639. share/doc/qt5/qtqml/qqmlabstracturlinterceptor.html
  7640. share/doc/qt5/qtqml/qqmlapplicationengine-members.html
  7641. share/doc/qt5/qtqml/qqmlapplicationengine.html
  7642. share/doc/qt5/qtqml/qqmlcomponent-members.html
  7643. share/doc/qt5/qtqml/qqmlcomponent.html
  7644. share/doc/qt5/qtqml/qqmlcontext-members.html
  7645. share/doc/qt5/qtqml/qqmlcontext.html
  7646. share/doc/qt5/qtqml/qqmlengine-members.html
  7647. share/doc/qt5/qtqml/qqmlengine.html
  7648. share/doc/qt5/qtqml/qqmlerror-members.html
  7649. share/doc/qt5/qtqml/qqmlerror.html
  7650. share/doc/qt5/qtqml/qqmlexpression-members.html
  7651. share/doc/qt5/qtqml/qqmlexpression.html
  7652. share/doc/qt5/qtqml/qqmlextensionplugin-members.html
  7653. share/doc/qt5/qtqml/qqmlextensionplugin.html
  7654. share/doc/qt5/qtqml/qqmlfileselector-members.html
  7655. share/doc/qt5/qtqml/qqmlfileselector.html
  7656. share/doc/qt5/qtqml/qqmlimageproviderbase-members.html
  7657. share/doc/qt5/qtqml/qqmlimageproviderbase.html
  7658. share/doc/qt5/qtqml/qqmlincubationcontroller-members.html
  7659. share/doc/qt5/qtqml/qqmlincubationcontroller.html
  7660. share/doc/qt5/qtqml/qqmlincubator-members.html
  7661. share/doc/qt5/qtqml/qqmlincubator.html
  7662. share/doc/qt5/qtqml/qqmllistproperty-members.html
  7663. share/doc/qt5/qtqml/qqmllistproperty.html
  7664. share/doc/qt5/qtqml/qqmllistreference-members.html
  7665. share/doc/qt5/qtqml/qqmllistreference.html
  7666. share/doc/qt5/qtqml/qqmlnetworkaccessmanagerfactory-members.html
  7667. share/doc/qt5/qtqml/qqmlnetworkaccessmanagerfactory.html
  7668. share/doc/qt5/qtqml/qqmlparserstatus-members.html
  7669. share/doc/qt5/qtqml/qqmlparserstatus.html
  7670. share/doc/qt5/qtqml/qqmlproperty-members.html
  7671. share/doc/qt5/qtqml/qqmlproperty.html
  7672. share/doc/qt5/qtqml/qqmlpropertymap-members.html
  7673. share/doc/qt5/qtqml/qqmlpropertymap.html
  7674. share/doc/qt5/qtqml/qqmlpropertyvaluesource-members.html
  7675. share/doc/qt5/qtqml/qqmlpropertyvaluesource.html
  7676. share/doc/qt5/qtqml/qqmlscriptstring-members.html
  7677. share/doc/qt5/qtqml/qqmlscriptstring.html
  7678. share/doc/qt5/qtqml/qtjavascript.html
  7679. share/doc/qt5/qtqml/qtqml-attribution-masm.html
  7680. share/doc/qt5/qtqml/qtqml-cppclasses-topic.html
  7681. share/doc/qt5/qtqml/qtqml-cppintegration-contextproperties.html
  7682. share/doc/qt5/qtqml/qtqml-cppintegration-data.html
  7683. share/doc/qt5/qtqml/qtqml-cppintegration-definetypes.html
  7684. share/doc/qt5/qtqml/qtqml-cppintegration-exposecppattributes.html
  7685. share/doc/qt5/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
  7686. share/doc/qt5/qtqml/qtqml-cppintegration-overview.html
  7687. share/doc/qt5/qtqml/qtqml-cppintegration-topic.html
  7688. share/doc/qt5/qtqml/qtqml-documents-definetypes.html
  7689. share/doc/qt5/qtqml/qtqml-documents-networktransparency.html
  7690. share/doc/qt5/qtqml/qtqml-documents-scope.html
  7691. share/doc/qt5/qtqml/qtqml-documents-structure.html
  7692. share/doc/qt5/qtqml/qtqml-documents-topic.html
  7693. share/doc/qt5/qtqml/qtqml-dynamicscene-content-button-qml.html
  7694. share/doc/qt5/qtqml/qtqml-dynamicscene-content-genericsceneitem-qml.html
  7695. share/doc/qt5/qtqml/qtqml-dynamicscene-content-itemcreation-js.html
  7696. share/doc/qt5/qtqml/qtqml-dynamicscene-content-paletteitem-qml.html
  7697. share/doc/qt5/qtqml/qtqml-dynamicscene-content-perspectiveitem-qml.html
  7698. share/doc/qt5/qtqml/qtqml-dynamicscene-content-sun-qml.html
  7699. share/doc/qt5/qtqml/qtqml-dynamicscene-dynamicscene-qml.html
  7700. share/doc/qt5/qtqml/qtqml-dynamicscene-dynamicscene-qmlproject.html
  7701. share/doc/qt5/qtqml/qtqml-dynamicscene-example.html
  7702. share/doc/qt5/qtqml/qtqml-index.html
  7703. share/doc/qt5/qtqml/qtqml-javascript-dynamicobjectcreation.html
  7704. share/doc/qt5/qtqml/qtqml-javascript-expressions.html
  7705. share/doc/qt5/qtqml/qtqml-javascript-functionlist.html
  7706. share/doc/qt5/qtqml/qtqml-javascript-hostenvironment.html
  7707. share/doc/qt5/qtqml/qtqml-javascript-imports.html
  7708. share/doc/qt5/qtqml/qtqml-javascript-qmlglobalobject.html
  7709. share/doc/qt5/qtqml/qtqml-javascript-resources.html
  7710. share/doc/qt5/qtqml/qtqml-javascript-topic.html
  7711. share/doc/qt5/qtqml/qtqml-models-qmlmodule.html
  7712. share/doc/qt5/qtqml/qtqml-module.html
  7713. share/doc/qt5/qtqml/qtqml-modules-cppplugins.html
  7714. share/doc/qt5/qtqml/qtqml-modules-identifiedmodules.html
  7715. share/doc/qt5/qtqml/qtqml-modules-legacymodules.html
  7716. share/doc/qt5/qtqml/qtqml-modules-qmldir.html
  7717. share/doc/qt5/qtqml/qtqml-modules-topic.html
  7718. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-example.html
  7719. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-main-cpp.html
  7720. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-pro.html
  7721. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qmlproject.html
  7722. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qrc.html
  7723. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-view-qml.html
  7724. share/doc/qt5/qtqml/qtqml-qml-i18n-example.html
  7725. share/doc/qt5/qtqml/qtqml-qml-i18n-qml-i18n-qml.html
  7726. share/doc/qt5/qtqml/qtqml-qml-i18n-qml-i18n-qmlproject.html
  7727. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-example.html
  7728. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-imports-timeexample-clock-qml.html
  7729. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-imports-timeexample-qmldir.html
  7730. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugin-cpp.html
  7731. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugins-qml.html
  7732. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugins-qmlproject.html
  7733. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-qmlextensionplugins-pro.html
  7734. share/doc/qt5/qtqml/qtqml-qmlmodule.html
  7735. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-adding-pro.html
  7736. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-adding-qrc.html
  7737. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-example-qml.html
  7738. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-example.html
  7739. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-main-cpp.html
  7740. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-person-cpp.html
  7741. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-person-h.html
  7742. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-attached-pro.html
  7743. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-attached-qrc.html
  7744. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-birthdayparty-cpp.html
  7745. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-birthdayparty-h.html
  7746. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-example-qml.html
  7747. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-example.html
  7748. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-main-cpp.html
  7749. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-person-cpp.html
  7750. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-person-h.html
  7751. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-binding-pro.html
  7752. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-binding-qrc.html
  7753. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-birthdayparty-cpp.html
  7754. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-birthdayparty-h.html
  7755. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-example-qml.html
  7756. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-example.html
  7757. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-cpp.html
  7758. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-h.html
  7759. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-main-cpp.html
  7760. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-person-cpp.html
  7761. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-person-h.html
  7762. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-birthdayparty-cpp.html
  7763. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-birthdayparty-h.html
  7764. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-coercion-pro.html
  7765. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-coercion-qrc.html
  7766. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-example-qml.html
  7767. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-example.html
  7768. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-main-cpp.html
  7769. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-person-cpp.html
  7770. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-person-h.html
  7771. share/doc/qt5/qtqml/qtqml-referenceexamples-default-birthdayparty-cpp.html
  7772. share/doc/qt5/qtqml/qtqml-referenceexamples-default-birthdayparty-h.html
  7773. share/doc/qt5/qtqml/qtqml-referenceexamples-default-default-pro.html
  7774. share/doc/qt5/qtqml/qtqml-referenceexamples-default-default-qrc.html
  7775. share/doc/qt5/qtqml/qtqml-referenceexamples-default-example-qml.html
  7776. share/doc/qt5/qtqml/qtqml-referenceexamples-default-example.html
  7777. share/doc/qt5/qtqml/qtqml-referenceexamples-default-main-cpp.html
  7778. share/doc/qt5/qtqml/qtqml-referenceexamples-default-person-cpp.html
  7779. share/doc/qt5/qtqml/qtqml-referenceexamples-default-person-h.html
  7780. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-example-qml.html
  7781. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-example.html
  7782. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-extended-pro.html
  7783. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-extended-qrc.html
  7784. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-lineedit-cpp.html
  7785. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-lineedit-h.html
  7786. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-main-cpp.html
  7787. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-birthdayparty-cpp.html
  7788. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-birthdayparty-h.html
  7789. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-example-qml.html
  7790. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-example.html
  7791. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-grouped-pro.html
  7792. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-grouped-qrc.html
  7793. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-main-cpp.html
  7794. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-person-cpp.html
  7795. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-person-h.html
  7796. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-birthdayparty-cpp.html
  7797. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-birthdayparty-h.html
  7798. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-example-qml.html
  7799. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-example.html
  7800. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-main-cpp.html
  7801. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-methods-pro.html
  7802. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-methods-qrc.html
  7803. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-person-cpp.html
  7804. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-person-h.html
  7805. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-birthdayparty-cpp.html
  7806. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-birthdayparty-h.html
  7807. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-example-qml.html
  7808. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-example.html
  7809. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-main-cpp.html
  7810. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-person-cpp.html
  7811. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-person-h.html
  7812. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-properties-pro.html
  7813. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-properties-qrc.html
  7814. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-birthdayparty-cpp.html
  7815. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-birthdayparty-h.html
  7816. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-example-qml.html
  7817. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-example.html
  7818. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-main-cpp.html
  7819. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-person-cpp.html
  7820. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-person-h.html
  7821. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-signal-pro.html
  7822. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-signal-qrc.html
  7823. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-cpp.html
  7824. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-h.html
  7825. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-example-qml.html
  7826. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-example.html
  7827. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-cpp.html
  7828. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-h.html
  7829. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-main-cpp.html
  7830. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-person-cpp.html
  7831. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-person-h.html
  7832. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-valuesource-pro.html
  7833. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-valuesource-qrc.html
  7834. share/doc/qt5/qtqml/qtqml-statemachine-qmlmodule.html
  7835. share/doc/qt5/qtqml/qtqml-syntax-basics.html
  7836. share/doc/qt5/qtqml/qtqml-syntax-directoryimports.html
  7837. share/doc/qt5/qtqml/qtqml-syntax-imports.html
  7838. share/doc/qt5/qtqml/qtqml-syntax-objectattributes.html
  7839. share/doc/qt5/qtqml/qtqml-syntax-propertybinding.html
  7840. share/doc/qt5/qtqml/qtqml-syntax-signals.html
  7841. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-app-qml.html
  7842. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-pro.html
  7843. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-qrc.html
  7844. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-main-cpp.html
  7845. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-cpp.html
  7846. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-h.html
  7847. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-app-qml.html
  7848. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-pro.html
  7849. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-qrc.html
  7850. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-cpp.html
  7851. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-h.html
  7852. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-app-qml.html
  7853. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-pro.html
  7854. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-qrc.html
  7855. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-cpp.html
  7856. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-h.html
  7857. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-app-qml.html
  7858. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-pro.html
  7859. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-qrc.html
  7860. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-cpp.html
  7861. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-h.html
  7862. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-cpp.html
  7863. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-h.html
  7864. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-app-qml.html
  7865. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-pro.html
  7866. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-qrc.html
  7867. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-cpp.html
  7868. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-h.html
  7869. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-cpp.html
  7870. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-h.html
  7871. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-pro.html
  7872. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qml.html
  7873. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qrc.html
  7874. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-chapter6-plugins-pro.html
  7875. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-cpp.html
  7876. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-h.html
  7877. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-import-pro.html
  7878. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-cpp.html
  7879. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-h.html
  7880. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-cpp.html
  7881. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-h.html
  7882. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-qmldir.html
  7883. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-example.html
  7884. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-extending-qml-pro.html
  7885. share/doc/qt5/qtqml/qtqml-typesystem-basictypes.html
  7886. share/doc/qt5/qtqml/qtqml-typesystem-objecttypes.html
  7887. share/doc/qt5/qtqml/qtqml-typesystem-topic.html
  7888. share/doc/qt5/qtqml/qtqml-xmlhttprequest-data-xml.html
  7889. share/doc/qt5/qtqml/qtqml-xmlhttprequest-example.html
  7890. share/doc/qt5/qtqml/qtqml-xmlhttprequest-get-qml.html
  7891. share/doc/qt5/qtqml/qtqml-xmlhttprequest-getform-ui-qml.html
  7892. share/doc/qt5/qtqml/qtqml-xmlhttprequest-main-cpp.html
  7893. share/doc/qt5/qtqml/qtqml-xmlhttprequest-methods-js.html
  7894. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-pro.html
  7895. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qml.html
  7896. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qmlproject.html
  7897. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qrc.html
  7898. share/doc/qt5/qtqml/qtqml.index
  7899. share/doc/qt5/qtqml/qtqml.qhp
  7900. share/doc/qt5/qtqml/qtqml.qhp.sha1
  7901. share/doc/qt5/qtqml/qtqml.tags
  7902. share/doc/qt5/qtqml/style/offline-simple.css
  7903. share/doc/qt5/qtqml/style/offline.css
  7904. share/doc/qt5/qtquick.qch
  7905. share/doc/qt5/qtquick/demos-manifest.xml
  7906. share/doc/qt5/qtquick/examples-manifest.xml
  7907. share/doc/qt5/qtquick/images/3d-rotation-axis.png
  7908. share/doc/qt5/qtquick/images/ListViewHorizontal.png
  7909. share/doc/qt5/qtquick/images/anchor_ordering.png
  7910. share/doc/qt5/qtquick/images/anchor_ordering_bad.png
  7911. share/doc/qt5/qtquick/images/anchorchanges.png
  7912. share/doc/qt5/qtquick/images/animatedimageitem.gif
  7913. share/doc/qt5/qtquick/images/arrow_bc.png
  7914. share/doc/qt5/qtquick/images/axisrotation.png
  7915. share/doc/qt5/qtquick/images/bgrContent.png
  7916. share/doc/qt5/qtquick/images/btn_next.png
  7917. share/doc/qt5/qtquick/images/btn_prev.png
  7918. share/doc/qt5/qtquick/images/bullet_dn.png
  7919. share/doc/qt5/qtquick/images/bullet_sq.png
  7920. share/doc/qt5/qtquick/images/columnlayout.png
  7921. share/doc/qt5/qtquick/images/custom-geometry-example.png
  7922. share/doc/qt5/qtquick/images/declarative-adv-tutorial1.png
  7923. share/doc/qt5/qtquick/images/declarative-adv-tutorial2.png
  7924. share/doc/qt5/qtquick/images/declarative-adv-tutorial3.png
  7925. share/doc/qt5/qtquick/images/declarative-adv-tutorial4.gif
  7926. share/doc/qt5/qtquick/images/declarative-anchors_example.png
  7927. share/doc/qt5/qtquick/images/declarative-anchors_example2.png
  7928. share/doc/qt5/qtquick/images/declarative-arcdirection.png
  7929. share/doc/qt5/qtquick/images/declarative-arcradius.png
  7930. share/doc/qt5/qtquick/images/declarative-colors.png
  7931. share/doc/qt5/qtquick/images/declarative-gridmesh.png
  7932. share/doc/qt5/qtquick/images/declarative-item_opacity1.png
  7933. share/doc/qt5/qtquick/images/declarative-item_opacity2.png
  7934. share/doc/qt5/qtquick/images/declarative-item_stacking1.png
  7935. share/doc/qt5/qtquick/images/declarative-item_stacking2.png
  7936. share/doc/qt5/qtquick/images/declarative-item_stacking3.png
  7937. share/doc/qt5/qtquick/images/declarative-item_stacking4.png
  7938. share/doc/qt5/qtquick/images/declarative-largearc.png
  7939. share/doc/qt5/qtquick/images/declarative-nopercent.png
  7940. share/doc/qt5/qtquick/images/declarative-patharc.png
  7941. share/doc/qt5/qtquick/images/declarative-pathattribute.png
  7942. share/doc/qt5/qtquick/images/declarative-pathcubic.png
  7943. share/doc/qt5/qtquick/images/declarative-pathcurve.png
  7944. share/doc/qt5/qtquick/images/declarative-pathquad.png
  7945. share/doc/qt5/qtquick/images/declarative-pathsvg.png
  7946. share/doc/qt5/qtquick/images/declarative-percent.png
  7947. share/doc/qt5/qtquick/images/declarative-qmlfocus1.png
  7948. share/doc/qt5/qtquick/images/declarative-qmlfocus2.png
  7949. share/doc/qt5/qtquick/images/declarative-qmlfocus3.png
  7950. share/doc/qt5/qtquick/images/declarative-qmlfocus4.png
  7951. share/doc/qt5/qtquick/images/declarative-qmlfocus5.png
  7952. share/doc/qt5/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
  7953. share/doc/qt5/qtquick/images/declarative-qtlogo-preserveaspectfit.png
  7954. share/doc/qt5/qtquick/images/declarative-qtlogo-stretch.png
  7955. share/doc/qt5/qtquick/images/declarative-qtlogo-tile.png
  7956. share/doc/qt5/qtquick/images/declarative-qtlogo-tilehorizontally.png
  7957. share/doc/qt5/qtquick/images/declarative-qtlogo-tilevertically.png
  7958. share/doc/qt5/qtquick/images/declarative-qtlogo.png
  7959. share/doc/qt5/qtquick/images/declarative-rect.png
  7960. share/doc/qt5/qtquick/images/declarative-rect_gradient.png
  7961. share/doc/qt5/qtquick/images/declarative-rotation.png
  7962. share/doc/qt5/qtquick/images/declarative-samegame.png
  7963. share/doc/qt5/qtquick/images/declarative-scale.png
  7964. share/doc/qt5/qtquick/images/declarative-scalegrid.png
  7965. share/doc/qt5/qtquick/images/declarative-shadereffectitem.png
  7966. share/doc/qt5/qtquick/images/declarative-shadereffectsource.png
  7967. share/doc/qt5/qtquick/images/declarative-text.png
  7968. share/doc/qt5/qtquick/images/declarative-textballoons_example.png
  7969. share/doc/qt5/qtquick/images/declarative-textedit.gif
  7970. share/doc/qt5/qtquick/images/declarative-textformat.png
  7971. share/doc/qt5/qtquick/images/declarative-textstyle.png
  7972. share/doc/qt5/qtquick/images/declarative-transformorigin.png
  7973. share/doc/qt5/qtquick/images/declarative-tutorial1.png
  7974. share/doc/qt5/qtquick/images/declarative-tutorial2.png
  7975. share/doc/qt5/qtquick/images/declarative-tutorial3_animation.gif
  7976. share/doc/qt5/qtquick/images/edge1.png
  7977. share/doc/qt5/qtquick/images/edge2.png
  7978. share/doc/qt5/qtquick/images/edge3.png
  7979. share/doc/qt5/qtquick/images/edge4.png
  7980. share/doc/qt5/qtquick/images/edges_qml.png
  7981. share/doc/qt5/qtquick/images/flickable-rebound.gif
  7982. share/doc/qt5/qtquick/images/flickable.gif
  7983. share/doc/qt5/qtquick/images/flipable.gif
  7984. share/doc/qt5/qtquick/images/fuzzydot.png
  7985. share/doc/qt5/qtquick/images/glowdot.png
  7986. share/doc/qt5/qtquick/images/graph-example.jpg
  7987. share/doc/qt5/qtquick/images/gridLayout_aligncenter.png
  7988. share/doc/qt5/qtquick/images/gridLayout_aligntop.png
  7989. share/doc/qt5/qtquick/images/gridLayout_aligntopleft.png
  7990. share/doc/qt5/qtquick/images/gridLayout_example.png
  7991. share/doc/qt5/qtquick/images/gridlayout.png
  7992. share/doc/qt5/qtquick/images/gridview-highlight.png
  7993. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
  7994. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
  7995. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
  7996. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
  7997. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
  7998. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
  7999. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
  8000. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
  8001. share/doc/qt5/qtquick/images/gridview-simple.png
  8002. share/doc/qt5/qtquick/images/home.png
  8003. share/doc/qt5/qtquick/images/horizontalpositioner_example.png
  8004. share/doc/qt5/qtquick/images/ico_note.png
  8005. share/doc/qt5/qtquick/images/ico_note_attention.png
  8006. share/doc/qt5/qtquick/images/ico_out.png
  8007. share/doc/qt5/qtquick/images/imageprovider.png
  8008. share/doc/qt5/qtquick/images/layoutmirroring.png
  8009. share/doc/qt5/qtquick/images/listview-decorations.png
  8010. share/doc/qt5/qtquick/images/listview-highlight.png
  8011. share/doc/qt5/qtquick/images/listview-layout-bottomtotop.png
  8012. share/doc/qt5/qtquick/images/listview-layout-lefttoright.png
  8013. share/doc/qt5/qtquick/images/listview-layout-righttoleft.png
  8014. share/doc/qt5/qtquick/images/listview-layout-toptobottom.png
  8015. share/doc/qt5/qtquick/images/listview-section.png
  8016. share/doc/qt5/qtquick/images/listview-setup.png
  8017. share/doc/qt5/qtquick/images/listview-simple.png
  8018. share/doc/qt5/qtquick/images/logo.png
  8019. share/doc/qt5/qtquick/images/manual-layout.png
  8020. share/doc/qt5/qtquick/images/margins_qml.png
  8021. share/doc/qt5/qtquick/images/mob-idle.png
  8022. share/doc/qt5/qtquick/images/modelview-overview.png
  8023. share/doc/qt5/qtquick/images/openglunderqml-example.jpg
  8024. share/doc/qt5/qtquick/images/parentchange.png
  8025. share/doc/qt5/qtquick/images/pathview.gif
  8026. share/doc/qt5/qtquick/images/positioner-example.png
  8027. share/doc/qt5/qtquick/images/qeasingcurve-inback.png
  8028. share/doc/qt5/qtquick/images/qeasingcurve-inbounce.png
  8029. share/doc/qt5/qtquick/images/qeasingcurve-incirc.png
  8030. share/doc/qt5/qtquick/images/qeasingcurve-incubic.png
  8031. share/doc/qt5/qtquick/images/qeasingcurve-inelastic.png
  8032. share/doc/qt5/qtquick/images/qeasingcurve-inexpo.png
  8033. share/doc/qt5/qtquick/images/qeasingcurve-inoutback.png
  8034. share/doc/qt5/qtquick/images/qeasingcurve-inoutbounce.png
  8035. share/doc/qt5/qtquick/images/qeasingcurve-inoutcirc.png
  8036. share/doc/qt5/qtquick/images/qeasingcurve-inoutcubic.png
  8037. share/doc/qt5/qtquick/images/qeasingcurve-inoutelastic.png
  8038. share/doc/qt5/qtquick/images/qeasingcurve-inoutexpo.png
  8039. share/doc/qt5/qtquick/images/qeasingcurve-inoutquad.png
  8040. share/doc/qt5/qtquick/images/qeasingcurve-inoutquart.png
  8041. share/doc/qt5/qtquick/images/qeasingcurve-inoutquint.png
  8042. share/doc/qt5/qtquick/images/qeasingcurve-inoutsine.png
  8043. share/doc/qt5/qtquick/images/qeasingcurve-inquad.png
  8044. share/doc/qt5/qtquick/images/qeasingcurve-inquart.png
  8045. share/doc/qt5/qtquick/images/qeasingcurve-inquint.png
  8046. share/doc/qt5/qtquick/images/qeasingcurve-insine.png
  8047. share/doc/qt5/qtquick/images/qeasingcurve-linear.png
  8048. share/doc/qt5/qtquick/images/qeasingcurve-outback.png
  8049. share/doc/qt5/qtquick/images/qeasingcurve-outbounce.png
  8050. share/doc/qt5/qtquick/images/qeasingcurve-outcirc.png
  8051. share/doc/qt5/qtquick/images/qeasingcurve-outcubic.png
  8052. share/doc/qt5/qtquick/images/qeasingcurve-outelastic.png
  8053. share/doc/qt5/qtquick/images/qeasingcurve-outexpo.png
  8054. share/doc/qt5/qtquick/images/qeasingcurve-outinback.png
  8055. share/doc/qt5/qtquick/images/qeasingcurve-outinbounce.png
  8056. share/doc/qt5/qtquick/images/qeasingcurve-outincirc.png
  8057. share/doc/qt5/qtquick/images/qeasingcurve-outincubic.png
  8058. share/doc/qt5/qtquick/images/qeasingcurve-outinelastic.png
  8059. share/doc/qt5/qtquick/images/qeasingcurve-outinexpo.png
  8060. share/doc/qt5/qtquick/images/qeasingcurve-outinquad.png
  8061. share/doc/qt5/qtquick/images/qeasingcurve-outinquart.png
  8062. share/doc/qt5/qtquick/images/qeasingcurve-outinquint.png
  8063. share/doc/qt5/qtquick/images/qeasingcurve-outinsine.png
  8064. share/doc/qt5/qtquick/images/qeasingcurve-outquad.png
  8065. share/doc/qt5/qtquick/images/qeasingcurve-outquart.png
  8066. share/doc/qt5/qtquick/images/qeasingcurve-outquint.png
  8067. share/doc/qt5/qtquick/images/qeasingcurve-outsine.png
  8068. share/doc/qt5/qtquick/images/qml-abstractitemmodel-example.png
  8069. share/doc/qt5/qtquick/images/qml-affectors-example.png
  8070. share/doc/qt5/qtquick/images/qml-animations-example.png
  8071. share/doc/qt5/qtquick/images/qml-blending-layered.png
  8072. share/doc/qt5/qtquick/images/qml-blending-nonlayered.png
  8073. share/doc/qt5/qtquick/images/qml-borderimage-normal-image.png
  8074. share/doc/qt5/qtquick/images/qml-borderimage-scaled.png
  8075. share/doc/qt5/qtquick/images/qml-borderimage-tiled.png
  8076. share/doc/qt5/qtquick/images/qml-canvas-example.png
  8077. share/doc/qt5/qtquick/images/qml-column.png
  8078. share/doc/qt5/qtquick/images/qml-customparticle-example.png
  8079. share/doc/qt5/qtquick/images/qml-dialcontrol-example.png
  8080. share/doc/qt5/qtquick/images/qml-dnd2-example.png
  8081. share/doc/qt5/qtquick/images/qml-draganddrop-example.png
  8082. share/doc/qt5/qtquick/images/qml-emitters-example.png
  8083. share/doc/qt5/qtquick/images/qml-flipable-example.png
  8084. share/doc/qt5/qtquick/images/qml-flow-snippet.png
  8085. share/doc/qt5/qtquick/images/qml-flow-text1.png
  8086. share/doc/qt5/qtquick/images/qml-flow-text2.png
  8087. share/doc/qt5/qtquick/images/qml-gradient.png
  8088. share/doc/qt5/qtquick/images/qml-grid-no-spacing.png
  8089. share/doc/qt5/qtquick/images/qml-grid-spacing.png
  8090. share/doc/qt5/qtquick/images/qml-imageelements-example.png
  8091. share/doc/qt5/qtquick/images/qml-imageparticle-example.png
  8092. share/doc/qt5/qtquick/images/qml-imageprovider-example.png
  8093. share/doc/qt5/qtquick/images/qml-item-canvas-arc.png
  8094. share/doc/qt5/qtquick/images/qml-item-canvas-arcTo.png
  8095. share/doc/qt5/qtquick/images/qml-item-canvas-bezierCurveTo.png
  8096. share/doc/qt5/qtquick/images/qml-item-canvas-clip-complex.png
  8097. share/doc/qt5/qtquick/images/qml-item-canvas-context.gif
  8098. share/doc/qt5/qtquick/images/qml-item-canvas-math-rotate.png
  8099. share/doc/qt5/qtquick/images/qml-item-canvas-math.png
  8100. share/doc/qt5/qtquick/images/qml-item-canvas-rotate.png
  8101. share/doc/qt5/qtquick/images/qml-item-canvas-scale.png
  8102. share/doc/qt5/qtquick/images/qml-item-canvas-scalex.png
  8103. share/doc/qt5/qtquick/images/qml-item-canvas-scaley.png
  8104. share/doc/qt5/qtquick/images/qml-item-canvas-skewx.png
  8105. share/doc/qt5/qtquick/images/qml-item-canvas-skewy.png
  8106. share/doc/qt5/qtquick/images/qml-item-canvas-startAngle.png
  8107. share/doc/qt5/qtquick/images/qml-item-canvas-translate.png
  8108. share/doc/qt5/qtquick/images/qml-item-canvas-translatey.png
  8109. share/doc/qt5/qtquick/images/qml-keyinteraction-example.png
  8110. share/doc/qt5/qtquick/images/qml-listview-sections-example.png
  8111. share/doc/qt5/qtquick/images/qml-localstorage-example.png
  8112. share/doc/qt5/qtquick/images/qml-modelviews-example.png
  8113. share/doc/qt5/qtquick/images/qml-mousearea-example.png
  8114. share/doc/qt5/qtquick/images/qml-mousearea-snippet.png
  8115. share/doc/qt5/qtquick/images/qml-objectlistmodel-example.png
  8116. share/doc/qt5/qtquick/images/qml-positioners-example.png
  8117. share/doc/qt5/qtquick/images/qml-righttoleft-example.png
  8118. share/doc/qt5/qtquick/images/qml-row.png
  8119. share/doc/qt5/qtquick/images/qml-scrollbar-example.png
  8120. share/doc/qt5/qtquick/images/qml-shadereffect-layereffect.png
  8121. share/doc/qt5/qtquick/images/qml-shadereffect-nolayereffect.png
  8122. share/doc/qt5/qtquick/images/qml-shadereffect-opacitymask.png
  8123. share/doc/qt5/qtquick/images/qml-shadereffects-example.png
  8124. share/doc/qt5/qtquick/images/qml-stringlistmodel-example.png
  8125. share/doc/qt5/qtquick/images/qml-system-example.png
  8126. share/doc/qt5/qtquick/images/qml-tabwidget-example.png
  8127. share/doc/qt5/qtquick/images/qml-text-example.png
  8128. share/doc/qt5/qtquick/images/qml-threading-example.png
  8129. share/doc/qt5/qtquick/images/qml-touchinteraction-example.png
  8130. share/doc/qt5/qtquick/images/qml-window-example.png
  8131. share/doc/qt5/qtquick/images/qml-xmllistmodel-example.png
  8132. share/doc/qt5/qtquick/images/qtquick-demo-calqlatr.png
  8133. share/doc/qt5/qtquick/images/qtquick-demo-clocks-small.png
  8134. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-1.png
  8135. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-2.png
  8136. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-3.jpg
  8137. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-4.jpg
  8138. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-5.jpg
  8139. share/doc/qt5/qtquick/images/qtquick-demo-maroon-med-6.jpg
  8140. share/doc/qt5/qtquick/images/qtquick-demo-photosurface-small.png
  8141. share/doc/qt5/qtquick/images/qtquick-demo-photoviewer-small.png
  8142. share/doc/qt5/qtquick/images/qtquick-demo-rssnews-small.png
  8143. share/doc/qt5/qtquick/images/qtquick-demo-samegame-med-1.png
  8144. share/doc/qt5/qtquick/images/qtquick-demo-samegame-med-2.png
  8145. share/doc/qt5/qtquick/images/qtquick-demo-stocqt.png
  8146. share/doc/qt5/qtquick/images/qtquick-demo-tweetsearch-med-1.png
  8147. share/doc/qt5/qtquick/images/qtquick-demo-tweetsearch-med-2.png
  8148. share/doc/qt5/qtquick/images/qtquicklayouts-example-layouts.png
  8149. share/doc/qt5/qtquick/images/qtquickwidgets-example.png
  8150. share/doc/qt5/qtquick/images/rect-color.png
  8151. share/doc/qt5/qtquick/images/rendercontrol-example.jpg
  8152. share/doc/qt5/qtquick/images/repeater-index.png
  8153. share/doc/qt5/qtquick/images/repeater-modeldata.png
  8154. share/doc/qt5/qtquick/images/repeater-simple.png
  8155. share/doc/qt5/qtquick/images/repeater.png
  8156. share/doc/qt5/qtquick/images/rowlayout-minimum.png
  8157. share/doc/qt5/qtquick/images/rowlayout.png
  8158. share/doc/qt5/qtquick/images/screen-and-window-dimensions.jpg
  8159. share/doc/qt5/qtquick/images/sg-renderloop-singlethreaded.jpg
  8160. share/doc/qt5/qtquick/images/sg-renderloop-threaded.jpg
  8161. share/doc/qt5/qtquick/images/simplematerial-example.jpg
  8162. share/doc/qt5/qtquick/images/spritecutting.png
  8163. share/doc/qt5/qtquick/images/spriteenginegraph.png
  8164. share/doc/qt5/qtquick/images/star.png
  8165. share/doc/qt5/qtquick/images/textureinsgnode-example.jpg
  8166. share/doc/qt5/qtquick/images/textureinthread-example.jpg
  8167. share/doc/qt5/qtquick/images/touchpoint-metrics.png
  8168. share/doc/qt5/qtquick/images/translate.png
  8169. share/doc/qt5/qtquick/images/twotextureproviders-example.jpg
  8170. share/doc/qt5/qtquick/images/verticalpositioner_example.png
  8171. share/doc/qt5/qtquick/images/verticalpositioner_transition.gif
  8172. share/doc/qt5/qtquick/images/viewtransitions-basic.gif
  8173. share/doc/qt5/qtquick/images/viewtransitions-delayedbyindex.gif
  8174. share/doc/qt5/qtquick/images/viewtransitions-intermediatemove.gif
  8175. share/doc/qt5/qtquick/images/viewtransitions-interruptedbad.gif
  8176. share/doc/qt5/qtquick/images/viewtransitions-interruptedgood.gif
  8177. share/doc/qt5/qtquick/images/viewtransitions-pathanim.gif
  8178. share/doc/qt5/qtquick/images/viewtransitions-scriptactionbad.gif
  8179. share/doc/qt5/qtquick/images/visual-coordinates-example.png
  8180. share/doc/qt5/qtquick/images/visual-parent-example.png
  8181. share/doc/qt5/qtquick/images/visual-parent-example2.png
  8182. share/doc/qt5/qtquick/images/visualcanvas_list.png
  8183. share/doc/qt5/qtquick/images/visualcanvas_overlap.png
  8184. share/doc/qt5/qtquick/images/visualize-batches.png
  8185. share/doc/qt5/qtquick/images/visualize-clip.png
  8186. share/doc/qt5/qtquick/images/visualize-original.png
  8187. share/doc/qt5/qtquick/images/visualize-overdraw-1.png
  8188. share/doc/qt5/qtquick/images/visualize-overdraw-2.png
  8189. share/doc/qt5/qtquick/qml-advtutorial.html
  8190. share/doc/qt5/qtquick/qml-color.html
  8191. share/doc/qt5/qtquick/qml-dynamicview-tutorial.html
  8192. share/doc/qt5/qtquick/qml-font.html
  8193. share/doc/qt5/qtquick/qml-matrix4x4.html
  8194. share/doc/qt5/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
  8195. share/doc/qt5/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
  8196. share/doc/qt5/qtquick/qml-qt-labs-settings-settings-members.html
  8197. share/doc/qt5/qtquick/qml-qt-labs-settings-settings.html
  8198. share/doc/qt5/qtquick/qml-qtquick-accessible-members.html
  8199. share/doc/qt5/qtquick/qml-qtquick-accessible.html
  8200. share/doc/qt5/qtquick/qml-qtquick-anchoranimation-members.html
  8201. share/doc/qt5/qtquick/qml-qtquick-anchoranimation.html
  8202. share/doc/qt5/qtquick/qml-qtquick-anchorchanges-members.html
  8203. share/doc/qt5/qtquick/qml-qtquick-anchorchanges.html
  8204. share/doc/qt5/qtquick/qml-qtquick-animatedimage-members.html
  8205. share/doc/qt5/qtquick/qml-qtquick-animatedimage.html
  8206. share/doc/qt5/qtquick/qml-qtquick-animatedsprite-members.html
  8207. share/doc/qt5/qtquick/qml-qtquick-animatedsprite.html
  8208. share/doc/qt5/qtquick/qml-qtquick-animation-members.html
  8209. share/doc/qt5/qtquick/qml-qtquick-animation.html
  8210. share/doc/qt5/qtquick/qml-qtquick-animationcontroller-members.html
  8211. share/doc/qt5/qtquick/qml-qtquick-animationcontroller.html
  8212. share/doc/qt5/qtquick/qml-qtquick-animator-members.html
  8213. share/doc/qt5/qtquick/qml-qtquick-animator.html
  8214. share/doc/qt5/qtquick/qml-qtquick-behavior-members.html
  8215. share/doc/qt5/qtquick/qml-qtquick-behavior.html
  8216. share/doc/qt5/qtquick/qml-qtquick-borderimage-members.html
  8217. share/doc/qt5/qtquick/qml-qtquick-borderimage.html
  8218. share/doc/qt5/qtquick/qml-qtquick-borderimagemesh-members.html
  8219. share/doc/qt5/qtquick/qml-qtquick-borderimagemesh.html
  8220. share/doc/qt5/qtquick/qml-qtquick-canvas-members.html
  8221. share/doc/qt5/qtquick/qml-qtquick-canvas-obsolete.html
  8222. share/doc/qt5/qtquick/qml-qtquick-canvas.html
  8223. share/doc/qt5/qtquick/qml-qtquick-canvasgradient-members.html
  8224. share/doc/qt5/qtquick/qml-qtquick-canvasgradient.html
  8225. share/doc/qt5/qtquick/qml-qtquick-canvasimagedata-members.html
  8226. share/doc/qt5/qtquick/qml-qtquick-canvasimagedata.html
  8227. share/doc/qt5/qtquick/qml-qtquick-canvaspixelarray-members.html
  8228. share/doc/qt5/qtquick/qml-qtquick-canvaspixelarray.html
  8229. share/doc/qt5/qtquick/qml-qtquick-coloranimation-members.html
  8230. share/doc/qt5/qtquick/qml-qtquick-coloranimation.html
  8231. share/doc/qt5/qtquick/qml-qtquick-column-members.html
  8232. share/doc/qt5/qtquick/qml-qtquick-column.html
  8233. share/doc/qt5/qtquick/qml-qtquick-context2d-members.html
  8234. share/doc/qt5/qtquick/qml-qtquick-context2d.html
  8235. share/doc/qt5/qtquick/qml-qtquick-doublevalidator-members.html
  8236. share/doc/qt5/qtquick/qml-qtquick-doublevalidator.html
  8237. share/doc/qt5/qtquick/qml-qtquick-drag-members.html
  8238. share/doc/qt5/qtquick/qml-qtquick-drag.html
  8239. share/doc/qt5/qtquick/qml-qtquick-dragevent-members.html
  8240. share/doc/qt5/qtquick/qml-qtquick-dragevent.html
  8241. share/doc/qt5/qtquick/qml-qtquick-droparea-members.html
  8242. share/doc/qt5/qtquick/qml-qtquick-droparea.html
  8243. share/doc/qt5/qtquick/qml-qtquick-enterkey-members.html
  8244. share/doc/qt5/qtquick/qml-qtquick-enterkey.html
  8245. share/doc/qt5/qtquick/qml-qtquick-flickable-members.html
  8246. share/doc/qt5/qtquick/qml-qtquick-flickable.html
  8247. share/doc/qt5/qtquick/qml-qtquick-flipable-members.html
  8248. share/doc/qt5/qtquick/qml-qtquick-flipable.html
  8249. share/doc/qt5/qtquick/qml-qtquick-flow-members.html
  8250. share/doc/qt5/qtquick/qml-qtquick-flow.html
  8251. share/doc/qt5/qtquick/qml-qtquick-focusscope-members.html
  8252. share/doc/qt5/qtquick/qml-qtquick-focusscope.html
  8253. share/doc/qt5/qtquick/qml-qtquick-fontloader-members.html
  8254. share/doc/qt5/qtquick/qml-qtquick-fontloader.html
  8255. share/doc/qt5/qtquick/qml-qtquick-fontmetrics-members.html
  8256. share/doc/qt5/qtquick/qml-qtquick-fontmetrics.html
  8257. share/doc/qt5/qtquick/qml-qtquick-gradient-members.html
  8258. share/doc/qt5/qtquick/qml-qtquick-gradient.html
  8259. share/doc/qt5/qtquick/qml-qtquick-gradientstop-members.html
  8260. share/doc/qt5/qtquick/qml-qtquick-gradientstop.html
  8261. share/doc/qt5/qtquick/qml-qtquick-graphicsinfo-members.html
  8262. share/doc/qt5/qtquick/qml-qtquick-graphicsinfo.html
  8263. share/doc/qt5/qtquick/qml-qtquick-grid-members.html
  8264. share/doc/qt5/qtquick/qml-qtquick-grid.html
  8265. share/doc/qt5/qtquick/qml-qtquick-gridmesh-members.html
  8266. share/doc/qt5/qtquick/qml-qtquick-gridmesh.html
  8267. share/doc/qt5/qtquick/qml-qtquick-gridview-members.html
  8268. share/doc/qt5/qtquick/qml-qtquick-gridview.html
  8269. share/doc/qt5/qtquick/qml-qtquick-image-members.html
  8270. share/doc/qt5/qtquick/qml-qtquick-image.html
  8271. share/doc/qt5/qtquick/qml-qtquick-intvalidator-members.html
  8272. share/doc/qt5/qtquick/qml-qtquick-intvalidator.html
  8273. share/doc/qt5/qtquick/qml-qtquick-item-members.html
  8274. share/doc/qt5/qtquick/qml-qtquick-item.html
  8275. share/doc/qt5/qtquick/qml-qtquick-itemgrabresult-members.html
  8276. share/doc/qt5/qtquick/qml-qtquick-itemgrabresult.html
  8277. share/doc/qt5/qtquick/qml-qtquick-keyevent-members.html
  8278. share/doc/qt5/qtquick/qml-qtquick-keyevent.html
  8279. share/doc/qt5/qtquick/qml-qtquick-keynavigation-members.html
  8280. share/doc/qt5/qtquick/qml-qtquick-keynavigation.html
  8281. share/doc/qt5/qtquick/qml-qtquick-keys-members.html
  8282. share/doc/qt5/qtquick/qml-qtquick-keys.html
  8283. share/doc/qt5/qtquick/qml-qtquick-layoutmirroring-members.html
  8284. share/doc/qt5/qtquick/qml-qtquick-layoutmirroring.html
  8285. share/doc/qt5/qtquick/qml-qtquick-layouts-columnlayout-members.html
  8286. share/doc/qt5/qtquick/qml-qtquick-layouts-columnlayout.html
  8287. share/doc/qt5/qtquick/qml-qtquick-layouts-gridlayout-members.html
  8288. share/doc/qt5/qtquick/qml-qtquick-layouts-gridlayout.html
  8289. share/doc/qt5/qtquick/qml-qtquick-layouts-layout-members.html
  8290. share/doc/qt5/qtquick/qml-qtquick-layouts-layout.html
  8291. share/doc/qt5/qtquick/qml-qtquick-layouts-rowlayout-members.html
  8292. share/doc/qt5/qtquick/qml-qtquick-layouts-rowlayout.html
  8293. share/doc/qt5/qtquick/qml-qtquick-layouts-stacklayout-members.html
  8294. share/doc/qt5/qtquick/qml-qtquick-layouts-stacklayout.html
  8295. share/doc/qt5/qtquick/qml-qtquick-listview-members.html
  8296. share/doc/qt5/qtquick/qml-qtquick-listview.html
  8297. share/doc/qt5/qtquick/qml-qtquick-loader-members.html
  8298. share/doc/qt5/qtquick/qml-qtquick-loader.html
  8299. share/doc/qt5/qtquick/qml-qtquick-matrix4x4-members.html
  8300. share/doc/qt5/qtquick/qml-qtquick-matrix4x4.html
  8301. share/doc/qt5/qtquick/qml-qtquick-mousearea-members.html
  8302. share/doc/qt5/qtquick/qml-qtquick-mousearea.html
  8303. share/doc/qt5/qtquick/qml-qtquick-mouseevent-members.html
  8304. share/doc/qt5/qtquick/qml-qtquick-mouseevent.html
  8305. share/doc/qt5/qtquick/qml-qtquick-multipointtoucharea-members.html
  8306. share/doc/qt5/qtquick/qml-qtquick-multipointtoucharea.html
  8307. share/doc/qt5/qtquick/qml-qtquick-numberanimation-members.html
  8308. share/doc/qt5/qtquick/qml-qtquick-numberanimation.html
  8309. share/doc/qt5/qtquick/qml-qtquick-opacityanimator-members.html
  8310. share/doc/qt5/qtquick/qml-qtquick-opacityanimator.html
  8311. share/doc/qt5/qtquick/qml-qtquick-openglinfo-members.html
  8312. share/doc/qt5/qtquick/qml-qtquick-openglinfo.html
  8313. share/doc/qt5/qtquick/qml-qtquick-parallelanimation-members.html
  8314. share/doc/qt5/qtquick/qml-qtquick-parallelanimation.html
  8315. share/doc/qt5/qtquick/qml-qtquick-parentanimation-members.html
  8316. share/doc/qt5/qtquick/qml-qtquick-parentanimation.html
  8317. share/doc/qt5/qtquick/qml-qtquick-parentchange-members.html
  8318. share/doc/qt5/qtquick/qml-qtquick-parentchange.html
  8319. share/doc/qt5/qtquick/qml-qtquick-particles-affector-members.html
  8320. share/doc/qt5/qtquick/qml-qtquick-particles-affector.html
  8321. share/doc/qt5/qtquick/qml-qtquick-particles-age-members.html
  8322. share/doc/qt5/qtquick/qml-qtquick-particles-age.html
  8323. share/doc/qt5/qtquick/qml-qtquick-particles-angledirection-members.html
  8324. share/doc/qt5/qtquick/qml-qtquick-particles-angledirection.html
  8325. share/doc/qt5/qtquick/qml-qtquick-particles-attractor-members.html
  8326. share/doc/qt5/qtquick/qml-qtquick-particles-attractor.html
  8327. share/doc/qt5/qtquick/qml-qtquick-particles-cumulativedirection-members.html
  8328. share/doc/qt5/qtquick/qml-qtquick-particles-cumulativedirection.html
  8329. share/doc/qt5/qtquick/qml-qtquick-particles-customparticle-members.html
  8330. share/doc/qt5/qtquick/qml-qtquick-particles-customparticle.html
  8331. share/doc/qt5/qtquick/qml-qtquick-particles-direction-members.html
  8332. share/doc/qt5/qtquick/qml-qtquick-particles-direction.html
  8333. share/doc/qt5/qtquick/qml-qtquick-particles-ellipseshape-members.html
  8334. share/doc/qt5/qtquick/qml-qtquick-particles-ellipseshape.html
  8335. share/doc/qt5/qtquick/qml-qtquick-particles-emitter-members.html
  8336. share/doc/qt5/qtquick/qml-qtquick-particles-emitter.html
  8337. share/doc/qt5/qtquick/qml-qtquick-particles-friction-members.html
  8338. share/doc/qt5/qtquick/qml-qtquick-particles-friction.html
  8339. share/doc/qt5/qtquick/qml-qtquick-particles-gravity-members.html
  8340. share/doc/qt5/qtquick/qml-qtquick-particles-gravity-obsolete.html
  8341. share/doc/qt5/qtquick/qml-qtquick-particles-gravity.html
  8342. share/doc/qt5/qtquick/qml-qtquick-particles-groupgoal-members.html
  8343. share/doc/qt5/qtquick/qml-qtquick-particles-groupgoal.html
  8344. share/doc/qt5/qtquick/qml-qtquick-particles-imageparticle-members.html
  8345. share/doc/qt5/qtquick/qml-qtquick-particles-imageparticle.html
  8346. share/doc/qt5/qtquick/qml-qtquick-particles-itemparticle-members.html
  8347. share/doc/qt5/qtquick/qml-qtquick-particles-itemparticle.html
  8348. share/doc/qt5/qtquick/qml-qtquick-particles-lineshape-members.html
  8349. share/doc/qt5/qtquick/qml-qtquick-particles-lineshape.html
  8350. share/doc/qt5/qtquick/qml-qtquick-particles-maskshape-members.html
  8351. share/doc/qt5/qtquick/qml-qtquick-particles-maskshape.html
  8352. share/doc/qt5/qtquick/qml-qtquick-particles-particle-members.html
  8353. share/doc/qt5/qtquick/qml-qtquick-particles-particle.html
  8354. share/doc/qt5/qtquick/qml-qtquick-particles-particlegroup-members.html
  8355. share/doc/qt5/qtquick/qml-qtquick-particles-particlegroup.html
  8356. share/doc/qt5/qtquick/qml-qtquick-particles-particlepainter-members.html
  8357. share/doc/qt5/qtquick/qml-qtquick-particles-particlepainter.html
  8358. share/doc/qt5/qtquick/qml-qtquick-particles-particlesystem-members.html
  8359. share/doc/qt5/qtquick/qml-qtquick-particles-particlesystem.html
  8360. share/doc/qt5/qtquick/qml-qtquick-particles-pointdirection-members.html
  8361. share/doc/qt5/qtquick/qml-qtquick-particles-pointdirection.html
  8362. share/doc/qt5/qtquick/qml-qtquick-particles-rectangleshape-members.html
  8363. share/doc/qt5/qtquick/qml-qtquick-particles-rectangleshape.html
  8364. share/doc/qt5/qtquick/qml-qtquick-particles-shape-members.html
  8365. share/doc/qt5/qtquick/qml-qtquick-particles-shape.html
  8366. share/doc/qt5/qtquick/qml-qtquick-particles-spritegoal-members.html
  8367. share/doc/qt5/qtquick/qml-qtquick-particles-spritegoal.html
  8368. share/doc/qt5/qtquick/qml-qtquick-particles-targetdirection-members.html
  8369. share/doc/qt5/qtquick/qml-qtquick-particles-targetdirection.html
  8370. share/doc/qt5/qtquick/qml-qtquick-particles-trailemitter-members.html
  8371. share/doc/qt5/qtquick/qml-qtquick-particles-trailemitter.html
  8372. share/doc/qt5/qtquick/qml-qtquick-particles-turbulence-members.html
  8373. share/doc/qt5/qtquick/qml-qtquick-particles-turbulence.html
  8374. share/doc/qt5/qtquick/qml-qtquick-particles-wander-members.html
  8375. share/doc/qt5/qtquick/qml-qtquick-particles-wander.html
  8376. share/doc/qt5/qtquick/qml-qtquick-path-members.html
  8377. share/doc/qt5/qtquick/qml-qtquick-path.html
  8378. share/doc/qt5/qtquick/qml-qtquick-pathanimation-members.html
  8379. share/doc/qt5/qtquick/qml-qtquick-pathanimation.html
  8380. share/doc/qt5/qtquick/qml-qtquick-patharc-members.html
  8381. share/doc/qt5/qtquick/qml-qtquick-patharc.html
  8382. share/doc/qt5/qtquick/qml-qtquick-pathattribute-members.html
  8383. share/doc/qt5/qtquick/qml-qtquick-pathattribute.html
  8384. share/doc/qt5/qtquick/qml-qtquick-pathcubic-members.html
  8385. share/doc/qt5/qtquick/qml-qtquick-pathcubic.html
  8386. share/doc/qt5/qtquick/qml-qtquick-pathcurve-members.html
  8387. share/doc/qt5/qtquick/qml-qtquick-pathcurve.html
  8388. share/doc/qt5/qtquick/qml-qtquick-pathelement-members.html
  8389. share/doc/qt5/qtquick/qml-qtquick-pathelement.html
  8390. share/doc/qt5/qtquick/qml-qtquick-pathinterpolator-members.html
  8391. share/doc/qt5/qtquick/qml-qtquick-pathinterpolator.html
  8392. share/doc/qt5/qtquick/qml-qtquick-pathline-members.html
  8393. share/doc/qt5/qtquick/qml-qtquick-pathline.html
  8394. share/doc/qt5/qtquick/qml-qtquick-pathpercent-members.html
  8395. share/doc/qt5/qtquick/qml-qtquick-pathpercent.html
  8396. share/doc/qt5/qtquick/qml-qtquick-pathquad-members.html
  8397. share/doc/qt5/qtquick/qml-qtquick-pathquad.html
  8398. share/doc/qt5/qtquick/qml-qtquick-pathsvg-members.html
  8399. share/doc/qt5/qtquick/qml-qtquick-pathsvg.html
  8400. share/doc/qt5/qtquick/qml-qtquick-pathview-members.html
  8401. share/doc/qt5/qtquick/qml-qtquick-pathview.html
  8402. share/doc/qt5/qtquick/qml-qtquick-pauseanimation-members.html
  8403. share/doc/qt5/qtquick/qml-qtquick-pauseanimation.html
  8404. share/doc/qt5/qtquick/qml-qtquick-pincharea-members.html
  8405. share/doc/qt5/qtquick/qml-qtquick-pincharea.html
  8406. share/doc/qt5/qtquick/qml-qtquick-pinchevent-members.html
  8407. share/doc/qt5/qtquick/qml-qtquick-pinchevent.html
  8408. share/doc/qt5/qtquick/qml-qtquick-positioner-members.html
  8409. share/doc/qt5/qtquick/qml-qtquick-positioner.html
  8410. share/doc/qt5/qtquick/qml-qtquick-propertyaction-members.html
  8411. share/doc/qt5/qtquick/qml-qtquick-propertyaction.html
  8412. share/doc/qt5/qtquick/qml-qtquick-propertyanimation-members.html
  8413. share/doc/qt5/qtquick/qml-qtquick-propertyanimation.html
  8414. share/doc/qt5/qtquick/qml-qtquick-propertychanges-members.html
  8415. share/doc/qt5/qtquick/qml-qtquick-propertychanges.html
  8416. share/doc/qt5/qtquick/qml-qtquick-rectangle-members.html
  8417. share/doc/qt5/qtquick/qml-qtquick-rectangle.html
  8418. share/doc/qt5/qtquick/qml-qtquick-regexpvalidator-members.html
  8419. share/doc/qt5/qtquick/qml-qtquick-regexpvalidator.html
  8420. share/doc/qt5/qtquick/qml-qtquick-repeater-members.html
  8421. share/doc/qt5/qtquick/qml-qtquick-repeater.html
  8422. share/doc/qt5/qtquick/qml-qtquick-rotation-members.html
  8423. share/doc/qt5/qtquick/qml-qtquick-rotation.html
  8424. share/doc/qt5/qtquick/qml-qtquick-rotationanimation-members.html
  8425. share/doc/qt5/qtquick/qml-qtquick-rotationanimation.html
  8426. share/doc/qt5/qtquick/qml-qtquick-rotationanimator-members.html
  8427. share/doc/qt5/qtquick/qml-qtquick-rotationanimator.html
  8428. share/doc/qt5/qtquick/qml-qtquick-row-members.html
  8429. share/doc/qt5/qtquick/qml-qtquick-row.html
  8430. share/doc/qt5/qtquick/qml-qtquick-scale-members.html
  8431. share/doc/qt5/qtquick/qml-qtquick-scale.html
  8432. share/doc/qt5/qtquick/qml-qtquick-scaleanimator-members.html
  8433. share/doc/qt5/qtquick/qml-qtquick-scaleanimator.html
  8434. share/doc/qt5/qtquick/qml-qtquick-scriptaction-members.html
  8435. share/doc/qt5/qtquick/qml-qtquick-scriptaction.html
  8436. share/doc/qt5/qtquick/qml-qtquick-sequentialanimation-members.html
  8437. share/doc/qt5/qtquick/qml-qtquick-sequentialanimation.html
  8438. share/doc/qt5/qtquick/qml-qtquick-shadereffect-members.html
  8439. share/doc/qt5/qtquick/qml-qtquick-shadereffect.html
  8440. share/doc/qt5/qtquick/qml-qtquick-shadereffectsource-members.html
  8441. share/doc/qt5/qtquick/qml-qtquick-shadereffectsource.html
  8442. share/doc/qt5/qtquick/qml-qtquick-shortcut-members.html
  8443. share/doc/qt5/qtquick/qml-qtquick-shortcut.html
  8444. share/doc/qt5/qtquick/qml-qtquick-smoothedanimation-members.html
  8445. share/doc/qt5/qtquick/qml-qtquick-smoothedanimation.html
  8446. share/doc/qt5/qtquick/qml-qtquick-springanimation-members.html
  8447. share/doc/qt5/qtquick/qml-qtquick-springanimation.html
  8448. share/doc/qt5/qtquick/qml-qtquick-sprite-members.html
  8449. share/doc/qt5/qtquick/qml-qtquick-sprite.html
  8450. share/doc/qt5/qtquick/qml-qtquick-spritesequence-members.html
  8451. share/doc/qt5/qtquick/qml-qtquick-spritesequence.html
  8452. share/doc/qt5/qtquick/qml-qtquick-state-members.html
  8453. share/doc/qt5/qtquick/qml-qtquick-state.html
  8454. share/doc/qt5/qtquick/qml-qtquick-statechangescript-members.html
  8455. share/doc/qt5/qtquick/qml-qtquick-statechangescript.html
  8456. share/doc/qt5/qtquick/qml-qtquick-stategroup-members.html
  8457. share/doc/qt5/qtquick/qml-qtquick-stategroup.html
  8458. share/doc/qt5/qtquick/qml-qtquick-systempalette-members.html
  8459. share/doc/qt5/qtquick/qml-qtquick-systempalette.html
  8460. share/doc/qt5/qtquick/qml-qtquick-text-members.html
  8461. share/doc/qt5/qtquick/qml-qtquick-text-obsolete.html
  8462. share/doc/qt5/qtquick/qml-qtquick-text.html
  8463. share/doc/qt5/qtquick/qml-qtquick-textedit-members.html
  8464. share/doc/qt5/qtquick/qml-qtquick-textedit.html
  8465. share/doc/qt5/qtquick/qml-qtquick-textinput-members.html
  8466. share/doc/qt5/qtquick/qml-qtquick-textinput.html
  8467. share/doc/qt5/qtquick/qml-qtquick-textmetrics-members.html
  8468. share/doc/qt5/qtquick/qml-qtquick-textmetrics.html
  8469. share/doc/qt5/qtquick/qml-qtquick-touchpoint-members.html
  8470. share/doc/qt5/qtquick/qml-qtquick-touchpoint-obsolete.html
  8471. share/doc/qt5/qtquick/qml-qtquick-touchpoint.html
  8472. share/doc/qt5/qtquick/qml-qtquick-transform-members.html
  8473. share/doc/qt5/qtquick/qml-qtquick-transform.html
  8474. share/doc/qt5/qtquick/qml-qtquick-transition-members.html
  8475. share/doc/qt5/qtquick/qml-qtquick-transition.html
  8476. share/doc/qt5/qtquick/qml-qtquick-translate-members.html
  8477. share/doc/qt5/qtquick/qml-qtquick-translate.html
  8478. share/doc/qt5/qtquick/qml-qtquick-uniformanimator-members.html
  8479. share/doc/qt5/qtquick/qml-qtquick-uniformanimator.html
  8480. share/doc/qt5/qtquick/qml-qtquick-vector3danimation-members.html
  8481. share/doc/qt5/qtquick/qml-qtquick-vector3danimation.html
  8482. share/doc/qt5/qtquick/qml-qtquick-viewtransition-members.html
  8483. share/doc/qt5/qtquick/qml-qtquick-viewtransition.html
  8484. share/doc/qt5/qtquick/qml-qtquick-wheelevent-members.html
  8485. share/doc/qt5/qtquick/qml-qtquick-wheelevent.html
  8486. share/doc/qt5/qtquick/qml-qtquick-window-closeevent-members.html
  8487. share/doc/qt5/qtquick/qml-qtquick-window-closeevent.html
  8488. share/doc/qt5/qtquick/qml-qtquick-window-screen-members.html
  8489. share/doc/qt5/qtquick/qml-qtquick-window-screen-obsolete.html
  8490. share/doc/qt5/qtquick/qml-qtquick-window-screen.html
  8491. share/doc/qt5/qtquick/qml-qtquick-window-window-members.html
  8492. share/doc/qt5/qtquick/qml-qtquick-window-window.html
  8493. share/doc/qt5/qtquick/qml-qtquick-xanimator-members.html
  8494. share/doc/qt5/qtquick/qml-qtquick-xanimator.html
  8495. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmllistmodel-members.html
  8496. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmllistmodel.html
  8497. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmlrole-members.html
  8498. share/doc/qt5/qtquick/qml-qtquick-xmllistmodel-xmlrole.html
  8499. share/doc/qt5/qtquick/qml-qtquick-yanimator-members.html
  8500. share/doc/qt5/qtquick/qml-qtquick-yanimator.html
  8501. share/doc/qt5/qtquick/qml-qttest-signalspy-members.html
  8502. share/doc/qt5/qtquick/qml-qttest-signalspy.html
  8503. share/doc/qt5/qtquick/qml-qttest-testcase-members.html
  8504. share/doc/qt5/qtquick/qml-qttest-testcase.html
  8505. share/doc/qt5/qtquick/qml-qttest-toucheventsequence-members.html
  8506. share/doc/qt5/qtquick/qml-qttest-toucheventsequence.html
  8507. share/doc/qt5/qtquick/qml-quaternion.html
  8508. share/doc/qt5/qtquick/qml-tutorial.html
  8509. share/doc/qt5/qtquick/qml-tutorial1.html
  8510. share/doc/qt5/qtquick/qml-tutorial2.html
  8511. share/doc/qt5/qtquick/qml-tutorial3.html
  8512. share/doc/qt5/qtquick/qml-vector2d.html
  8513. share/doc/qt5/qtquick/qml-vector3d.html
  8514. share/doc/qt5/qtquick/qml-vector4d.html
  8515. share/doc/qt5/qtquick/qmlexampletoggleswitch.html
  8516. share/doc/qt5/qtquick/qquickasyncimageprovider-members.html
  8517. share/doc/qt5/qtquick/qquickasyncimageprovider.html
  8518. share/doc/qt5/qtquick/qquickframebufferobject-members.html
  8519. share/doc/qt5/qtquick/qquickframebufferobject-renderer-members.html
  8520. share/doc/qt5/qtquick/qquickframebufferobject-renderer.html
  8521. share/doc/qt5/qtquick/qquickframebufferobject.html
  8522. share/doc/qt5/qtquick/qquickimageprovider-members.html
  8523. share/doc/qt5/qtquick/qquickimageprovider.html
  8524. share/doc/qt5/qtquick/qquickimageresponse-members.html
  8525. share/doc/qt5/qtquick/qquickimageresponse.html
  8526. share/doc/qt5/qtquick/qquickitem-itemchangedata-members.html
  8527. share/doc/qt5/qtquick/qquickitem-itemchangedata.html
  8528. share/doc/qt5/qtquick/qquickitem-members.html
  8529. share/doc/qt5/qtquick/qquickitem-updatepaintnodedata-members.html
  8530. share/doc/qt5/qtquick/qquickitem-updatepaintnodedata.html
  8531. share/doc/qt5/qtquick/qquickitem.html
  8532. share/doc/qt5/qtquick/qquickitemgrabresult-members.html
  8533. share/doc/qt5/qtquick/qquickitemgrabresult.html
  8534. share/doc/qt5/qtquick/qquickpainteditem-members.html
  8535. share/doc/qt5/qtquick/qquickpainteditem-obsolete.html
  8536. share/doc/qt5/qtquick/qquickpainteditem.html
  8537. share/doc/qt5/qtquick/qquickrendercontrol-members.html
  8538. share/doc/qt5/qtquick/qquickrendercontrol.html
  8539. share/doc/qt5/qtquick/qquicktextdocument-members.html
  8540. share/doc/qt5/qtquick/qquicktextdocument.html
  8541. share/doc/qt5/qtquick/qquicktexturefactory-members.html
  8542. share/doc/qt5/qtquick/qquicktexturefactory.html
  8543. share/doc/qt5/qtquick/qquickview-members.html
  8544. share/doc/qt5/qtquick/qquickview.html
  8545. share/doc/qt5/qtquick/qquickwidget-members.html
  8546. share/doc/qt5/qtquick/qquickwidget.html
  8547. share/doc/qt5/qtquick/qquickwindow-members.html
  8548. share/doc/qt5/qtquick/qquickwindow-obsolete.html
  8549. share/doc/qt5/qtquick/qquickwindow.html
  8550. share/doc/qt5/qtquick/qsgabstractrenderer-members.html
  8551. share/doc/qt5/qtquick/qsgabstractrenderer.html
  8552. share/doc/qt5/qtquick/qsgbasicgeometrynode-members.html
  8553. share/doc/qt5/qtquick/qsgbasicgeometrynode.html
  8554. share/doc/qt5/qtquick/qsgclipnode-members.html
  8555. share/doc/qt5/qtquick/qsgclipnode.html
  8556. share/doc/qt5/qtquick/qsgdynamictexture-members.html
  8557. share/doc/qt5/qtquick/qsgdynamictexture.html
  8558. share/doc/qt5/qtquick/qsgengine-members.html
  8559. share/doc/qt5/qtquick/qsgengine.html
  8560. share/doc/qt5/qtquick/qsgflatcolormaterial-members.html
  8561. share/doc/qt5/qtquick/qsgflatcolormaterial.html
  8562. share/doc/qt5/qtquick/qsggeometry-attribute-members.html
  8563. share/doc/qt5/qtquick/qsggeometry-attribute.html
  8564. share/doc/qt5/qtquick/qsggeometry-attributeset-members.html
  8565. share/doc/qt5/qtquick/qsggeometry-attributeset.html
  8566. share/doc/qt5/qtquick/qsggeometry-coloredpoint2d-members.html
  8567. share/doc/qt5/qtquick/qsggeometry-coloredpoint2d.html
  8568. share/doc/qt5/qtquick/qsggeometry-members.html
  8569. share/doc/qt5/qtquick/qsggeometry-point2d-members.html
  8570. share/doc/qt5/qtquick/qsggeometry-point2d.html
  8571. share/doc/qt5/qtquick/qsggeometry-texturedpoint2d-members.html
  8572. share/doc/qt5/qtquick/qsggeometry-texturedpoint2d.html
  8573. share/doc/qt5/qtquick/qsggeometry.html
  8574. share/doc/qt5/qtquick/qsggeometrynode-members.html
  8575. share/doc/qt5/qtquick/qsggeometrynode.html
  8576. share/doc/qt5/qtquick/qsgimagenode-members.html
  8577. share/doc/qt5/qtquick/qsgimagenode.html
  8578. share/doc/qt5/qtquick/qsgmaterial-members.html
  8579. share/doc/qt5/qtquick/qsgmaterial.html
  8580. share/doc/qt5/qtquick/qsgmaterialshader-members.html
  8581. share/doc/qt5/qtquick/qsgmaterialshader-renderstate-members.html
  8582. share/doc/qt5/qtquick/qsgmaterialshader-renderstate.html
  8583. share/doc/qt5/qtquick/qsgmaterialshader.html
  8584. share/doc/qt5/qtquick/qsgmaterialtype.html
  8585. share/doc/qt5/qtquick/qsgnode-members.html
  8586. share/doc/qt5/qtquick/qsgnode.html
  8587. share/doc/qt5/qtquick/qsgopacitynode-members.html
  8588. share/doc/qt5/qtquick/qsgopacitynode.html
  8589. share/doc/qt5/qtquick/qsgopaquetexturematerial-members.html
  8590. share/doc/qt5/qtquick/qsgopaquetexturematerial.html
  8591. share/doc/qt5/qtquick/qsgrectanglenode-members.html
  8592. share/doc/qt5/qtquick/qsgrectanglenode.html
  8593. share/doc/qt5/qtquick/qsgrendererinterface-members.html
  8594. share/doc/qt5/qtquick/qsgrendererinterface.html
  8595. share/doc/qt5/qtquick/qsgrendernode-members.html
  8596. share/doc/qt5/qtquick/qsgrendernode-renderstate-members.html
  8597. share/doc/qt5/qtquick/qsgrendernode-renderstate.html
  8598. share/doc/qt5/qtquick/qsgrendernode.html
  8599. share/doc/qt5/qtquick/qsgsimplematerial-members.html
  8600. share/doc/qt5/qtquick/qsgsimplematerial.html
  8601. share/doc/qt5/qtquick/qsgsimplematerialshader-members.html
  8602. share/doc/qt5/qtquick/qsgsimplematerialshader.html
  8603. share/doc/qt5/qtquick/qsgsimplerectnode-members.html
  8604. share/doc/qt5/qtquick/qsgsimplerectnode.html
  8605. share/doc/qt5/qtquick/qsgsimpletexturenode-members.html
  8606. share/doc/qt5/qtquick/qsgsimpletexturenode.html
  8607. share/doc/qt5/qtquick/qsgtexture-members.html
  8608. share/doc/qt5/qtquick/qsgtexture.html
  8609. share/doc/qt5/qtquick/qsgtexturematerial-members.html
  8610. share/doc/qt5/qtquick/qsgtexturematerial.html
  8611. share/doc/qt5/qtquick/qsgtextureprovider-members.html
  8612. share/doc/qt5/qtquick/qsgtextureprovider.html
  8613. share/doc/qt5/qtquick/qsgtransformnode-members.html
  8614. share/doc/qt5/qtquick/qsgtransformnode.html
  8615. share/doc/qt5/qtquick/qsgvertexcolormaterial-members.html
  8616. share/doc/qt5/qtquick/qsgvertexcolormaterial.html
  8617. share/doc/qt5/qtquick/qt-labs-folderlistmodel-qmlmodule.html
  8618. share/doc/qt5/qtquick/qt-labs-settings-qmlmodule.html
  8619. share/doc/qt5/qtquick/qt-labs-sharedimage-qmlmodule.html
  8620. share/doc/qt5/qtquick/qtquick-animation-animation-pro.html
  8621. share/doc/qt5/qtquick/qtquick-animation-animation-qml.html
  8622. share/doc/qt5/qtquick/qtquick-animation-animation-qmlproject.html
  8623. share/doc/qt5/qtquick/qtquick-animation-animation-qrc.html
  8624. share/doc/qt5/qtquick/qtquick-animation-basics-animators-qml.html
  8625. share/doc/qt5/qtquick/qtquick-animation-basics-color-animation-qml.html
  8626. share/doc/qt5/qtquick/qtquick-animation-basics-property-animation-qml.html
  8627. share/doc/qt5/qtquick/qtquick-animation-behaviors-behavior-example-qml.html
  8628. share/doc/qt5/qtquick/qtquick-animation-behaviors-siderect-qml.html
  8629. share/doc/qt5/qtquick/qtquick-animation-behaviors-tvtennis-qml.html
  8630. share/doc/qt5/qtquick/qtquick-animation-behaviors-wigglytext-qml.html
  8631. share/doc/qt5/qtquick/qtquick-animation-easing-easing-qml.html
  8632. share/doc/qt5/qtquick/qtquick-animation-example.html
  8633. share/doc/qt5/qtquick/qtquick-animation-main-cpp.html
  8634. share/doc/qt5/qtquick/qtquick-animation-pathanimation-pathanimation-qml.html
  8635. share/doc/qt5/qtquick/qtquick-animation-pathinterpolator-pathinterpolator-qml.html
  8636. share/doc/qt5/qtquick/qtquick-animation-states-states-qml.html
  8637. share/doc/qt5/qtquick/qtquick-animation-states-transitions-qml.html
  8638. share/doc/qt5/qtquick/qtquick-canvas-beziercurve-beziercurve-qml.html
  8639. share/doc/qt5/qtquick/qtquick-canvas-canvas-pro.html
  8640. share/doc/qt5/qtquick/qtquick-canvas-canvas-qml.html
  8641. share/doc/qt5/qtquick/qtquick-canvas-canvas-qrc.html
  8642. share/doc/qt5/qtquick/qtquick-canvas-clip-clip-qml.html
  8643. share/doc/qt5/qtquick/qtquick-canvas-example.html
  8644. share/doc/qt5/qtquick/qtquick-canvas-main-cpp.html
  8645. share/doc/qt5/qtquick/qtquick-canvas-quadraticcurveto-quadraticcurveto-qml.html
  8646. share/doc/qt5/qtquick/qtquick-canvas-roundedrect-roundedrect-qml.html
  8647. share/doc/qt5/qtquick/qtquick-canvas-smile-smile-qml.html
  8648. share/doc/qt5/qtquick/qtquick-canvas-squircle-squircle-qml.html
  8649. share/doc/qt5/qtquick/qtquick-canvas-tiger-tiger-js.html
  8650. share/doc/qt5/qtquick/qtquick-canvas-tiger-tiger-qml.html
  8651. share/doc/qt5/qtquick/qtquick-codesamples.html
  8652. share/doc/qt5/qtquick/qtquick-convenience-topic.html
  8653. share/doc/qt5/qtquick/qtquick-cppextensionpoints.html
  8654. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-content-dial-qml.html
  8655. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-content-quitbutton-qml.html
  8656. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-pro.html
  8657. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qml.html
  8658. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qmlproject.html
  8659. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qrc.html
  8660. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-example.html
  8661. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-main-cpp.html
  8662. share/doc/qt5/qtquick/qtquick-customitems-flipable-content-card-qml.html
  8663. share/doc/qt5/qtquick/qtquick-customitems-flipable-example.html
  8664. share/doc/qt5/qtquick/qtquick-customitems-flipable-flipable-qml.html
  8665. share/doc/qt5/qtquick/qtquick-customitems-flipable-flipable-qmlproject.html
  8666. share/doc/qt5/qtquick/qtquick-customitems-painteditem-example.html
  8667. share/doc/qt5/qtquick/qtquick-customitems-painteditem-painteditem-pro.html
  8668. share/doc/qt5/qtquick/qtquick-customitems-painteditem-painteditem-qrc.html
  8669. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoon-cpp.html
  8670. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoon-h.html
  8671. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoonplugin-plugin-h.html
  8672. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoonplugin-qmldir.html
  8673. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoons-qml.html
  8674. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-example.html
  8675. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-main-qml.html
  8676. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-scrollbar-qml.html
  8677. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-scrollbar-qmlproject.html
  8678. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-example.html
  8679. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-main-qml.html
  8680. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-tabwidget-qml.html
  8681. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-tabwidget-qmlproject.html
  8682. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-pro.html
  8683. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-qml.html
  8684. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-qmlproject.html
  8685. share/doc/qt5/qtquick/qtquick-demos-calqlatr-calqlatr-qrc.html
  8686. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-button-qml.html
  8687. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-calculator-js.html
  8688. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-display-qml.html
  8689. share/doc/qt5/qtquick/qtquick-demos-calqlatr-content-numberpad-qml.html
  8690. share/doc/qt5/qtquick/qtquick-demos-calqlatr-example.html
  8691. share/doc/qt5/qtquick/qtquick-demos-calqlatr-main-cpp.html
  8692. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-pro.html
  8693. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-qml.html
  8694. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-qmlproject.html
  8695. share/doc/qt5/qtquick/qtquick-demos-clocks-clocks-qrc.html
  8696. share/doc/qt5/qtquick/qtquick-demos-clocks-content-clock-qml.html
  8697. share/doc/qt5/qtquick/qtquick-demos-clocks-example.html
  8698. share/doc/qt5/qtquick/qtquick-demos-clocks-main-cpp.html
  8699. share/doc/qt5/qtquick/qtquick-demos-maroon-content-buildbutton-qml.html
  8700. share/doc/qt5/qtquick/qtquick-demos-maroon-content-gamecanvas-qml.html
  8701. share/doc/qt5/qtquick/qtquick-demos-maroon-content-gameoverscreen-qml.html
  8702. share/doc/qt5/qtquick/qtquick-demos-maroon-content-infobar-qml.html
  8703. share/doc/qt5/qtquick/qtquick-demos-maroon-content-logic-js.html
  8704. share/doc/qt5/qtquick/qtquick-demos-maroon-content-mobs-mobbase-qml.html
  8705. share/doc/qt5/qtquick/qtquick-demos-maroon-content-newgamescreen-qml.html
  8706. share/doc/qt5/qtquick/qtquick-demos-maroon-content-soundeffect-qml.html
  8707. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-bomb-qml.html
  8708. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-factory-qml.html
  8709. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-melee-qml.html
  8710. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-ranged-qml.html
  8711. share/doc/qt5/qtquick/qtquick-demos-maroon-content-towers-towerbase-qml.html
  8712. share/doc/qt5/qtquick/qtquick-demos-maroon-example.html
  8713. share/doc/qt5/qtquick/qtquick-demos-maroon-main-cpp.html
  8714. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-pro.html
  8715. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-qml.html
  8716. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-qmlproject.html
  8717. share/doc/qt5/qtquick/qtquick-demos-maroon-maroon-qrc.html
  8718. share/doc/qt5/qtquick/qtquick-demos-photosurface-example.html
  8719. share/doc/qt5/qtquick/qtquick-demos-photosurface-main-cpp.html
  8720. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-pro.html
  8721. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-qml.html
  8722. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-qmlproject.html
  8723. share/doc/qt5/qtquick/qtquick-demos-photosurface-photosurface-qrc.html
  8724. share/doc/qt5/qtquick/qtquick-demos-photoviewer-example.html
  8725. share/doc/qt5/qtquick/qtquick-demos-photoviewer-i18n-qml-de-qm.html
  8726. share/doc/qt5/qtquick/qtquick-demos-photoviewer-i18n-qml-fr-qm.html
  8727. share/doc/qt5/qtquick/qtquick-demos-photoviewer-main-cpp.html
  8728. share/doc/qt5/qtquick/qtquick-demos-photoviewer-main-qml.html
  8729. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewer-pro.html
  8730. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-albumdelegate-qml.html
  8731. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-busyindicator-qml.html
  8732. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-button-qml.html
  8733. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-editablebutton-qml.html
  8734. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-photodelegate-qml.html
  8735. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-progressbar-qml.html
  8736. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-rssmodel-qml.html
  8737. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-script-script-js.html
  8738. share/doc/qt5/qtquick/qtquick-demos-photoviewer-photoviewercore-tag-qml.html
  8739. share/doc/qt5/qtquick/qtquick-demos-photoviewer-qml-qrc.html
  8740. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-busyindicator-qml.html
  8741. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-categorydelegate-qml.html
  8742. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-newsdelegate-qml.html
  8743. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-rssfeeds-qml.html
  8744. share/doc/qt5/qtquick/qtquick-demos-rssnews-content-scrollbar-qml.html
  8745. share/doc/qt5/qtquick/qtquick-demos-rssnews-example.html
  8746. share/doc/qt5/qtquick/qtquick-demos-rssnews-main-cpp.html
  8747. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-pro.html
  8748. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-qml.html
  8749. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-qmlproject.html
  8750. share/doc/qt5/qtquick/qtquick-demos-rssnews-rssnews-qrc.html
  8751. share/doc/qt5/qtquick/qtquick-demos-samegame-content-block-qml.html
  8752. share/doc/qt5/qtquick/qtquick-demos-samegame-content-blockemitter-qml.html
  8753. share/doc/qt5/qtquick/qtquick-demos-samegame-content-button-qml.html
  8754. share/doc/qt5/qtquick/qtquick-demos-samegame-content-gamearea-qml.html
  8755. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level0-qml.html
  8756. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level1-qml.html
  8757. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level2-qml.html
  8758. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level3-qml.html
  8759. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level4-qml.html
  8760. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level5-qml.html
  8761. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level6-qml.html
  8762. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level7-qml.html
  8763. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level8-qml.html
  8764. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-level9-qml.html
  8765. share/doc/qt5/qtquick/qtquick-demos-samegame-content-levels-templatebase-qml.html
  8766. share/doc/qt5/qtquick/qtquick-demos-samegame-content-logoanimation-qml.html
  8767. share/doc/qt5/qtquick/qtquick-demos-samegame-content-menuemitter-qml.html
  8768. share/doc/qt5/qtquick/qtquick-demos-samegame-content-paintemitter-qml.html
  8769. share/doc/qt5/qtquick/qtquick-demos-samegame-content-primarypack-qml.html
  8770. share/doc/qt5/qtquick/qtquick-demos-samegame-content-puzzleblock-qml.html
  8771. share/doc/qt5/qtquick/qtquick-demos-samegame-content-qmldir.html
  8772. share/doc/qt5/qtquick/qtquick-demos-samegame-content-samegame-js.html
  8773. share/doc/qt5/qtquick/qtquick-demos-samegame-content-samegametext-qml.html
  8774. share/doc/qt5/qtquick/qtquick-demos-samegame-content-settings-qml.html
  8775. share/doc/qt5/qtquick/qtquick-demos-samegame-content-simpleblock-qml.html
  8776. share/doc/qt5/qtquick/qtquick-demos-samegame-content-smoketext-qml.html
  8777. share/doc/qt5/qtquick/qtquick-demos-samegame-example.html
  8778. share/doc/qt5/qtquick/qtquick-demos-samegame-main-cpp.html
  8779. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-pro.html
  8780. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-qml.html
  8781. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-qmlproject.html
  8782. share/doc/qt5/qtquick/qtquick-demos-samegame-samegame-qrc.html
  8783. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-banner-qml.html
  8784. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-button-qml.html
  8785. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-checkbox-qml.html
  8786. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-qmldir.html
  8787. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-settings-qml.html
  8788. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockchart-qml.html
  8789. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockinfo-qml.html
  8790. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocklistdelegate-qml.html
  8791. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocklistmodel-qml.html
  8792. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocklistview-qml.html
  8793. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockmodel-qml.html
  8794. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stocksettingspanel-qml.html
  8795. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-stockview-qml.html
  8796. share/doc/qt5/qtquick/qtquick-demos-stocqt-content-windows-settings-qml.html
  8797. share/doc/qt5/qtquick/qtquick-demos-stocqt-example.html
  8798. share/doc/qt5/qtquick/qtquick-demos-stocqt-main-cpp.html
  8799. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-pro.html
  8800. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-qml.html
  8801. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-qmlproject.html
  8802. share/doc/qt5/qtquick/qtquick-demos-stocqt-stocqt-qrc.html
  8803. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-flipbar-qml.html
  8804. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-lineinput-qml.html
  8805. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-listfooter-qml.html
  8806. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-listheader-qml.html
  8807. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-searchdelegate-qml.html
  8808. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-tweetdelegate-qml.html
  8809. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-tweetsearch-js.html
  8810. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-content-tweetsmodel-qml.html
  8811. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-example.html
  8812. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-main-cpp.html
  8813. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-pro.html
  8814. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-qml.html
  8815. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-qmlproject.html
  8816. share/doc/qt5/qtquick/qtquick-demos-tweetsearch-tweetsearch-qrc.html
  8817. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-pro.html
  8818. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qml.html
  8819. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qmlproject.html
  8820. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qrc.html
  8821. share/doc/qt5/qtquick/qtquick-draganddrop-example.html
  8822. share/doc/qt5/qtquick/qtquick-draganddrop-main-cpp.html
  8823. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-dragtile-qml.html
  8824. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-droptile-qml.html
  8825. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-tiles-qml.html
  8826. share/doc/qt5/qtquick/qtquick-draganddrop-views-gridview-qml.html
  8827. share/doc/qt5/qtquick/qtquick-effects-particles.html
  8828. share/doc/qt5/qtquick/qtquick-effects-sprites.html
  8829. share/doc/qt5/qtquick/qtquick-effects-topic.html
  8830. share/doc/qt5/qtquick/qtquick-effects-transformations.html
  8831. share/doc/qt5/qtquick/qtquick-externaldraganddrop-draganddroptextitem-qml.html
  8832. share/doc/qt5/qtquick/qtquick-externaldraganddrop-example.html
  8833. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-pro.html
  8834. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qml.html
  8835. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qmlproject.html
  8836. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qrc.html
  8837. share/doc/qt5/qtquick/qtquick-externaldraganddrop-main-cpp.html
  8838. share/doc/qt5/qtquick/qtquick-imageelements-animatedsprite-qml.html
  8839. share/doc/qt5/qtquick/qtquick-imageelements-borderimage-qml.html
  8840. share/doc/qt5/qtquick/qtquick-imageelements-content-borderimageselector-qml.html
  8841. share/doc/qt5/qtquick/qtquick-imageelements-content-imagecell-qml.html
  8842. share/doc/qt5/qtquick/qtquick-imageelements-content-myborderimage-qml.html
  8843. share/doc/qt5/qtquick/qtquick-imageelements-content-shadowrectangle-qml.html
  8844. share/doc/qt5/qtquick/qtquick-imageelements-example.html
  8845. share/doc/qt5/qtquick/qtquick-imageelements-image-qml.html
  8846. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-pro.html
  8847. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qml.html
  8848. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qmlproject.html
  8849. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qrc.html
  8850. share/doc/qt5/qtquick/qtquick-imageelements-main-cpp.html
  8851. share/doc/qt5/qtquick/qtquick-imageelements-shadows-qml.html
  8852. share/doc/qt5/qtquick/qtquick-imageelements-spritesequence-qml.html
  8853. share/doc/qt5/qtquick/qtquick-imageprovider-example.html
  8854. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-cpp.html
  8855. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-example-qml.html
  8856. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-pro.html
  8857. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-qmlproject.html
  8858. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovidercore-qmldir.html
  8859. share/doc/qt5/qtquick/qtquick-imageresponseprovider-example.html
  8860. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-cpp.html
  8861. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-example-qml.html
  8862. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-pro.html
  8863. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-qmlproject.html
  8864. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovidercore-qmldir.html
  8865. share/doc/qt5/qtquick/qtquick-index.html
  8866. share/doc/qt5/qtquick/qtquick-input-focus.html
  8867. share/doc/qt5/qtquick/qtquick-input-mouseevents.html
  8868. share/doc/qt5/qtquick/qtquick-input-textinput.html
  8869. share/doc/qt5/qtquick/qtquick-input-topic.html
  8870. share/doc/qt5/qtquick/qtquick-keyinteraction-example.html
  8871. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-contextmenu-qml.html
  8872. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-gridmenu-qml.html
  8873. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-listmenu-qml.html
  8874. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-listviewdelegate-qml.html
  8875. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-tabmenu-qml.html
  8876. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-focus-qml.html
  8877. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-pro.html
  8878. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qml.html
  8879. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qmlproject.html
  8880. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qrc.html
  8881. share/doc/qt5/qtquick/qtquick-keyinteraction-main-cpp.html
  8882. share/doc/qt5/qtquick/qtquick-layouts-example.html
  8883. share/doc/qt5/qtquick/qtquick-layouts-layouts-pro.html
  8884. share/doc/qt5/qtquick/qtquick-layouts-layouts-qml.html
  8885. share/doc/qt5/qtquick/qtquick-layouts-layouts-qmlproject.html
  8886. share/doc/qt5/qtquick/qtquick-layouts-layouts-qrc.html
  8887. share/doc/qt5/qtquick/qtquick-layouts-main-cpp.html
  8888. share/doc/qt5/qtquick/qtquick-layouts-qmlmodule.html
  8889. share/doc/qt5/qtquick/qtquick-localstorage-example.html
  8890. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-database-js.html
  8891. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-header-qml.html
  8892. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-pro.html
  8893. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-qml.html
  8894. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-qrc.html
  8895. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-main-cpp.html
  8896. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mybutton-qml.html
  8897. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mydelegate-qml.html
  8898. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mymodel-qml.html
  8899. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-pro.html
  8900. share/doc/qt5/qtquick/qtquick-localstorage-qmlmodule.html
  8901. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-pro.html
  8902. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-qrc.html
  8903. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-example.html
  8904. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-main-cpp.html
  8905. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-model-cpp.html
  8906. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-model-h.html
  8907. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-view-qml.html
  8908. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-dataobject-cpp.html
  8909. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-dataobject-h.html
  8910. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-example.html
  8911. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-main-cpp.html
  8912. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-objectlistmodel-pro.html
  8913. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-objectlistmodel-qrc.html
  8914. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-view-qml.html
  8915. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-example.html
  8916. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-main-cpp.html
  8917. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-stringlistmodel-pro.html
  8918. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-stringlistmodel-qrc.html
  8919. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-view-qml.html
  8920. share/doc/qt5/qtquick/qtquick-modelviewsdata-cppmodels.html
  8921. share/doc/qt5/qtquick/qtquick-modelviewsdata-modelview.html
  8922. share/doc/qt5/qtquick/qtquick-modelviewsdata-topic.html
  8923. share/doc/qt5/qtquick/qtquick-module.html
  8924. share/doc/qt5/qtquick/qtquick-mousearea-example.html
  8925. share/doc/qt5/qtquick/qtquick-mousearea-main-cpp.html
  8926. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-pro.html
  8927. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qml.html
  8928. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qmlproject.html
  8929. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qrc.html
  8930. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-wheel-example-qml.html
  8931. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-pro.html
  8932. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qml.html
  8933. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qmlproject.html
  8934. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qrc.html
  8935. share/doc/qt5/qtquick/qtquick-particles-affectors-content-age-qml.html
  8936. share/doc/qt5/qtquick/qtquick-particles-affectors-content-attractor-qml.html
  8937. share/doc/qt5/qtquick/qtquick-particles-affectors-content-customaffector-qml.html
  8938. share/doc/qt5/qtquick/qtquick-particles-affectors-content-friction-qml.html
  8939. share/doc/qt5/qtquick/qtquick-particles-affectors-content-gravity-qml.html
  8940. share/doc/qt5/qtquick/qtquick-particles-affectors-content-greybutton-qml.html
  8941. share/doc/qt5/qtquick/qtquick-particles-affectors-content-groupgoal-qml.html
  8942. share/doc/qt5/qtquick/qtquick-particles-affectors-content-move-qml.html
  8943. share/doc/qt5/qtquick/qtquick-particles-affectors-content-spritegoal-qml.html
  8944. share/doc/qt5/qtquick/qtquick-particles-affectors-content-turbulence-qml.html
  8945. share/doc/qt5/qtquick/qtquick-particles-affectors-content-wander-qml.html
  8946. share/doc/qt5/qtquick/qtquick-particles-affectors-example.html
  8947. share/doc/qt5/qtquick/qtquick-particles-affectors-main-cpp.html
  8948. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-blurparticles-qml.html
  8949. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-fragmentshader-qml.html
  8950. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-imagecolors-qml.html
  8951. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-pro.html
  8952. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qml.html
  8953. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qmlproject.html
  8954. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qrc.html
  8955. share/doc/qt5/qtquick/qtquick-particles-customparticle-example.html
  8956. share/doc/qt5/qtquick/qtquick-particles-customparticle-main-cpp.html
  8957. share/doc/qt5/qtquick/qtquick-particles-emitters-content-burstandpulse-qml.html
  8958. share/doc/qt5/qtquick/qtquick-particles-emitters-content-customemitter-qml.html
  8959. share/doc/qt5/qtquick/qtquick-particles-emitters-content-emitmask-qml.html
  8960. share/doc/qt5/qtquick/qtquick-particles-emitters-content-maximumemitted-qml.html
  8961. share/doc/qt5/qtquick/qtquick-particles-emitters-content-shapeanddirection-qml.html
  8962. share/doc/qt5/qtquick/qtquick-particles-emitters-content-trailemitter-qml.html
  8963. share/doc/qt5/qtquick/qtquick-particles-emitters-content-velocityfrommotion-qml.html
  8964. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-pro.html
  8965. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qml.html
  8966. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qmlproject.html
  8967. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qrc.html
  8968. share/doc/qt5/qtquick/qtquick-particles-emitters-example.html
  8969. share/doc/qt5/qtquick/qtquick-particles-emitters-main-cpp.html
  8970. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-allatonce-qml.html
  8971. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-colored-qml.html
  8972. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-colortable-qml.html
  8973. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-deformation-qml.html
  8974. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-rotation-qml.html
  8975. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-sharing-qml.html
  8976. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-sprites-qml.html
  8977. share/doc/qt5/qtquick/qtquick-particles-imageparticle-example.html
  8978. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-pro.html
  8979. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qml.html
  8980. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qmlproject.html
  8981. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qrc.html
  8982. share/doc/qt5/qtquick/qtquick-particles-imageparticle-main-cpp.html
  8983. share/doc/qt5/qtquick/qtquick-particles-performance.html
  8984. share/doc/qt5/qtquick/qtquick-particles-qmlmodule.html
  8985. share/doc/qt5/qtquick/qtquick-particles-system-content-dynamiccomparison-qml.html
  8986. share/doc/qt5/qtquick/qtquick-particles-system-content-dynamicemitters-qml.html
  8987. share/doc/qt5/qtquick/qtquick-particles-system-content-multiplepainters-qml.html
  8988. share/doc/qt5/qtquick/qtquick-particles-system-content-startstop-qml.html
  8989. share/doc/qt5/qtquick/qtquick-particles-system-content-timedgroupchanges-qml.html
  8990. share/doc/qt5/qtquick/qtquick-particles-system-example.html
  8991. share/doc/qt5/qtquick/qtquick-particles-system-main-cpp.html
  8992. share/doc/qt5/qtquick/qtquick-particles-system-system-pro.html
  8993. share/doc/qt5/qtquick/qtquick-particles-system-system-qml.html
  8994. share/doc/qt5/qtquick/qtquick-particles-system-system-qmlproject.html
  8995. share/doc/qt5/qtquick/qtquick-particles-system-system-qrc.html
  8996. share/doc/qt5/qtquick/qtquick-positioners-example.html
  8997. share/doc/qt5/qtquick/qtquick-positioners-main-cpp.html
  8998. share/doc/qt5/qtquick/qtquick-positioners-positioners-attachedproperties-qml.html
  8999. share/doc/qt5/qtquick/qtquick-positioners-positioners-pro.html
  9000. share/doc/qt5/qtquick/qtquick-positioners-positioners-qml.html
  9001. share/doc/qt5/qtquick/qtquick-positioners-positioners-qmlproject.html
  9002. share/doc/qt5/qtquick/qtquick-positioners-positioners-qrc.html
  9003. share/doc/qt5/qtquick/qtquick-positioners-positioners-transitions-qml.html
  9004. share/doc/qt5/qtquick/qtquick-positioning-anchors.html
  9005. share/doc/qt5/qtquick/qtquick-positioning-layouts.html
  9006. share/doc/qt5/qtquick/qtquick-positioning-righttoleft.html
  9007. share/doc/qt5/qtquick/qtquick-positioning-topic.html
  9008. share/doc/qt5/qtquick/qtquick-qmlmodule.html
  9009. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qml.html
  9010. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qmlproject.html
  9011. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qrc.html
  9012. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-button-qml.html
  9013. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-checkbox-qml.html
  9014. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-slider-qml.html
  9015. share/doc/qt5/qtquick/qtquick-quick-accessibility-example.html
  9016. share/doc/qt5/qtquick/qtquick-quick-accessibility-main-cpp.html
  9017. share/doc/qt5/qtquick/qtquick-quick-accessibility-quick-accessibility-pro.html
  9018. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-customgl-qml.html
  9019. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-example.html
  9020. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-fbitem-cpp.html
  9021. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-fbitem-h.html
  9022. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-main-cpp.html
  9023. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-pro.html
  9024. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-qrc.html
  9025. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquare-qml.html
  9026. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquaretab-qml.html
  9027. share/doc/qt5/qtquick/qtquick-rendercontrol-cuberenderer-cpp.html
  9028. share/doc/qt5/qtquick/qtquick-rendercontrol-cuberenderer-h.html
  9029. share/doc/qt5/qtquick/qtquick-rendercontrol-demo-qml.html
  9030. share/doc/qt5/qtquick/qtquick-rendercontrol-example.html
  9031. share/doc/qt5/qtquick/qtquick-rendercontrol-main-cpp.html
  9032. share/doc/qt5/qtquick/qtquick-rendercontrol-rendercontrol-pro.html
  9033. share/doc/qt5/qtquick/qtquick-rendercontrol-rendercontrol-qrc.html
  9034. share/doc/qt5/qtquick/qtquick-rendercontrol-window-multithreaded-cpp.html
  9035. share/doc/qt5/qtquick/qtquick-rendercontrol-window-multithreaded-h.html
  9036. share/doc/qt5/qtquick/qtquick-rendercontrol-window-singlethreaded-cpp.html
  9037. share/doc/qt5/qtquick/qtquick-rendercontrol-window-singlethreaded-h.html
  9038. share/doc/qt5/qtquick/qtquick-righttoleft-example.html
  9039. share/doc/qt5/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qml.html
  9040. share/doc/qt5/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qmlproject.html
  9041. share/doc/qt5/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qml.html
  9042. share/doc/qt5/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qmlproject.html
  9043. share/doc/qt5/qtquick/qtquick-righttoleft-main-cpp.html
  9044. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-pro.html
  9045. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qml.html
  9046. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qmlproject.html
  9047. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qrc.html
  9048. share/doc/qt5/qtquick/qtquick-righttoleft-textalignment-textalignment-qml.html
  9049. share/doc/qt5/qtquick/qtquick-righttoleft-textalignment-textalignment-qmlproject.html
  9050. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-beziercurve-cpp.html
  9051. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-beziercurve-h.html
  9052. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-customgeometry-pro.html
  9053. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-customgeometry-qrc.html
  9054. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-example.html
  9055. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-main-cpp.html
  9056. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-main-qml.html
  9057. share/doc/qt5/qtquick/qtquick-scenegraph-graph-example.html
  9058. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-cpp.html
  9059. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-h.html
  9060. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-pro.html
  9061. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-qrc.html
  9062. share/doc/qt5/qtquick/qtquick-scenegraph-graph-gridnode-cpp.html
  9063. share/doc/qt5/qtquick/qtquick-scenegraph-graph-gridnode-h.html
  9064. share/doc/qt5/qtquick/qtquick-scenegraph-graph-linenode-cpp.html
  9065. share/doc/qt5/qtquick/qtquick-scenegraph-graph-linenode-h.html
  9066. share/doc/qt5/qtquick/qtquick-scenegraph-graph-main-cpp.html
  9067. share/doc/qt5/qtquick/qtquick-scenegraph-graph-main-qml.html
  9068. share/doc/qt5/qtquick/qtquick-scenegraph-graph-noisynode-cpp.html
  9069. share/doc/qt5/qtquick/qtquick-scenegraph-graph-noisynode-h.html
  9070. share/doc/qt5/qtquick/qtquick-scenegraph-materials.html
  9071. share/doc/qt5/qtquick/qtquick-scenegraph-nodes.html
  9072. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-example.html
  9073. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-main-cpp.html
  9074. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-main-qml.html
  9075. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-pro.html
  9076. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-qrc.html
  9077. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-squircle-cpp.html
  9078. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-squircle-h.html
  9079. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-example.html
  9080. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-main-qml.html
  9081. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-cpp.html
  9082. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-pro.html
  9083. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-qrc.html
  9084. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-example.html
  9085. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-cpp.html
  9086. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-h.html
  9087. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-main-cpp.html
  9088. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-main-qml.html
  9089. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-pro.html
  9090. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-qrc.html
  9091. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-error-qml.html
  9092. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-example.html
  9093. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-main-cpp.html
  9094. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-main-qml.html
  9095. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-textureinthread-pro.html
  9096. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-textureinthread-qrc.html
  9097. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-cpp.html
  9098. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-h.html
  9099. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-example.html
  9100. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-main-cpp.html
  9101. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-main-qml.html
  9102. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-pro.html
  9103. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-qrc.html
  9104. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-cpp.html
  9105. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-h.html
  9106. share/doc/qt5/qtquick/qtquick-shadereffects-content-slider-qml.html
  9107. share/doc/qt5/qtquick/qtquick-shadereffects-example.html
  9108. share/doc/qt5/qtquick/qtquick-shadereffects-main-cpp.html
  9109. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-pro.html
  9110. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qml.html
  9111. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qmlproject.html
  9112. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qrc.html
  9113. share/doc/qt5/qtquick/qtquick-statesanimations-animations.html
  9114. share/doc/qt5/qtquick/qtquick-statesanimations-behaviors.html
  9115. share/doc/qt5/qtquick/qtquick-statesanimations-states.html
  9116. share/doc/qt5/qtquick/qtquick-statesanimations-topic.html
  9117. share/doc/qt5/qtquick/qtquick-text-example.html
  9118. share/doc/qt5/qtquick/qtquick-text-fonts-availablefonts-qml.html
  9119. share/doc/qt5/qtquick/qtquick-text-fonts-banner-qml.html
  9120. share/doc/qt5/qtquick/qtquick-text-fonts-fonts-qml.html
  9121. share/doc/qt5/qtquick/qtquick-text-fonts-hello-qml.html
  9122. share/doc/qt5/qtquick/qtquick-text-imgtag-imgtag-qml.html
  9123. share/doc/qt5/qtquick/qtquick-text-imgtag-textwithimage-qml.html
  9124. share/doc/qt5/qtquick/qtquick-text-main-cpp.html
  9125. share/doc/qt5/qtquick/qtquick-text-styledtext-layout-qml.html
  9126. share/doc/qt5/qtquick/qtquick-text-text-pro.html
  9127. share/doc/qt5/qtquick/qtquick-text-text-qml.html
  9128. share/doc/qt5/qtquick/qtquick-text-text-qmlproject.html
  9129. share/doc/qt5/qtquick/qtquick-text-text-qrc.html
  9130. share/doc/qt5/qtquick/qtquick-text-textselection-textselection-qml.html
  9131. share/doc/qt5/qtquick/qtquick-text-validator.html
  9132. share/doc/qt5/qtquick/qtquick-threading-example.html
  9133. share/doc/qt5/qtquick/qtquick-threading-main-cpp.html
  9134. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-dataloader-js.html
  9135. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-example.html
  9136. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-threadedlistmodel-qmlproject.html
  9137. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-timedisplay-qml.html
  9138. share/doc/qt5/qtquick/qtquick-threading-threading-pro.html
  9139. share/doc/qt5/qtquick/qtquick-threading-threading-qml.html
  9140. share/doc/qt5/qtquick/qtquick-threading-threading-qmlproject.html
  9141. share/doc/qt5/qtquick/qtquick-threading-threading-qrc.html
  9142. share/doc/qt5/qtquick/qtquick-threading-workerscript-spinner-qml.html
  9143. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-js.html
  9144. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-qml.html
  9145. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-qmlproject.html
  9146. share/doc/qt5/qtquick/qtquick-touchinteraction-example.html
  9147. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-basic-flickable-qml.html
  9148. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-content-panel-qml.html
  9149. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-corkboards-qml.html
  9150. share/doc/qt5/qtquick/qtquick-touchinteraction-main-cpp.html
  9151. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-bearwhack-qml.html
  9152. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-augmentedtouchpoint-qml.html
  9153. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-bearwhackparticlesystem-qml.html
  9154. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-particleflame-qml.html
  9155. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-multiflame-qml.html
  9156. share/doc/qt5/qtquick/qtquick-touchinteraction-pincharea-flickresize-qml.html
  9157. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-pro.html
  9158. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qml.html
  9159. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qmlproject.html
  9160. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qrc.html
  9161. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview-qml.html
  9162. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview1-qmlproject.html
  9163. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
  9164. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-petsmodel-qml.html
  9165. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview-qml.html
  9166. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview2-qmlproject.html
  9167. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
  9168. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-petsmodel-qml.html
  9169. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview-qml.html
  9170. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview3-qmlproject.html
  9171. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
  9172. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-petsmodel-qml.html
  9173. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview-qml.html
  9174. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview4-qmlproject.html
  9175. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
  9176. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-listselector-qml.html
  9177. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-petsmodel-qml.html
  9178. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-block-qml.html
  9179. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-button-qml.html
  9180. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-example.html
  9181. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-samegame-qml.html
  9182. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-samegame1-qmlproject.html
  9183. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-block-qml.html
  9184. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-button-qml.html
  9185. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-example.html
  9186. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame-js.html
  9187. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame-qml.html
  9188. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame2-qmlproject.html
  9189. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-block-qml.html
  9190. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-button-qml.html
  9191. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-dialog-qml.html
  9192. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-example.html
  9193. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame-js.html
  9194. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame-qml.html
  9195. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame3-qmlproject.html
  9196. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-boomblock-qml.html
  9197. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-button-qml.html
  9198. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-dialog-qml.html
  9199. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-samegame-js.html
  9200. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-example.html
  9201. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-highscores-score-data-xml.html
  9202. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-samegame-qml.html
  9203. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-samegame4-qmlproject.html
  9204. share/doc/qt5/qtquick/qtquick-views-example.html
  9205. share/doc/qt5/qtquick/qtquick-views-gridview-gridview-example-qml.html
  9206. share/doc/qt5/qtquick/qtquick-views-listview-content-petsmodel-qml.html
  9207. share/doc/qt5/qtquick/qtquick-views-listview-content-pressandholdbutton-qml.html
  9208. share/doc/qt5/qtquick/qtquick-views-listview-content-recipesmodel-qml.html
  9209. share/doc/qt5/qtquick/qtquick-views-listview-content-smalltext-qml.html
  9210. share/doc/qt5/qtquick/qtquick-views-listview-content-textbutton-qml.html
  9211. share/doc/qt5/qtquick/qtquick-views-listview-content-togglebutton-qml.html
  9212. share/doc/qt5/qtquick/qtquick-views-listview-displaymargin-qml.html
  9213. share/doc/qt5/qtquick/qtquick-views-listview-dynamiclist-qml.html
  9214. share/doc/qt5/qtquick/qtquick-views-listview-expandingdelegates-qml.html
  9215. share/doc/qt5/qtquick/qtquick-views-listview-highlight-qml.html
  9216. share/doc/qt5/qtquick/qtquick-views-listview-highlightranges-qml.html
  9217. share/doc/qt5/qtquick/qtquick-views-listview-sections-qml.html
  9218. share/doc/qt5/qtquick/qtquick-views-main-cpp.html
  9219. share/doc/qt5/qtquick/qtquick-views-objectmodel-objectmodel-qml.html
  9220. share/doc/qt5/qtquick/qtquick-views-package-delegate-qml.html
  9221. share/doc/qt5/qtquick/qtquick-views-package-view-qml.html
  9222. share/doc/qt5/qtquick/qtquick-views-parallax-content-clock-qml.html
  9223. share/doc/qt5/qtquick/qtquick-views-parallax-content-parallaxview-qml.html
  9224. share/doc/qt5/qtquick/qtquick-views-parallax-content-pics-home-page-svg.html
  9225. share/doc/qt5/qtquick/qtquick-views-parallax-content-quitbutton-qml.html
  9226. share/doc/qt5/qtquick/qtquick-views-parallax-content-smiley-qml.html
  9227. share/doc/qt5/qtquick/qtquick-views-parallax-parallax-qml.html
  9228. share/doc/qt5/qtquick/qtquick-views-pathview-pathview-example-qml.html
  9229. share/doc/qt5/qtquick/qtquick-views-views-pro.html
  9230. share/doc/qt5/qtquick/qtquick-views-views-qml.html
  9231. share/doc/qt5/qtquick/qtquick-views-views-qmlproject.html
  9232. share/doc/qt5/qtquick/qtquick-views-views-qrc.html
  9233. share/doc/qt5/qtquick/qtquick-views-visualdatamodel-dragselection-qml.html
  9234. share/doc/qt5/qtquick/qtquick-views-visualdatamodel-slideshow-qml.html
  9235. share/doc/qt5/qtquick/qtquick-views-visualdatamodel-visualdatamodel-qmlproject.html
  9236. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-d3d12.html
  9237. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-openvg.html
  9238. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-software.html
  9239. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations.html
  9240. share/doc/qt5/qtquick/qtquick-visualcanvas-coordinates.html
  9241. share/doc/qt5/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
  9242. share/doc/qt5/qtquick/qtquick-visualcanvas-scenegraph.html
  9243. share/doc/qt5/qtquick/qtquick-visualcanvas-topic.html
  9244. share/doc/qt5/qtquick/qtquick-visualcanvas-visualparent.html
  9245. share/doc/qt5/qtquick/qtquick-visualtypes-topic.html
  9246. share/doc/qt5/qtquick/qtquick-window-allscreens-qml.html
  9247. share/doc/qt5/qtquick/qtquick-window-currentscreen-qml.html
  9248. share/doc/qt5/qtquick/qtquick-window-example.html
  9249. share/doc/qt5/qtquick/qtquick-window-main-cpp.html
  9250. share/doc/qt5/qtquick/qtquick-window-qmlmodule.html
  9251. share/doc/qt5/qtquick/qtquick-window-resources-icon-svg.html
  9252. share/doc/qt5/qtquick/qtquick-window-splash-qml.html
  9253. share/doc/qt5/qtquick/qtquick-window-window-pro.html
  9254. share/doc/qt5/qtquick/qtquick-window-window-qml.html
  9255. share/doc/qt5/qtquick/qtquick-window-window-qrc.html
  9256. share/doc/qt5/qtquick/qtquick-xmllistmodel-qmlmodule.html
  9257. share/doc/qt5/qtquick/qtquick.index
  9258. share/doc/qt5/qtquick/qtquick.qhp
  9259. share/doc/qt5/qtquick/qtquick.qhp.sha1
  9260. share/doc/qt5/qtquick/qtquick.tags
  9261. share/doc/qt5/qtquick/qtquicklayouts-index.html
  9262. share/doc/qt5/qtquick/qtquicklayouts-overview.html
  9263. share/doc/qt5/qtquick/qtquickwidgets-module.html
  9264. share/doc/qt5/qtquick/qttest-qmlmodule.html
  9265. share/doc/qt5/qtquick/style/offline-simple.css
  9266. share/doc/qt5/qtquick/style/offline.css
  9267. share/doc/qt5/qtquickcontrols.qch
  9268. share/doc/qt5/qtquickcontrols/applicationwindow.html
  9269. share/doc/qt5/qtquickcontrols/controls.html
  9270. share/doc/qt5/qtquickcontrols/controlsstyling.html
  9271. share/doc/qt5/qtquickcontrols/examples-manifest.xml
  9272. share/doc/qt5/qtquickcontrols/images/applicationwindow.png
  9273. share/doc/qt5/qtquickcontrols/images/arrow_bc.png
  9274. share/doc/qt5/qtquickcontrols/images/bgrContent.png
  9275. share/doc/qt5/qtquickcontrols/images/btn_next.png
  9276. share/doc/qt5/qtquickcontrols/images/btn_prev.png
  9277. share/doc/qt5/qtquickcontrols/images/bullet_dn.png
  9278. share/doc/qt5/qtquickcontrols/images/bullet_sq.png
  9279. share/doc/qt5/qtquickcontrols/images/busyindicator.png
  9280. share/doc/qt5/qtquickcontrols/images/button.png
  9281. share/doc/qt5/qtquickcontrols/images/calendar.png
  9282. share/doc/qt5/qtquickcontrols/images/calendarstyle-components-week-numbers.png
  9283. share/doc/qt5/qtquickcontrols/images/checkbox.png
  9284. share/doc/qt5/qtquickcontrols/images/circulargauge-angles.png
  9285. share/doc/qt5/qtquickcontrols/images/circulargauge-needle-example-2.png
  9286. share/doc/qt5/qtquickcontrols/images/circulargauge-needle.png
  9287. share/doc/qt5/qtquickcontrols/images/circulargauge-reversed.png
  9288. share/doc/qt5/qtquickcontrols/images/circulargauge-tickmark-indices-values.png
  9289. share/doc/qt5/qtquickcontrols/images/combobox.png
  9290. share/doc/qt5/qtquickcontrols/images/gauge-minorTickmark-example.png
  9291. share/doc/qt5/qtquickcontrols/images/gauge-temperature.png
  9292. share/doc/qt5/qtquickcontrols/images/gauge-tickmark-example.png
  9293. share/doc/qt5/qtquickcontrols/images/groupbox.png
  9294. share/doc/qt5/qtquickcontrols/images/home.png
  9295. share/doc/qt5/qtquickcontrols/images/ico_note.png
  9296. share/doc/qt5/qtquickcontrols/images/ico_note_attention.png
  9297. share/doc/qt5/qtquickcontrols/images/ico_out.png
  9298. share/doc/qt5/qtquickcontrols/images/label.png
  9299. share/doc/qt5/qtquickcontrols/images/logo.png
  9300. share/doc/qt5/qtquickcontrols/images/menu.png
  9301. share/doc/qt5/qtquickcontrols/images/menubar-action.png
  9302. share/doc/qt5/qtquickcontrols/images/menubar.png
  9303. share/doc/qt5/qtquickcontrols/images/piemenu-menuitem-example.png
  9304. share/doc/qt5/qtquickcontrols/images/progressbar.png
  9305. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-calendar.png
  9306. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-filesystembrowser.png
  9307. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-gallery-android-dark.png
  9308. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-gallery-android.png
  9309. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-gallery-osx.png
  9310. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-styles.png
  9311. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-tableview.png
  9312. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-text.png
  9313. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-touch.png
  9314. share/doc/qt5/qtquickcontrols/images/qtquickcontrols-example-uiforms.png
  9315. share/doc/qt5/qtquickcontrols/images/radiobutton.png
  9316. share/doc/qt5/qtquickcontrols/images/scrollview.png
  9317. share/doc/qt5/qtquickcontrols/images/slider.png
  9318. share/doc/qt5/qtquickcontrols/images/spinbox.png
  9319. share/doc/qt5/qtquickcontrols/images/splitview.png
  9320. share/doc/qt5/qtquickcontrols/images/square-blue.png
  9321. share/doc/qt5/qtquickcontrols/images/square-green.png
  9322. share/doc/qt5/qtquickcontrols/images/square-red.png
  9323. share/doc/qt5/qtquickcontrols/images/square-white.png
  9324. share/doc/qt5/qtquickcontrols/images/square-yellow.png
  9325. share/doc/qt5/qtquickcontrols/images/stackview.png
  9326. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-background-example.png
  9327. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-knob-example.png
  9328. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-minorTickmark-example.png
  9329. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-needle-example.png
  9330. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-tickmark-example.png
  9331. share/doc/qt5/qtquickcontrols/images/styling-circulargauge-tickmarkLabel-example.png
  9332. share/doc/qt5/qtquickcontrols/images/styling-gauge-font-size.png
  9333. share/doc/qt5/qtquickcontrols/images/styling-gauge-foreground.png
  9334. share/doc/qt5/qtquickcontrols/images/styling-gauge-minorTickmark.png
  9335. share/doc/qt5/qtquickcontrols/images/styling-gauge-tickmark.png
  9336. share/doc/qt5/qtquickcontrols/images/styling-gauge-valueBar.png
  9337. share/doc/qt5/qtquickcontrols/images/switch.png
  9338. share/doc/qt5/qtquickcontrols/images/tableview.png
  9339. share/doc/qt5/qtquickcontrols/images/tabview.png
  9340. share/doc/qt5/qtquickcontrols/images/textarea.png
  9341. share/doc/qt5/qtquickcontrols/images/textfield.png
  9342. share/doc/qt5/qtquickcontrols/images/toolbar.png
  9343. share/doc/qt5/qtquickcontrols/images/treeview.png
  9344. share/doc/qt5/qtquickcontrols/images/tumbler-flat-style.png
  9345. share/doc/qt5/qtquickcontrols/images/tumbler.png
  9346. share/doc/qt5/qtquickcontrols/images/used-in-examples/calendar/images/eventindicator.png
  9347. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/bubble.png
  9348. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/button-pressed.png
  9349. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/button.png
  9350. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/progress-background.png
  9351. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/progress-fill.png
  9352. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/slider-handle.png
  9353. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/tab.png
  9354. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/tab_selected.png
  9355. share/doc/qt5/qtquickcontrols/images/used-in-examples/styles/images/textfield.png
  9356. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/button_default.png
  9357. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/button_pressed.png
  9358. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/navigation_next_item.png
  9359. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/navigation_previous_item.png
  9360. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/tab_selected.png
  9361. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/tabs_standard.png
  9362. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/textinput.png
  9363. share/doc/qt5/qtquickcontrols/images/used-in-examples/touch/images/toolbar.png
  9364. share/doc/qt5/qtquickcontrols/menus.html
  9365. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-action-members.html
  9366. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-action.html
  9367. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-applicationwindow-members.html
  9368. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-applicationwindow.html
  9369. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-busyindicator-members.html
  9370. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-busyindicator.html
  9371. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-button-members.html
  9372. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-button.html
  9373. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-calendar-members.html
  9374. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-calendar.html
  9375. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-checkbox-members.html
  9376. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-checkbox.html
  9377. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-combobox-members.html
  9378. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-combobox.html
  9379. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-exclusivegroup-members.html
  9380. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-exclusivegroup.html
  9381. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-groupbox-members.html
  9382. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-groupbox.html
  9383. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-label-members.html
  9384. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-label.html
  9385. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menu-members.html
  9386. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menu.html
  9387. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menubar-members.html
  9388. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menubar.html
  9389. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuitem-members.html
  9390. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuitem.html
  9391. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuseparator-members.html
  9392. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-menuseparator.html
  9393. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-progressbar-members.html
  9394. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-progressbar.html
  9395. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-radiobutton-members.html
  9396. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-radiobutton.html
  9397. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-scrollview-members.html
  9398. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-scrollview.html
  9399. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-slider-members.html
  9400. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-slider.html
  9401. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-spinbox-members.html
  9402. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-spinbox.html
  9403. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-splitview-members.html
  9404. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-splitview.html
  9405. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stack-members.html
  9406. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stack.html
  9407. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackview-members.html
  9408. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackview.html
  9409. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackviewdelegate-members.html
  9410. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-stackviewdelegate.html
  9411. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-statusbar-members.html
  9412. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-statusbar.html
  9413. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-applicationwindowstyle-members.html
  9414. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-applicationwindowstyle.html
  9415. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-busyindicatorstyle-members.html
  9416. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-busyindicatorstyle.html
  9417. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-buttonstyle-members.html
  9418. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-buttonstyle.html
  9419. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-calendarstyle-members.html
  9420. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-calendarstyle.html
  9421. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-checkboxstyle-members.html
  9422. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-checkboxstyle.html
  9423. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-circulargaugestyle-members.html
  9424. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-circulargaugestyle.html
  9425. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-comboboxstyle-members.html
  9426. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-comboboxstyle.html
  9427. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-delaybuttonstyle-members.html
  9428. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-delaybuttonstyle.html
  9429. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-dialstyle-members.html
  9430. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-dialstyle.html
  9431. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-gaugestyle-members.html
  9432. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-gaugestyle.html
  9433. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menubarstyle-members.html
  9434. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menubarstyle.html
  9435. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menustyle-members.html
  9436. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-menustyle.html
  9437. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-piemenustyle-members.html
  9438. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-piemenustyle.html
  9439. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-progressbarstyle-members.html
  9440. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-progressbarstyle.html
  9441. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-radiobuttonstyle-members.html
  9442. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-radiobuttonstyle.html
  9443. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-scrollviewstyle-members.html
  9444. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-scrollviewstyle.html
  9445. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-sliderstyle-members.html
  9446. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-sliderstyle.html
  9447. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-spinboxstyle-members.html
  9448. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-spinboxstyle.html
  9449. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusbarstyle-members.html
  9450. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusbarstyle.html
  9451. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusindicatorstyle-members.html
  9452. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-statusindicatorstyle.html
  9453. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-switchstyle-members.html
  9454. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-switchstyle.html
  9455. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tableviewstyle-members.html
  9456. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tableviewstyle.html
  9457. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tabviewstyle-members.html
  9458. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tabviewstyle.html
  9459. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textareastyle-members.html
  9460. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textareastyle.html
  9461. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textfieldstyle-members.html
  9462. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-textfieldstyle.html
  9463. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-togglebuttonstyle-members.html
  9464. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-togglebuttonstyle.html
  9465. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-toolbarstyle-members.html
  9466. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-toolbarstyle.html
  9467. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-treeviewstyle-members.html
  9468. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-treeviewstyle.html
  9469. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle-members.html
  9470. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle-obsolete.html
  9471. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle.html
  9472. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-switch-members.html
  9473. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-switch.html
  9474. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tab-members.html
  9475. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tab.html
  9476. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableview-members.html
  9477. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableview.html
  9478. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableviewcolumn-members.html
  9479. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tableviewcolumn.html
  9480. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tabview-members.html
  9481. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-tabview.html
  9482. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textarea-members.html
  9483. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textarea.html
  9484. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textfield-members.html
  9485. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-textfield.html
  9486. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbar-members.html
  9487. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbar.html
  9488. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbutton-members.html
  9489. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-toolbutton.html
  9490. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-treeview-members.html
  9491. share/doc/qt5/qtquickcontrols/qml-qtquick-controls-treeview.html
  9492. share/doc/qt5/qtquickcontrols/qtquick-controls-qmlmodule.html
  9493. share/doc/qt5/qtquickcontrols/qtquick-controls-styles-qmlmodule.html
  9494. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-calendar-pro.html
  9495. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-example.html
  9496. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-qml-main-qml.html
  9497. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-resources-qrc.html
  9498. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-event-cpp.html
  9499. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-event-h.html
  9500. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-main-cpp.html
  9501. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-sqleventmodel-cpp.html
  9502. share/doc/qt5/qtquickcontrols/qtquickcontrols-calendar-src-sqleventmodel-h.html
  9503. share/doc/qt5/qtquickcontrols/qtquickcontrols-examples.html
  9504. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-example.html
  9505. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-filesystembrowser-pro.html
  9506. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-main-cpp.html
  9507. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-main-qml.html
  9508. share/doc/qt5/qtquickcontrols/qtquickcontrols-filesystembrowser-qml-qrc.html
  9509. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-example.html
  9510. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-pro.html
  9511. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-qrc.html
  9512. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-main-cpp.html
  9513. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-main-qml.html
  9514. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-android-ui-js.html
  9515. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-buttonpage-qml.html
  9516. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-inputpage-qml.html
  9517. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-ios-ui-js.html
  9518. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-osx-ui-js.html
  9519. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-progresspage-qml.html
  9520. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qml-ui-js.html
  9521. share/doc/qt5/qtquickcontrols/qtquickcontrols-index.html
  9522. share/doc/qt5/qtquickcontrols/qtquickcontrols-overview.html
  9523. share/doc/qt5/qtquickcontrols/qtquickcontrols-platformnotes.html
  9524. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-example.html
  9525. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-main-cpp.html
  9526. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-main-qml.html
  9527. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-styles-pro.html
  9528. share/doc/qt5/qtquickcontrols/qtquickcontrols-styles-styles-qrc.html
  9529. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-example.html
  9530. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-main-qml.html
  9531. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-src-main-cpp.html
  9532. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-src-sortfilterproxymodel-cpp.html
  9533. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-src-sortfilterproxymodel-h.html
  9534. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-tableview-pro.html
  9535. share/doc/qt5/qtquickcontrols/qtquickcontrols-tableview-tableview-qrc.html
  9536. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-example.html
  9537. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qml-main-qml.html
  9538. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qml-toolbarseparator-qml.html
  9539. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-resources-qrc.html
  9540. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-src-documenthandler-cpp.html
  9541. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-src-documenthandler-h.html
  9542. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-src-main-cpp.html
  9543. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-texteditor-pro.html
  9544. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-androiddelegate-qml.html
  9545. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-buttonpage-qml.html
  9546. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-listpage-qml.html
  9547. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-progressbarpage-qml.html
  9548. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-sliderpage-qml.html
  9549. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-tabbarpage-qml.html
  9550. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-content-textinputpage-qml.html
  9551. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-example.html
  9552. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-main-qml.html
  9553. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-resources-qrc.html
  9554. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-src-main-cpp.html
  9555. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-touch-pro.html
  9556. share/doc/qt5/qtquickcontrols/qtquickcontrols-touch-touch-qmlproject.html
  9557. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-example.html
  9558. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-main-cpp.html
  9559. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-main-qml.html
  9560. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-mainform-ui-qml.html
  9561. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-customermodel-qml.html
  9562. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-history-qml.html
  9563. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-historyform-ui-qml.html
  9564. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-notes-qml.html
  9565. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-notesform-ui-qml.html
  9566. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-settings-qml.html
  9567. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-qml-settingsform-ui-qml.html
  9568. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-uiforms-pro.html
  9569. share/doc/qt5/qtquickcontrols/qtquickcontrols-uiforms-uiforms-qrc.html
  9570. share/doc/qt5/qtquickcontrols/qtquickcontrols.index
  9571. share/doc/qt5/qtquickcontrols/qtquickcontrols.qhp
  9572. share/doc/qt5/qtquickcontrols/qtquickcontrols.qhp.sha1
  9573. share/doc/qt5/qtquickcontrols/qtquickcontrols.tags
  9574. share/doc/qt5/qtquickcontrols/qtquickcontrolsstyles-index.html
  9575. share/doc/qt5/qtquickcontrols/style/offline-simple.css
  9576. share/doc/qt5/qtquickcontrols/style/offline.css
  9577. share/doc/qt5/qtquickcontrols/styling-circulargauge.html
  9578. share/doc/qt5/qtquickcontrols/styling-gauge.html
  9579. share/doc/qt5/qtquickcontrols/stylingtutorials.html
  9580. share/doc/qt5/qtquickcontrols/views.html
  9581. share/doc/qt5/qtquickcontrols/viewsstyling.html
  9582. share/doc/qt5/qtquickcontrols2.qch
  9583. share/doc/qt5/qtquickcontrols2/examples-manifest.xml
  9584. share/doc/qt5/qtquickcontrols2/images/arrow_bc.png
  9585. share/doc/qt5/qtquickcontrols2/images/bgrContent.png
  9586. share/doc/qt5/qtquickcontrols2/images/btn_next.png
  9587. share/doc/qt5/qtquickcontrols2/images/btn_prev.png
  9588. share/doc/qt5/qtquickcontrols2/images/bullet_dn.png
  9589. share/doc/qt5/qtquickcontrols2/images/bullet_sq.png
  9590. share/doc/qt5/qtquickcontrols2/images/home.png
  9591. share/doc/qt5/qtquickcontrols2/images/ico_note.png
  9592. share/doc/qt5/qtquickcontrols2/images/ico_note_attention.png
  9593. share/doc/qt5/qtquickcontrols2/images/ico_out.png
  9594. share/doc/qt5/qtquickcontrols2/images/logo.png
  9595. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-applicationwindow-wireframe.png
  9596. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-busyindicator-custom.png
  9597. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-busyindicator.gif
  9598. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-busyindicator.png
  9599. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-custom.png
  9600. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-flat.gif
  9601. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button-highlighted.gif
  9602. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-button.gif
  9603. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter1.png
  9604. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter2-listview-header.gif
  9605. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter2.png
  9606. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter3-listview-header.gif
  9607. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter3-view-margins.png
  9608. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter3.gif
  9609. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter4-long-message.png
  9610. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter4-message-timestamp.png
  9611. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter4.gif
  9612. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-dark.png
  9613. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-test.png
  9614. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-material.png
  9615. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal-dark.png
  9616. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal.png
  9617. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-dark.png
  9618. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-test.png
  9619. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-material.png
  9620. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal-dark.png
  9621. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal.png
  9622. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkbox-custom.png
  9623. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkbox-tristate.gif
  9624. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkbox.gif
  9625. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkdelegate-custom.png
  9626. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkdelegate-tristate.gif
  9627. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-checkdelegate.gif
  9628. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-combobox-custom.png
  9629. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-combobox.gif
  9630. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-contactlist.png
  9631. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-control.png
  9632. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-customize-buttons.png
  9633. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-default-thumbnail.png
  9634. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-default.png
  9635. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-delaybutton-custom.png
  9636. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-delaybutton.gif
  9637. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial-custom.png
  9638. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial-no-wrap.gif
  9639. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial-wrap.gif
  9640. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dial.png
  9641. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-dialogbuttonbox.png
  9642. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-drawer-expanded-wireframe.png
  9643. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-drawer.gif
  9644. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-flatstyle-creator.png
  9645. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-flatstyle.png
  9646. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-frame-custom.png
  9647. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-frame.png
  9648. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-gallery-drawer.png
  9649. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-gallery-menu.png
  9650. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-gallery-welcome.png
  9651. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-groupbox-checkable.png
  9652. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-groupbox-custom.png
  9653. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-groupbox.png
  9654. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-itemdelegate-custom.png
  9655. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-itemdelegate.gif
  9656. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-label-custom.png
  9657. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-label.png
  9658. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-accent.png
  9659. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-attributes.png
  9660. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-background.png
  9661. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-dark.png
  9662. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-elevation.png
  9663. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-foreground.png
  9664. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-light.png
  9665. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-purple.png
  9666. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-theme.png
  9667. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-material-thumbnail.png
  9668. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menu.png
  9669. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-menuseparator.png
  9670. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-page-wireframe.png
  9671. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pageindicator-custom.png
  9672. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pageindicator.png
  9673. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pane-custom.png
  9674. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-pane.png
  9675. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup-custom.png
  9676. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup-settings.png
  9677. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup-transformorigin.png
  9678. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-popup.png
  9679. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-progressbar-custom.png
  9680. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-progressbar-indeterminate.gif
  9681. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-progressbar.gif
  9682. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiobutton-custom.png
  9683. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiobutton.gif
  9684. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiodelegate-custom.png
  9685. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-radiodelegate.gif
  9686. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-rangeslider-custom.png
  9687. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-rangeslider.gif
  9688. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-roundbutton.png
  9689. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-custom.png
  9690. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-non-attached.png
  9691. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-nosnap.gif
  9692. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-snapalways.gif
  9693. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar-snaponrelease.gif
  9694. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollbar.gif
  9695. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollindicator-custom.png
  9696. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollindicator-non-attached.png
  9697. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollindicator.gif
  9698. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollview-custom.png
  9699. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollview-wireframe.png
  9700. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-scrollview.png
  9701. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-sidepanel-landscape.png
  9702. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-sidepanel-portrait.png
  9703. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-custom.png
  9704. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-nosnap.gif
  9705. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-snapalways.gif
  9706. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider-snaponrelease.gif
  9707. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-slider.gif
  9708. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox-custom.png
  9709. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox-double.png
  9710. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox-textual.png
  9711. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-spinbox.png
  9712. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-pop.gif
  9713. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-push.gif
  9714. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-replace.gif
  9715. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-unwind.gif
  9716. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-visible.png
  9717. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-stackview-wireframe.png
  9718. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-styles.png
  9719. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-behind.gif
  9720. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-custom.png
  9721. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-leading-trailing.gif
  9722. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipedelegate.gif
  9723. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipetoremove.png
  9724. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipeview-wireframe.png
  9725. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-swipeview.gif
  9726. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switch-custom.png
  9727. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switch.gif
  9728. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switch.png
  9729. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switchdelegate-custom.png
  9730. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-switchdelegate.gif
  9731. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-custom.png
  9732. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-explicit.png
  9733. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-flickable.png
  9734. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbar-wireframe.png
  9735. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tabbutton.png
  9736. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textarea-custom.png
  9737. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textarea-scrollable.png
  9738. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textarea.png
  9739. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-texteditor-desktop.jpg
  9740. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-texteditor-touch.jpg
  9741. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-custom.png
  9742. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-disabled.png
  9743. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-focused.png
  9744. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield-normal.png
  9745. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-textfield.png
  9746. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbar-custom.png
  9747. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbar.png
  9748. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbutton-custom.png
  9749. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolbutton.png
  9750. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolseparator-custom.png
  9751. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-toolseparator.png
  9752. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tooltip-slider.png
  9753. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tooltip.png
  9754. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tumbler-custom.png
  9755. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tumbler-wrap.gif
  9756. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-tumbler.png
  9757. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-accent.png
  9758. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-attributes.png
  9759. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-background.png
  9760. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-dark.png
  9761. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-foreground.png
  9762. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-light.png
  9763. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-theme.png
  9764. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-thumbnail.png
  9765. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-universal-violet.png
  9766. share/doc/qt5/qtquickcontrols2/images/qtquickcontrols2-wearable.png
  9767. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow.png
  9768. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@2x.png
  9769. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@3x.png
  9770. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@4x.png
  9771. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows.png
  9772. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@2x.png
  9773. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@3x.png
  9774. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@4x.png
  9775. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo.png
  9776. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@2x.png
  9777. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@3x.png
  9778. share/doc/qt5/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@4x.png
  9779. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo.png
  9780. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo@2x.png
  9781. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo@3x.png
  9782. share/doc/qt5/qtquickcontrols2/images/used-in-examples/sidepanel/images/qt-logo@4x.png
  9783. share/doc/qt5/qtquickcontrols2/images/used-in-examples/texteditor/images/qt-logo.png
  9784. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back.png
  9785. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back@2x.png
  9786. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back@3x.png
  9787. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/back@4x.png
  9788. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/background.png
  9789. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home.png
  9790. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home@2x.png
  9791. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home@3x.png
  9792. share/doc/qt5/qtquickcontrols2/images/used-in-examples/wearable/images/home@4x.png
  9793. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-abstractbutton-members.html
  9794. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-abstractbutton.html
  9795. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-applicationwindow-members.html
  9796. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-applicationwindow.html
  9797. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-busyindicator-members.html
  9798. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-busyindicator.html
  9799. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-button-members.html
  9800. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-button.html
  9801. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-buttongroup-members.html
  9802. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-buttongroup.html
  9803. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkbox-members.html
  9804. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkbox.html
  9805. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkdelegate-members.html
  9806. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-checkdelegate.html
  9807. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-combobox-members.html
  9808. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-combobox.html
  9809. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-container-members.html
  9810. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-container.html
  9811. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-control-members.html
  9812. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-control.html
  9813. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-delaybutton-members.html
  9814. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-delaybutton.html
  9815. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dial-members.html
  9816. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dial.html
  9817. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialog-members.html
  9818. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialog.html
  9819. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialogbuttonbox-members.html
  9820. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-dialogbuttonbox.html
  9821. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-drawer-members.html
  9822. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-drawer.html
  9823. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-frame-members.html
  9824. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-frame.html
  9825. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-groupbox-members.html
  9826. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-groupbox.html
  9827. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-itemdelegate-members.html
  9828. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-itemdelegate.html
  9829. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-label-members.html
  9830. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-label.html
  9831. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menu-members.html
  9832. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menu.html
  9833. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuitem-members.html
  9834. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuitem.html
  9835. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuseparator-members.html
  9836. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-menuseparator.html
  9837. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-page-members.html
  9838. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-page.html
  9839. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pageindicator-members.html
  9840. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pageindicator.html
  9841. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pane-members.html
  9842. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-pane.html
  9843. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-popup-members.html
  9844. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-popup.html
  9845. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-progressbar-members.html
  9846. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-progressbar.html
  9847. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiobutton-members.html
  9848. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiobutton.html
  9849. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiodelegate-members.html
  9850. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-radiodelegate.html
  9851. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-rangeslider-members.html
  9852. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-rangeslider.html
  9853. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-roundbutton-members.html
  9854. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-roundbutton.html
  9855. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollbar-members.html
  9856. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollbar.html
  9857. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollindicator-members.html
  9858. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollindicator.html
  9859. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollview-members.html
  9860. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-scrollview.html
  9861. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-slider-members.html
  9862. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-slider.html
  9863. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-spinbox-members.html
  9864. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-spinbox.html
  9865. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-stackview-members.html
  9866. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-stackview.html
  9867. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipedelegate-members.html
  9868. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipedelegate.html
  9869. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipeview-members.html
  9870. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-swipeview.html
  9871. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switch-members.html
  9872. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switch.html
  9873. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switchdelegate-members.html
  9874. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-switchdelegate.html
  9875. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbar-members.html
  9876. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbar.html
  9877. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbutton-members.html
  9878. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tabbutton.html
  9879. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textarea-members.html
  9880. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textarea.html
  9881. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textfield-members.html
  9882. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-textfield.html
  9883. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbar-members.html
  9884. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbar.html
  9885. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbutton-members.html
  9886. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolbutton.html
  9887. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolseparator-members.html
  9888. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-toolseparator.html
  9889. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tooltip-members.html
  9890. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tooltip.html
  9891. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tumbler-members.html
  9892. share/doc/qt5/qtquickcontrols2/qml-qtquick-controls2-tumbler.html
  9893. share/doc/qt5/qtquickcontrols2/qquickstyle-members.html
  9894. share/doc/qt5/qtquickcontrols2/qquickstyle.html
  9895. share/doc/qt5/qtquickcontrols2/qtquick-controls2-qmlmodule.html
  9896. share/doc/qt5/qtquickcontrols2/qtquick-templates2-qmlmodule.html
  9897. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-buttons.html
  9898. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-chapter1-settingup-pro.html
  9899. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-main-cpp.html
  9900. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-main-qml.html
  9901. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-qml-qrc.html
  9902. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-chapter2-lists-pro.html
  9903. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-main-qml.html
  9904. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-qml-qrc.html
  9905. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-chapter3-navigation-pro.html
  9906. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-contactpage-qml.html
  9907. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-conversationpage-qml.html
  9908. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-main-qml.html
  9909. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-qml-qrc.html
  9910. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-chapter4-models-pro.html
  9911. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-contactpage-qml.html
  9912. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-conversationpage-qml.html
  9913. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-main-qml.html
  9914. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-qml-qrc.html
  9915. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-cpp.html
  9916. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-h.html
  9917. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-cpp.html
  9918. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-h.html
  9919. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-chapter5-styling-pro.html
  9920. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-chattoolbar-qml.html
  9921. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-contactpage-qml.html
  9922. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-conversationpage-qml.html
  9923. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-main-qml.html
  9924. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-material-chattoolbar-qml.html
  9925. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-qml-qrc.html
  9926. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-cpp.html
  9927. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-h.html
  9928. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-cpp.html
  9929. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-h.html
  9930. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-chattutorial-pro.html
  9931. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-example.html
  9932. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-chattutorial-shared-shared-qrc.html
  9933. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-configuration.html
  9934. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactdelegate-ui-qml.html
  9935. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactdialog-qml.html
  9936. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactform-ui-qml.html
  9937. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactlist-pro.html
  9938. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactlist-qml.html
  9939. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactmodel-cpp.html
  9940. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactmodel-h.html
  9941. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-contactview-ui-qml.html
  9942. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-designer-backend-contactmodel-qml.html
  9943. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-designer-backend-qmldir.html
  9944. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-example.html
  9945. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-main-cpp.html
  9946. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-contactlist-sectiondelegate-ui-qml.html
  9947. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-containers.html
  9948. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-customize.html
  9949. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-default.html
  9950. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-delegates.html
  9951. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-deployment.html
  9952. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-differences.html
  9953. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-environment.html
  9954. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-examples.html
  9955. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-fileselectors.html
  9956. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-example.html
  9957. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flat-button-qml.html
  9958. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flat-checkbox-qml.html
  9959. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flat-switch-qml.html
  9960. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flatstyle-pro.html
  9961. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-flatstyle-qml.html
  9962. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-imports-theme-qmldir.html
  9963. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-imports-theme-theme-qml.html
  9964. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-main-cpp.html
  9965. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-flatstyle-mainform-ui-qml.html
  9966. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-example.html
  9967. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-gallery-cpp.html
  9968. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-gallery-pro.html
  9969. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-gallery-qml.html
  9970. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-busyindicatorpage-qml.html
  9971. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-buttonpage-qml.html
  9972. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-checkboxpage-qml.html
  9973. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-comboboxpage-qml.html
  9974. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-delaybuttonpage-qml.html
  9975. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-delegatepage-qml.html
  9976. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-dialogpage-qml.html
  9977. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-dialpage-qml.html
  9978. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-framepage-qml.html
  9979. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-groupboxpage-qml.html
  9980. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-pageindicatorpage-qml.html
  9981. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-progressbarpage-qml.html
  9982. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-radiobuttonpage-qml.html
  9983. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-rangesliderpage-qml.html
  9984. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollablepage-qml.html
  9985. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollbarpage-qml.html
  9986. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollindicatorpage-qml.html
  9987. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-sliderpage-qml.html
  9988. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-spinboxpage-qml.html
  9989. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-stackviewpage-qml.html
  9990. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-swipeviewpage-qml.html
  9991. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-switchpage-qml.html
  9992. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-tabbarpage-qml.html
  9993. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-textareapage-qml.html
  9994. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-textfieldpage-qml.html
  9995. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-tooltippage-qml.html
  9996. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gallery-pages-tumblerpage-qml.html
  9997. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-gettingstarted.html
  9998. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-guidelines.html
  9999. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-highdpi.html
  10000. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-index.html
  10001. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-indicators.html
  10002. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-input.html
  10003. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-material.html
  10004. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-menus.html
  10005. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-module.html
  10006. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-navigation.html
  10007. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-popups.html
  10008. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-separators.html
  10009. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-example.html
  10010. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-sidepanel-cpp.html
  10011. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-sidepanel-pro.html
  10012. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-sidepanel-sidepanel-qml.html
  10013. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-styles.html
  10014. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-example.html
  10015. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-swipetoremove-cpp.html
  10016. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-swipetoremove-pro.html
  10017. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-swipetoremove-swipetoremove-qml.html
  10018. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-documenthandler-cpp.html
  10019. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-documenthandler-h.html
  10020. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-example.html
  10021. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-qml-texteditor-qml.html
  10022. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-qml-touch-texteditor-qml.html
  10023. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-texteditor-cpp.html
  10024. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-texteditor-pro.html
  10025. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-texteditor-texteditor-qrc.html
  10026. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-universal.html
  10027. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-example.html
  10028. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-alarms-alarmspage-qml.html
  10029. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-fitness-fitness-js.html
  10030. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-fitness-fitnesspage-qml.html
  10031. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-launcherpage-qml.html
  10032. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navibutton-qml.html
  10033. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navigation-navigation-js.html
  10034. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navigation-navigationpage-qml.html
  10035. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-navigation-routeelement-qml.html
  10036. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-notifications-notifications-js.html
  10037. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-notifications-notificationspage-qml.html
  10038. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-settings-settingspage-qml.html
  10039. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-pageindicator-qml.html
  10040. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-qmldir.html
  10041. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-slider-qml.html
  10042. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-switch-qml.html
  10043. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-style-uistyle-qml.html
  10044. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-weather-weather-js.html
  10045. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-weather-weatherpage-qml.html
  10046. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-worldclock-clock-qml.html
  10047. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-qml-worldclock-worldclockpage-qml.html
  10048. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-cpp.html
  10049. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-pro.html
  10050. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-qml.html
  10051. share/doc/qt5/qtquickcontrols2/qtquickcontrols2-wearable-wearable-qrc.html
  10052. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.index
  10053. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.qhp
  10054. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.qhp.sha1
  10055. share/doc/qt5/qtquickcontrols2/qtquickcontrols2.tags
  10056. share/doc/qt5/qtquickcontrols2/qtquicktemplates2-index.html
  10057. share/doc/qt5/qtquickcontrols2/style/offline-simple.css
  10058. share/doc/qt5/qtquickcontrols2/style/offline.css
  10059. share/doc/qt5/qtquickdialogs.qch
  10060. share/doc/qt5/qtquickdialogs/examples-manifest.xml
  10061. share/doc/qt5/qtquickdialogs/images/arrow_bc.png
  10062. share/doc/qt5/qtquickdialogs/images/bgrContent.png
  10063. share/doc/qt5/qtquickdialogs/images/btn_next.png
  10064. share/doc/qt5/qtquickdialogs/images/btn_prev.png
  10065. share/doc/qt5/qtquickdialogs/images/bullet_dn.png
  10066. share/doc/qt5/qtquickdialogs/images/bullet_sq.png
  10067. share/doc/qt5/qtquickdialogs/images/critical.png
  10068. share/doc/qt5/qtquickdialogs/images/home.png
  10069. share/doc/qt5/qtquickdialogs/images/ico_note.png
  10070. share/doc/qt5/qtquickdialogs/images/ico_note_attention.png
  10071. share/doc/qt5/qtquickdialogs/images/ico_out.png
  10072. share/doc/qt5/qtquickdialogs/images/information.png
  10073. share/doc/qt5/qtquickdialogs/images/logo.png
  10074. share/doc/qt5/qtquickdialogs/images/question.png
  10075. share/doc/qt5/qtquickdialogs/images/replacefile.png
  10076. share/doc/qt5/qtquickdialogs/images/systemdialogs-example.jpg
  10077. share/doc/qt5/qtquickdialogs/images/warning.png
  10078. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-colordialog-members.html
  10079. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-colordialog.html
  10080. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-dialog-members.html
  10081. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-dialog.html
  10082. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-filedialog-members.html
  10083. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-filedialog.html
  10084. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-fontdialog-members.html
  10085. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-fontdialog.html
  10086. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-messagedialog-members.html
  10087. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-messagedialog.html
  10088. share/doc/qt5/qtquickdialogs/qtquick-dialogs-qmlmodule.html
  10089. share/doc/qt5/qtquickdialogs/qtquickdialog-examples.html
  10090. share/doc/qt5/qtquickdialogs/qtquickdialogs-index.html
  10091. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-colordialogs-qml.html
  10092. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-customdialogs-qml.html
  10093. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-example.html
  10094. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-filedialogs-qml.html
  10095. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-fontdialogs-qml.html
  10096. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-main-cpp.html
  10097. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-messagedialogs-qml.html
  10098. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-pro.html
  10099. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qml.html
  10100. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qrc.html
  10101. share/doc/qt5/qtquickdialogs/qtquickdialogs.index
  10102. share/doc/qt5/qtquickdialogs/qtquickdialogs.qhp
  10103. share/doc/qt5/qtquickdialogs/qtquickdialogs.qhp.sha1
  10104. share/doc/qt5/qtquickdialogs/style/offline-simple.css
  10105. share/doc/qt5/qtquickdialogs/style/offline.css
  10106. share/doc/qt5/qtquickextras.qch
  10107. share/doc/qt5/qtquickextras/examples-manifest.xml
  10108. share/doc/qt5/qtquickextras/images/arrow_bc.png
  10109. share/doc/qt5/qtquickextras/images/bgrContent.png
  10110. share/doc/qt5/qtquickextras/images/btn_next.png
  10111. share/doc/qt5/qtquickextras/images/btn_prev.png
  10112. share/doc/qt5/qtquickextras/images/bullet_dn.png
  10113. share/doc/qt5/qtquickextras/images/bullet_sq.png
  10114. share/doc/qt5/qtquickextras/images/circulargauge.png
  10115. share/doc/qt5/qtquickextras/images/delaybutton-activated.png
  10116. share/doc/qt5/qtquickextras/images/delaybutton-progress.png
  10117. share/doc/qt5/qtquickextras/images/delaybutton.png
  10118. share/doc/qt5/qtquickextras/images/dial.png
  10119. share/doc/qt5/qtquickextras/images/gauge.png
  10120. share/doc/qt5/qtquickextras/images/home.png
  10121. share/doc/qt5/qtquickextras/images/ico_note.png
  10122. share/doc/qt5/qtquickextras/images/ico_note_attention.png
  10123. share/doc/qt5/qtquickextras/images/ico_out.png
  10124. share/doc/qt5/qtquickextras/images/logo.png
  10125. share/doc/qt5/qtquickextras/images/piemenu-boundingItem-example.png
  10126. share/doc/qt5/qtquickextras/images/piemenu-boundingItem-null-example.png
  10127. share/doc/qt5/qtquickextras/images/piemenu.png
  10128. share/doc/qt5/qtquickextras/images/qtquickextras-example-dashboard.png
  10129. share/doc/qt5/qtquickextras/images/qtquickextras-example-flat.png
  10130. share/doc/qt5/qtquickextras/images/qtquickextras-example-gallery.png
  10131. share/doc/qt5/qtquickextras/images/statusindicator-active.png
  10132. share/doc/qt5/qtquickextras/images/statusindicator-green.png
  10133. share/doc/qt5/qtquickextras/images/statusindicator-inactive.png
  10134. share/doc/qt5/qtquickextras/images/togglebutton-checked.png
  10135. share/doc/qt5/qtquickextras/images/togglebutton-unchecked.png
  10136. share/doc/qt5/qtquickextras/images/tumbler.png
  10137. share/doc/qt5/qtquickextras/images/used-in-examples/dashboard/images/fuel-icon.png
  10138. share/doc/qt5/qtquickextras/images/used-in-examples/dashboard/images/temperature-icon.png
  10139. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-normal.png
  10140. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-pressed.png
  10141. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-bw.jpg
  10142. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-rgb.jpg
  10143. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-sepia.jpg
  10144. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-normal.png
  10145. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-pressed.png
  10146. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-normal.png
  10147. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-pressed.png
  10148. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/background-light.png
  10149. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/background.png
  10150. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/center-light.png
  10151. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/center.png
  10152. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-back.png
  10153. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-go.png
  10154. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-settings.png
  10155. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/info.png
  10156. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/needle-light.png
  10157. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/needle.png
  10158. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/qt-logo.png
  10159. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/zoom_in.png
  10160. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/zoom_out.png
  10161. share/doc/qt5/qtquickextras/qml-qtquick-extras-circulargauge-members.html
  10162. share/doc/qt5/qtquickextras/qml-qtquick-extras-circulargauge.html
  10163. share/doc/qt5/qtquickextras/qml-qtquick-extras-delaybutton-members.html
  10164. share/doc/qt5/qtquickextras/qml-qtquick-extras-delaybutton.html
  10165. share/doc/qt5/qtquickextras/qml-qtquick-extras-dial-members.html
  10166. share/doc/qt5/qtquickextras/qml-qtquick-extras-dial.html
  10167. share/doc/qt5/qtquickextras/qml-qtquick-extras-gauge-members.html
  10168. share/doc/qt5/qtquickextras/qml-qtquick-extras-gauge.html
  10169. share/doc/qt5/qtquickextras/qml-qtquick-extras-picture-members.html
  10170. share/doc/qt5/qtquickextras/qml-qtquick-extras-picture.html
  10171. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu-members.html
  10172. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu-obsolete.html
  10173. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu.html
  10174. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator-members.html
  10175. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator-obsolete.html
  10176. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator.html
  10177. share/doc/qt5/qtquickextras/qml-qtquick-extras-togglebutton-members.html
  10178. share/doc/qt5/qtquickextras/qml-qtquick-extras-togglebutton.html
  10179. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumbler-members.html
  10180. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumbler.html
  10181. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumblercolumn-members.html
  10182. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumblercolumn.html
  10183. share/doc/qt5/qtquickextras/qtquick-extras-qmlmodule.html
  10184. share/doc/qt5/qtquickextras/qtquickextras-dashboard-dashboard-pro.html
  10185. share/doc/qt5/qtquickextras/qtquickextras-dashboard-dashboard-qrc.html
  10186. share/doc/qt5/qtquickextras/qtquickextras-dashboard-example.html
  10187. share/doc/qt5/qtquickextras/qtquickextras-dashboard-main-cpp.html
  10188. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-dashboard-qml.html
  10189. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-dashboardgaugestyle-qml.html
  10190. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-icongaugestyle-qml.html
  10191. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-tachometerstyle-qml.html
  10192. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-turnindicator-qml.html
  10193. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-valuesource-qml.html
  10194. share/doc/qt5/qtquickextras/qtquickextras-examples.html
  10195. share/doc/qt5/qtquickextras/qtquickextras-flat-content-qml.html
  10196. share/doc/qt5/qtquickextras/qtquickextras-flat-example.html
  10197. share/doc/qt5/qtquickextras/qtquickextras-flat-flat-pro.html
  10198. share/doc/qt5/qtquickextras/qtquickextras-flat-flat-qrc.html
  10199. share/doc/qt5/qtquickextras/qtquickextras-flat-main-cpp.html
  10200. share/doc/qt5/qtquickextras/qtquickextras-flat-main-qml.html
  10201. share/doc/qt5/qtquickextras/qtquickextras-flat-settingsicon-qml.html
  10202. share/doc/qt5/qtquickextras/qtquickextras-gallery-example.html
  10203. share/doc/qt5/qtquickextras/qtquickextras-gallery-gallery-pro.html
  10204. share/doc/qt5/qtquickextras/qtquickextras-gallery-gallery-qrc.html
  10205. share/doc/qt5/qtquickextras/qtquickextras-gallery-main-cpp.html
  10206. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-blackbuttonbackground-qml.html
  10207. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-blackbuttonstyle-qml.html
  10208. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugedarkstyle-qml.html
  10209. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugedefaultstyle-qml.html
  10210. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugelightstyle-qml.html
  10211. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugeview-qml.html
  10212. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controllabel-qml.html
  10213. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controlview-qml.html
  10214. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controlviewtoolbar-qml.html
  10215. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerlabel-qml.html
  10216. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerslider-qml.html
  10217. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerswitch-qml.html
  10218. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-flickablemoreindicator-qml.html
  10219. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-gallery-qml.html
  10220. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenucontrolview-qml.html
  10221. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenudarkstyle-qml.html
  10222. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenudefaultstyle-qml.html
  10223. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-stylepicker-qml.html
  10224. share/doc/qt5/qtquickextras/qtquickextras-index.html
  10225. share/doc/qt5/qtquickextras/qtquickextras-overview.html
  10226. share/doc/qt5/qtquickextras/qtquickextras.index
  10227. share/doc/qt5/qtquickextras/qtquickextras.qhp
  10228. share/doc/qt5/qtquickextras/qtquickextras.qhp.sha1
  10229. share/doc/qt5/qtquickextras/style/offline-simple.css
  10230. share/doc/qt5/qtquickextras/style/offline.css
  10231. share/doc/qt5/qtscxml.qch
  10232. share/doc/qt5/qtscxml/examples-manifest.xml
  10233. share/doc/qt5/qtscxml/examples-qtscxml.html
  10234. share/doc/qt5/qtscxml/images/arrow_bc.png
  10235. share/doc/qt5/qtscxml/images/bgrContent.png
  10236. share/doc/qt5/qtscxml/images/btn_next.png
  10237. share/doc/qt5/qtscxml/images/btn_prev.png
  10238. share/doc/qt5/qtscxml/images/bullet_dn.png
  10239. share/doc/qt5/qtscxml/images/bullet_sq.png
  10240. share/doc/qt5/qtscxml/images/calculator-qml.png
  10241. share/doc/qt5/qtscxml/images/calculator.png
  10242. share/doc/qt5/qtscxml/images/ftpclient-statechart.png
  10243. share/doc/qt5/qtscxml/images/home.png
  10244. share/doc/qt5/qtscxml/images/ico_note.png
  10245. share/doc/qt5/qtscxml/images/ico_note_attention.png
  10246. share/doc/qt5/qtscxml/images/ico_out.png
  10247. share/doc/qt5/qtscxml/images/invoke-dynamic.png
  10248. share/doc/qt5/qtscxml/images/invoke-static.png
  10249. share/doc/qt5/qtscxml/images/logo.png
  10250. share/doc/qt5/qtscxml/images/mediaplayer.png
  10251. share/doc/qt5/qtscxml/images/pinball-statechart-global.png
  10252. share/doc/qt5/qtscxml/images/pinball-statechart-guicontrol.png
  10253. share/doc/qt5/qtscxml/images/pinball-statechart-internalstate.png
  10254. share/doc/qt5/qtscxml/images/pinball-statechart-logicalstate.png
  10255. share/doc/qt5/qtscxml/images/pinball-statechart-modestate.png
  10256. share/doc/qt5/qtscxml/images/pinball-statechart-onstate.png
  10257. share/doc/qt5/qtscxml/images/pinball-statechart-workflow.png
  10258. share/doc/qt5/qtscxml/images/pinball.png
  10259. share/doc/qt5/qtscxml/images/sudoku.png
  10260. share/doc/qt5/qtscxml/images/trafficlight.png
  10261. share/doc/qt5/qtscxml/qml-mediaplayer-qml-dynamic-members.html
  10262. share/doc/qt5/qtscxml/qml-mediaplayer-qml-dynamic.html
  10263. share/doc/qt5/qtscxml/qml-qtscxml-eventconnection-members.html
  10264. share/doc/qt5/qtscxml/qml-qtscxml-eventconnection.html
  10265. share/doc/qt5/qtscxml/qml-qtscxml-invokedservices-members.html
  10266. share/doc/qt5/qtscxml/qml-qtscxml-invokedservices.html
  10267. share/doc/qt5/qtscxml/qml-qtscxml-scxmlstatemachine-members.html
  10268. share/doc/qt5/qtscxml/qml-qtscxml-scxmlstatemachine.html
  10269. share/doc/qt5/qtscxml/qml-qtscxml-statemachineloader-members.html
  10270. share/doc/qt5/qtscxml/qml-qtscxml-statemachineloader.html
  10271. share/doc/qt5/qtscxml/qscxmlc.html
  10272. share/doc/qt5/qtscxml/qscxmlcompiler-loader-members.html
  10273. share/doc/qt5/qtscxml/qscxmlcompiler-loader.html
  10274. share/doc/qt5/qtscxml/qscxmlcompiler-members.html
  10275. share/doc/qt5/qtscxml/qscxmlcompiler.html
  10276. share/doc/qt5/qtscxml/qscxmlcppdatamodel-members.html
  10277. share/doc/qt5/qtscxml/qscxmlcppdatamodel.html
  10278. share/doc/qt5/qtscxml/qscxmldatamodel-foreachloopbody-members.html
  10279. share/doc/qt5/qtscxml/qscxmldatamodel-foreachloopbody.html
  10280. share/doc/qt5/qtscxml/qscxmldatamodel-members.html
  10281. share/doc/qt5/qtscxml/qscxmldatamodel.html
  10282. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory-members.html
  10283. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory.html
  10284. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel-members.html
  10285. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel.html
  10286. share/doc/qt5/qtscxml/qscxmlerror-members.html
  10287. share/doc/qt5/qtscxml/qscxmlerror.html
  10288. share/doc/qt5/qtscxml/qscxmlevent-members.html
  10289. share/doc/qt5/qtscxml/qscxmlevent.html
  10290. share/doc/qt5/qtscxml/qscxmlexecutablecontent-assignmentinfo-members.html
  10291. share/doc/qt5/qtscxml/qscxmlexecutablecontent-assignmentinfo.html
  10292. share/doc/qt5/qtscxml/qscxmlexecutablecontent-evaluatorinfo-members.html
  10293. share/doc/qt5/qtscxml/qscxmlexecutablecontent-evaluatorinfo.html
  10294. share/doc/qt5/qtscxml/qscxmlexecutablecontent-foreachinfo-members.html
  10295. share/doc/qt5/qtscxml/qscxmlexecutablecontent-foreachinfo.html
  10296. share/doc/qt5/qtscxml/qscxmlexecutablecontent-invokeinfo-members.html
  10297. share/doc/qt5/qtscxml/qscxmlexecutablecontent-invokeinfo.html
  10298. share/doc/qt5/qtscxml/qscxmlexecutablecontent-parameterinfo-members.html
  10299. share/doc/qt5/qtscxml/qscxmlexecutablecontent-parameterinfo.html
  10300. share/doc/qt5/qtscxml/qscxmlexecutablecontent.html
  10301. share/doc/qt5/qtscxml/qscxmlinvokableservice-members.html
  10302. share/doc/qt5/qtscxml/qscxmlinvokableservice.html
  10303. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory-members.html
  10304. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory.html
  10305. share/doc/qt5/qtscxml/qscxmlnulldatamodel-members.html
  10306. share/doc/qt5/qtscxml/qscxmlnulldatamodel.html
  10307. share/doc/qt5/qtscxml/qscxmlstatemachine-members.html
  10308. share/doc/qt5/qtscxml/qscxmlstatemachine.html
  10309. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory-members.html
  10310. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory.html
  10311. share/doc/qt5/qtscxml/qscxmltabledata-members.html
  10312. share/doc/qt5/qtscxml/qscxmltabledata.html
  10313. share/doc/qt5/qtscxml/qtscxml-calculator-qml-button-qml.html
  10314. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-cpp.html
  10315. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-pro.html
  10316. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-qml.html
  10317. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-qrc.html
  10318. share/doc/qt5/qtscxml/qtscxml-calculator-qml-example.html
  10319. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-calculator-widgets-cpp.html
  10320. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-calculator-widgets-pro.html
  10321. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-example.html
  10322. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-cpp.html
  10323. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-h.html
  10324. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-ui.html
  10325. share/doc/qt5/qtscxml/qtscxml-ftpclient-example.html
  10326. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpclient-pro.html
  10327. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpcontrolchannel-cpp.html
  10328. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpcontrolchannel-h.html
  10329. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpdatachannel-cpp.html
  10330. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpdatachannel-h.html
  10331. share/doc/qt5/qtscxml/qtscxml-ftpclient-main-cpp.html
  10332. share/doc/qt5/qtscxml/qtscxml-ftpclient-simpleftp-scxml.html
  10333. share/doc/qt5/qtscxml/qtscxml-index.html
  10334. share/doc/qt5/qtscxml/qtscxml-instantiating-state-machines.html
  10335. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-example.html
  10336. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-cpp.html
  10337. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-pro.html
  10338. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qml.html
  10339. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qrc.html
  10340. share/doc/qt5/qtscxml/qtscxml-invoke-static-example.html
  10341. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-cpp.html
  10342. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-pro.html
  10343. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-qml.html
  10344. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-qrc.html
  10345. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-example.html
  10346. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-cppdatamodel-scxml.html
  10347. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-cpp.html
  10348. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-pro.html
  10349. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qml.html
  10350. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qrc.html
  10351. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-cpp.html
  10352. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-h.html
  10353. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-example.html
  10354. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-cpp.html
  10355. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-pro.html
  10356. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qml.html
  10357. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qrc.html
  10358. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-example.html
  10359. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-cpp.html
  10360. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-pro.html
  10361. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qml.html
  10362. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qrc.html
  10363. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-example.html
  10364. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-qrc.html
  10365. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-cpp.html
  10366. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-pro.html
  10367. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-example.html
  10368. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-cpp.html
  10369. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-pro.html
  10370. share/doc/qt5/qtscxml/qtscxml-module.html
  10371. share/doc/qt5/qtscxml/qtscxml-overview.html
  10372. share/doc/qt5/qtscxml/qtscxml-pinball-example.html
  10373. share/doc/qt5/qtscxml/qtscxml-pinball-main-cpp.html
  10374. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-cpp.html
  10375. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-h.html
  10376. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-ui.html
  10377. share/doc/qt5/qtscxml/qtscxml-pinball-pinball-pro.html
  10378. share/doc/qt5/qtscxml/qtscxml-pinball-pinball-scxml.html
  10379. share/doc/qt5/qtscxml/qtscxml-qmlmodule.html
  10380. share/doc/qt5/qtscxml/qtscxml-scxml-compliance.html
  10381. share/doc/qt5/qtscxml/qtscxml-sudoku-example.html
  10382. share/doc/qt5/qtscxml/qtscxml-sudoku-main-cpp.html
  10383. share/doc/qt5/qtscxml/qtscxml-sudoku-mainwindow-cpp.html
  10384. share/doc/qt5/qtscxml/qtscxml-sudoku-mainwindow-h.html
  10385. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-js.html
  10386. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-pro.html
  10387. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-qrc.html
  10388. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-scxml.html
  10389. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-example.html
  10390. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-cpp.html
  10391. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-pro.html
  10392. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qml.html
  10393. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qrc.html
  10394. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-example.html
  10395. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-light-qml.html
  10396. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-cpp.html
  10397. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-pro.html
  10398. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-qrc.html
  10399. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml.html
  10400. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-example.html
  10401. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-cpp.html
  10402. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-pro.html
  10403. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qml.html
  10404. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qrc.html
  10405. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-example.html
  10406. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-cpp.html
  10407. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-pro.html
  10408. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-qrc.html
  10409. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-example.html
  10410. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-cpp.html
  10411. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-pro.html
  10412. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-qrc.html
  10413. share/doc/qt5/qtscxml/qtscxml.index
  10414. share/doc/qt5/qtscxml/qtscxml.qhp
  10415. share/doc/qt5/qtscxml/qtscxml.qhp.sha1
  10416. share/doc/qt5/qtscxml/qtscxml.tags
  10417. share/doc/qt5/qtscxml/style/offline-simple.css
  10418. share/doc/qt5/qtscxml/style/offline.css
  10419. share/doc/qt5/qtsensors.qch
  10420. share/doc/qt5/qtsensors/compatmap.html
  10421. share/doc/qt5/qtsensors/creating-a-sensor-plugin.html
  10422. share/doc/qt5/qtsensors/determining-the-default-sensor-for-a-type.html
  10423. share/doc/qt5/qtsensors/dynamic-sensor-backend-registration.html
  10424. share/doc/qt5/qtsensors/examples-manifest.xml
  10425. share/doc/qt5/qtsensors/genericbackend.html
  10426. share/doc/qt5/qtsensors/images/accelbubble.png
  10427. share/doc/qt5/qtsensors/images/arrow_bc.png
  10428. share/doc/qt5/qtsensors/images/bgrContent.png
  10429. share/doc/qt5/qtsensors/images/btn_next.png
  10430. share/doc/qt5/qtsensors/images/btn_prev.png
  10431. share/doc/qt5/qtsensors/images/bullet_dn.png
  10432. share/doc/qt5/qtsensors/images/bullet_sq.png
  10433. share/doc/qt5/qtsensors/images/home.png
  10434. share/doc/qt5/qtsensors/images/ico_note.png
  10435. share/doc/qt5/qtsensors/images/ico_note_attention.png
  10436. share/doc/qt5/qtsensors/images/ico_out.png
  10437. share/doc/qt5/qtsensors/images/logo.png
  10438. share/doc/qt5/qtsensors/images/maze.png
  10439. share/doc/qt5/qtsensors/images/qmlqtsensors.png
  10440. share/doc/qt5/qtsensors/images/qtsensors-examples-explorer.png
  10441. share/doc/qt5/qtsensors/images/qtsensors-examples-grue.png
  10442. share/doc/qt5/qtsensors/images/sensorgesture-cover.png
  10443. share/doc/qt5/qtsensors/images/sensorgesture-doubletap.png
  10444. share/doc/qt5/qtsensors/images/sensorgesture-facedown.png
  10445. share/doc/qt5/qtsensors/images/sensorgesture-faceup.png
  10446. share/doc/qt5/qtsensors/images/sensorgesture-hover.png
  10447. share/doc/qt5/qtsensors/images/sensorgesture-shake.png
  10448. share/doc/qt5/qtsensors/images/sensorgesture-slam_1.png
  10449. share/doc/qt5/qtsensors/images/sensorgesture-slam_2.png
  10450. share/doc/qt5/qtsensors/images/sensorgesture-twist.png
  10451. share/doc/qt5/qtsensors/images/sensorgesture-whip.png
  10452. share/doc/qt5/qtsensors/images/sensorgesturecpp.png
  10453. share/doc/qt5/qtsensors/images/sensors-coordinates.jpg
  10454. share/doc/qt5/qtsensors/images/sensors-coordinates2.jpg
  10455. share/doc/qt5/qtsensors/images/sensors-coordinates3.jpg
  10456. share/doc/qt5/qtsensors/images/sensors-dynamic.png
  10457. share/doc/qt5/qtsensors/images/sensors-geo-vs-raw-magnetism.jpg
  10458. share/doc/qt5/qtsensors/images/sensors-orientation.jpg
  10459. share/doc/qt5/qtsensors/images/sensors-overview.png
  10460. share/doc/qt5/qtsensors/images/sensors-rotation-anim.gif
  10461. share/doc/qt5/qtsensors/images/sensors-rotation.jpg
  10462. share/doc/qt5/qtsensors/images/sensors-rotation2.jpg
  10463. share/doc/qt5/qtsensors/images/sensors-rotation3.jpg
  10464. share/doc/qt5/qtsensors/images/sensors-sides.jpg
  10465. share/doc/qt5/qtsensors/images/sensors-sides2.jpg
  10466. share/doc/qt5/qtsensors/images/sensors-static.png
  10467. share/doc/qt5/qtsensors/images/shakeit.png
  10468. share/doc/qt5/qtsensors/qaccelerometer-members.html
  10469. share/doc/qt5/qtsensors/qaccelerometer.html
  10470. share/doc/qt5/qtsensors/qaccelerometerfilter-members.html
  10471. share/doc/qt5/qtsensors/qaccelerometerfilter.html
  10472. share/doc/qt5/qtsensors/qaccelerometerreading-members.html
  10473. share/doc/qt5/qtsensors/qaccelerometerreading.html
  10474. share/doc/qt5/qtsensors/qaltimeter-members.html
  10475. share/doc/qt5/qtsensors/qaltimeter.html
  10476. share/doc/qt5/qtsensors/qaltimeterfilter-members.html
  10477. share/doc/qt5/qtsensors/qaltimeterfilter.html
  10478. share/doc/qt5/qtsensors/qaltimeterreading-members.html
  10479. share/doc/qt5/qtsensors/qaltimeterreading.html
  10480. share/doc/qt5/qtsensors/qambientlightfilter-members.html
  10481. share/doc/qt5/qtsensors/qambientlightfilter.html
  10482. share/doc/qt5/qtsensors/qambientlightreading-members.html
  10483. share/doc/qt5/qtsensors/qambientlightreading.html
  10484. share/doc/qt5/qtsensors/qambientlightsensor-members.html
  10485. share/doc/qt5/qtsensors/qambientlightsensor.html
  10486. share/doc/qt5/qtsensors/qambienttemperaturefilter-members.html
  10487. share/doc/qt5/qtsensors/qambienttemperaturefilter.html
  10488. share/doc/qt5/qtsensors/qambienttemperaturereading-members.html
  10489. share/doc/qt5/qtsensors/qambienttemperaturereading.html
  10490. share/doc/qt5/qtsensors/qambienttemperaturesensor-members.html
  10491. share/doc/qt5/qtsensors/qambienttemperaturesensor.html
  10492. share/doc/qt5/qtsensors/qcompass-members.html
  10493. share/doc/qt5/qtsensors/qcompass.html
  10494. share/doc/qt5/qtsensors/qcompassfilter-members.html
  10495. share/doc/qt5/qtsensors/qcompassfilter.html
  10496. share/doc/qt5/qtsensors/qcompassreading-members.html
  10497. share/doc/qt5/qtsensors/qcompassreading.html
  10498. share/doc/qt5/qtsensors/qdistancefilter-members.html
  10499. share/doc/qt5/qtsensors/qdistancefilter.html
  10500. share/doc/qt5/qtsensors/qdistancereading-members.html
  10501. share/doc/qt5/qtsensors/qdistancereading.html
  10502. share/doc/qt5/qtsensors/qdistancesensor-members.html
  10503. share/doc/qt5/qtsensors/qdistancesensor.html
  10504. share/doc/qt5/qtsensors/qgyroscope-members.html
  10505. share/doc/qt5/qtsensors/qgyroscope.html
  10506. share/doc/qt5/qtsensors/qgyroscopefilter-members.html
  10507. share/doc/qt5/qtsensors/qgyroscopefilter.html
  10508. share/doc/qt5/qtsensors/qgyroscopereading-members.html
  10509. share/doc/qt5/qtsensors/qgyroscopereading.html
  10510. share/doc/qt5/qtsensors/qholsterfilter-members.html
  10511. share/doc/qt5/qtsensors/qholsterfilter.html
  10512. share/doc/qt5/qtsensors/qholsterreading-members.html
  10513. share/doc/qt5/qtsensors/qholsterreading.html
  10514. share/doc/qt5/qtsensors/qholstersensor-members.html
  10515. share/doc/qt5/qtsensors/qholstersensor.html
  10516. share/doc/qt5/qtsensors/qhumidityfilter-members.html
  10517. share/doc/qt5/qtsensors/qhumidityfilter.html
  10518. share/doc/qt5/qtsensors/qhumidityreading-members.html
  10519. share/doc/qt5/qtsensors/qhumidityreading.html
  10520. share/doc/qt5/qtsensors/qhumiditysensor-members.html
  10521. share/doc/qt5/qtsensors/qhumiditysensor.html
  10522. share/doc/qt5/qtsensors/qirproximityfilter-members.html
  10523. share/doc/qt5/qtsensors/qirproximityfilter.html
  10524. share/doc/qt5/qtsensors/qirproximityreading-members.html
  10525. share/doc/qt5/qtsensors/qirproximityreading.html
  10526. share/doc/qt5/qtsensors/qirproximitysensor-members.html
  10527. share/doc/qt5/qtsensors/qirproximitysensor.html
  10528. share/doc/qt5/qtsensors/qlidfilter-members.html
  10529. share/doc/qt5/qtsensors/qlidfilter.html
  10530. share/doc/qt5/qtsensors/qlidreading-members.html
  10531. share/doc/qt5/qtsensors/qlidreading.html
  10532. share/doc/qt5/qtsensors/qlidsensor-members.html
  10533. share/doc/qt5/qtsensors/qlidsensor.html
  10534. share/doc/qt5/qtsensors/qlightfilter-members.html
  10535. share/doc/qt5/qtsensors/qlightfilter.html
  10536. share/doc/qt5/qtsensors/qlightreading-members.html
  10537. share/doc/qt5/qtsensors/qlightreading.html
  10538. share/doc/qt5/qtsensors/qlightsensor-members.html
  10539. share/doc/qt5/qtsensors/qlightsensor.html
  10540. share/doc/qt5/qtsensors/qmagnetometer-members.html
  10541. share/doc/qt5/qtsensors/qmagnetometer.html
  10542. share/doc/qt5/qtsensors/qmagnetometerfilter-members.html
  10543. share/doc/qt5/qtsensors/qmagnetometerfilter.html
  10544. share/doc/qt5/qtsensors/qmagnetometerreading-members.html
  10545. share/doc/qt5/qtsensors/qmagnetometerreading.html
  10546. share/doc/qt5/qtsensors/qml-qtsensors-accelerometer-members.html
  10547. share/doc/qt5/qtsensors/qml-qtsensors-accelerometer.html
  10548. share/doc/qt5/qtsensors/qml-qtsensors-accelerometerreading-members.html
  10549. share/doc/qt5/qtsensors/qml-qtsensors-accelerometerreading.html
  10550. share/doc/qt5/qtsensors/qml-qtsensors-altimeter-members.html
  10551. share/doc/qt5/qtsensors/qml-qtsensors-altimeter.html
  10552. share/doc/qt5/qtsensors/qml-qtsensors-altimeterreading-members.html
  10553. share/doc/qt5/qtsensors/qml-qtsensors-altimeterreading.html
  10554. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightreading-members.html
  10555. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightreading.html
  10556. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightsensor-members.html
  10557. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightsensor.html
  10558. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturereading-members.html
  10559. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturereading.html
  10560. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturesensor-members.html
  10561. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturesensor.html
  10562. share/doc/qt5/qtsensors/qml-qtsensors-compass-members.html
  10563. share/doc/qt5/qtsensors/qml-qtsensors-compass.html
  10564. share/doc/qt5/qtsensors/qml-qtsensors-compassreading-members.html
  10565. share/doc/qt5/qtsensors/qml-qtsensors-compassreading.html
  10566. share/doc/qt5/qtsensors/qml-qtsensors-distancereading-members.html
  10567. share/doc/qt5/qtsensors/qml-qtsensors-distancereading.html
  10568. share/doc/qt5/qtsensors/qml-qtsensors-distancesensor-members.html
  10569. share/doc/qt5/qtsensors/qml-qtsensors-distancesensor.html
  10570. share/doc/qt5/qtsensors/qml-qtsensors-gyroscope-members.html
  10571. share/doc/qt5/qtsensors/qml-qtsensors-gyroscope.html
  10572. share/doc/qt5/qtsensors/qml-qtsensors-gyroscopereading-members.html
  10573. share/doc/qt5/qtsensors/qml-qtsensors-gyroscopereading.html
  10574. share/doc/qt5/qtsensors/qml-qtsensors-holsterreading-members.html
  10575. share/doc/qt5/qtsensors/qml-qtsensors-holsterreading.html
  10576. share/doc/qt5/qtsensors/qml-qtsensors-holstersensor-members.html
  10577. share/doc/qt5/qtsensors/qml-qtsensors-holstersensor.html
  10578. share/doc/qt5/qtsensors/qml-qtsensors-humidityreading-members.html
  10579. share/doc/qt5/qtsensors/qml-qtsensors-humidityreading.html
  10580. share/doc/qt5/qtsensors/qml-qtsensors-humiditysensor-members.html
  10581. share/doc/qt5/qtsensors/qml-qtsensors-humiditysensor.html
  10582. share/doc/qt5/qtsensors/qml-qtsensors-irproximityreading-members.html
  10583. share/doc/qt5/qtsensors/qml-qtsensors-irproximityreading.html
  10584. share/doc/qt5/qtsensors/qml-qtsensors-irproximitysensor-members.html
  10585. share/doc/qt5/qtsensors/qml-qtsensors-irproximitysensor.html
  10586. share/doc/qt5/qtsensors/qml-qtsensors-lidreading-members.html
  10587. share/doc/qt5/qtsensors/qml-qtsensors-lidreading.html
  10588. share/doc/qt5/qtsensors/qml-qtsensors-lidsensor-members.html
  10589. share/doc/qt5/qtsensors/qml-qtsensors-lidsensor.html
  10590. share/doc/qt5/qtsensors/qml-qtsensors-lightreading-members.html
  10591. share/doc/qt5/qtsensors/qml-qtsensors-lightreading.html
  10592. share/doc/qt5/qtsensors/qml-qtsensors-lightsensor-members.html
  10593. share/doc/qt5/qtsensors/qml-qtsensors-lightsensor.html
  10594. share/doc/qt5/qtsensors/qml-qtsensors-magnetometer-members.html
  10595. share/doc/qt5/qtsensors/qml-qtsensors-magnetometer.html
  10596. share/doc/qt5/qtsensors/qml-qtsensors-magnetometerreading-members.html
  10597. share/doc/qt5/qtsensors/qml-qtsensors-magnetometerreading.html
  10598. share/doc/qt5/qtsensors/qml-qtsensors-orientationreading-members.html
  10599. share/doc/qt5/qtsensors/qml-qtsensors-orientationreading.html
  10600. share/doc/qt5/qtsensors/qml-qtsensors-orientationsensor-members.html
  10601. share/doc/qt5/qtsensors/qml-qtsensors-orientationsensor.html
  10602. share/doc/qt5/qtsensors/qml-qtsensors-pressurereading-members.html
  10603. share/doc/qt5/qtsensors/qml-qtsensors-pressurereading.html
  10604. share/doc/qt5/qtsensors/qml-qtsensors-pressuresensor-members.html
  10605. share/doc/qt5/qtsensors/qml-qtsensors-pressuresensor.html
  10606. share/doc/qt5/qtsensors/qml-qtsensors-proximityreading-members.html
  10607. share/doc/qt5/qtsensors/qml-qtsensors-proximityreading.html
  10608. share/doc/qt5/qtsensors/qml-qtsensors-proximitysensor-members.html
  10609. share/doc/qt5/qtsensors/qml-qtsensors-proximitysensor.html
  10610. share/doc/qt5/qtsensors/qml-qtsensors-rotationreading-members.html
  10611. share/doc/qt5/qtsensors/qml-qtsensors-rotationreading.html
  10612. share/doc/qt5/qtsensors/qml-qtsensors-rotationsensor-members.html
  10613. share/doc/qt5/qtsensors/qml-qtsensors-rotationsensor.html
  10614. share/doc/qt5/qtsensors/qml-qtsensors-sensor-members.html
  10615. share/doc/qt5/qtsensors/qml-qtsensors-sensor.html
  10616. share/doc/qt5/qtsensors/qml-qtsensors-sensorgesture-members.html
  10617. share/doc/qt5/qtsensors/qml-qtsensors-sensorgesture.html
  10618. share/doc/qt5/qtsensors/qml-qtsensors-sensorglobal-members.html
  10619. share/doc/qt5/qtsensors/qml-qtsensors-sensorglobal.html
  10620. share/doc/qt5/qtsensors/qml-qtsensors-sensorreading-members.html
  10621. share/doc/qt5/qtsensors/qml-qtsensors-sensorreading.html
  10622. share/doc/qt5/qtsensors/qml-qtsensors-tapreading-members.html
  10623. share/doc/qt5/qtsensors/qml-qtsensors-tapreading.html
  10624. share/doc/qt5/qtsensors/qml-qtsensors-tapsensor-members.html
  10625. share/doc/qt5/qtsensors/qml-qtsensors-tapsensor.html
  10626. share/doc/qt5/qtsensors/qml-qtsensors-tiltreading-members.html
  10627. share/doc/qt5/qtsensors/qml-qtsensors-tiltreading.html
  10628. share/doc/qt5/qtsensors/qml-qtsensors-tiltsensor-members.html
  10629. share/doc/qt5/qtsensors/qml-qtsensors-tiltsensor.html
  10630. share/doc/qt5/qtsensors/qorientationfilter-members.html
  10631. share/doc/qt5/qtsensors/qorientationfilter.html
  10632. share/doc/qt5/qtsensors/qorientationreading-members.html
  10633. share/doc/qt5/qtsensors/qorientationreading.html
  10634. share/doc/qt5/qtsensors/qorientationsensor-members.html
  10635. share/doc/qt5/qtsensors/qorientationsensor.html
  10636. share/doc/qt5/qtsensors/qpressurefilter-members.html
  10637. share/doc/qt5/qtsensors/qpressurefilter.html
  10638. share/doc/qt5/qtsensors/qpressurereading-members.html
  10639. share/doc/qt5/qtsensors/qpressurereading.html
  10640. share/doc/qt5/qtsensors/qpressuresensor-members.html
  10641. share/doc/qt5/qtsensors/qpressuresensor.html
  10642. share/doc/qt5/qtsensors/qproximityfilter-members.html
  10643. share/doc/qt5/qtsensors/qproximityfilter.html
  10644. share/doc/qt5/qtsensors/qproximityreading-members.html
  10645. share/doc/qt5/qtsensors/qproximityreading.html
  10646. share/doc/qt5/qtsensors/qproximitysensor-members.html
  10647. share/doc/qt5/qtsensors/qproximitysensor.html
  10648. share/doc/qt5/qtsensors/qrotationfilter-members.html
  10649. share/doc/qt5/qtsensors/qrotationfilter.html
  10650. share/doc/qt5/qtsensors/qrotationreading-members.html
  10651. share/doc/qt5/qtsensors/qrotationreading.html
  10652. share/doc/qt5/qtsensors/qrotationsensor-members.html
  10653. share/doc/qt5/qtsensors/qrotationsensor.html
  10654. share/doc/qt5/qtsensors/qsensor-members.html
  10655. share/doc/qt5/qtsensors/qsensor.html
  10656. share/doc/qt5/qtsensors/qsensorbackend-members.html
  10657. share/doc/qt5/qtsensors/qsensorbackend.html
  10658. share/doc/qt5/qtsensors/qsensorbackendfactory-members.html
  10659. share/doc/qt5/qtsensors/qsensorbackendfactory.html
  10660. share/doc/qt5/qtsensors/qsensorchangesinterface-members.html
  10661. share/doc/qt5/qtsensors/qsensorchangesinterface.html
  10662. share/doc/qt5/qtsensors/qsensorfilter-members.html
  10663. share/doc/qt5/qtsensors/qsensorfilter.html
  10664. share/doc/qt5/qtsensors/qsensorgesture-members.html
  10665. share/doc/qt5/qtsensors/qsensorgesture.html
  10666. share/doc/qt5/qtsensors/qsensorgesturemanager-members.html
  10667. share/doc/qt5/qtsensors/qsensorgesturemanager.html
  10668. share/doc/qt5/qtsensors/qsensorgestureplugininterface-members.html
  10669. share/doc/qt5/qtsensors/qsensorgestureplugininterface.html
  10670. share/doc/qt5/qtsensors/qsensorgesturerecognizer-members.html
  10671. share/doc/qt5/qtsensors/qsensorgesturerecognizer.html
  10672. share/doc/qt5/qtsensors/qsensormanager-members.html
  10673. share/doc/qt5/qtsensors/qsensormanager.html
  10674. share/doc/qt5/qtsensors/qsensorplugininterface-members.html
  10675. share/doc/qt5/qtsensors/qsensorplugininterface.html
  10676. share/doc/qt5/qtsensors/qsensorreading-members.html
  10677. share/doc/qt5/qtsensors/qsensorreading.html
  10678. share/doc/qt5/qtsensors/qtapfilter-members.html
  10679. share/doc/qt5/qtsensors/qtapfilter.html
  10680. share/doc/qt5/qtsensors/qtapreading-members.html
  10681. share/doc/qt5/qtsensors/qtapreading.html
  10682. share/doc/qt5/qtsensors/qtapsensor-members.html
  10683. share/doc/qt5/qtsensors/qtapsensor.html
  10684. share/doc/qt5/qtsensors/qtiltfilter-members.html
  10685. share/doc/qt5/qtsensors/qtiltfilter.html
  10686. share/doc/qt5/qtsensors/qtiltreading-members.html
  10687. share/doc/qt5/qtsensors/qtiltreading.html
  10688. share/doc/qt5/qtsensors/qtiltsensor-members.html
  10689. share/doc/qt5/qtsensors/qtiltsensor.html
  10690. share/doc/qt5/qtsensors/qtsensorgestures-cpp.html
  10691. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-pro.html
  10692. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-qml.html
  10693. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-qrc.html
  10694. share/doc/qt5/qtsensors/qtsensors-accelbubble-android-androidmanifest-xml.html
  10695. share/doc/qt5/qtsensors/qtsensors-accelbubble-content-bluebubble-svg.html
  10696. share/doc/qt5/qtsensors/qtsensors-accelbubble-example.html
  10697. share/doc/qt5/qtsensors/qtsensors-accelbubble-main-cpp.html
  10698. share/doc/qt5/qtsensors/qtsensors-cpp.html
  10699. share/doc/qt5/qtsensors/qtsensors-examples.html
  10700. share/doc/qt5/qtsensors/qtsensors-grue-console-app-console-app-pro.html
  10701. share/doc/qt5/qtsensors/qtsensors-grue-example.html
  10702. share/doc/qt5/qtsensors/qtsensors-grue-grue-pro.html
  10703. share/doc/qt5/qtsensors/qtsensors-grue-grue-qml.html
  10704. share/doc/qt5/qtsensors/qtsensors-grue-import-import-pro.html
  10705. share/doc/qt5/qtsensors/qtsensors-grue-import-qmldir.html
  10706. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-cpp.html
  10707. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-h.html
  10708. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-p-h.html
  10709. share/doc/qt5/qtsensors/qtsensors-grue-lib-lib-pro.html
  10710. share/doc/qt5/qtsensors/qtsensors-grue-main-cpp.html
  10711. share/doc/qt5/qtsensors/qtsensors-grue-plugin-gruesensorimpl-cpp.html
  10712. share/doc/qt5/qtsensors/qtsensors-grue-plugin-gruesensorimpl-h.html
  10713. share/doc/qt5/qtsensors/qtsensors-grue-plugin-plugin-pro.html
  10714. share/doc/qt5/qtsensors/qtsensors-grue-qml-pro.html
  10715. share/doc/qt5/qtsensors/qtsensors-grue-qml-qrc.html
  10716. share/doc/qt5/qtsensors/qtsensors-index.html
  10717. share/doc/qt5/qtsensors/qtsensors-maze-android-androidmanifest-xml.html
  10718. share/doc/qt5/qtsensors/qtsensors-maze-components-applicationwindow-qml.html
  10719. share/doc/qt5/qtsensors/qtsensors-maze-components-button-qml.html
  10720. share/doc/qt5/qtsensors/qtsensors-maze-congratulation-qml.html
  10721. share/doc/qt5/qtsensors/qtsensors-maze-example.html
  10722. share/doc/qt5/qtsensors/qtsensors-maze-labyrinthsquare-qml.html
  10723. share/doc/qt5/qtsensors/qtsensors-maze-lib-js.html
  10724. share/doc/qt5/qtsensors/qtsensors-maze-main-cpp.html
  10725. share/doc/qt5/qtsensors/qtsensors-maze-maze-pro.html
  10726. share/doc/qt5/qtsensors/qtsensors-maze-maze-qml.html
  10727. share/doc/qt5/qtsensors/qtsensors-maze-maze-qrc.html
  10728. share/doc/qt5/qtsensors/qtsensors-maze-mouse-qml.html
  10729. share/doc/qt5/qtsensors/qtsensors-module.html
  10730. share/doc/qt5/qtsensors/qtsensors-porting.html
  10731. share/doc/qt5/qtsensors/qtsensors-qmlmodule.html
  10732. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-applicationwindow-qml.html
  10733. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-button-qml.html
  10734. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-divider-qml.html
  10735. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-example.html
  10736. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-main-cpp.html
  10737. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-pro.html
  10738. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qml.html
  10739. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qrc.html
  10740. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-button-qml.html
  10741. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-example.html
  10742. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gesturelist-qml.html
  10743. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gesturesview-qml.html
  10744. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gestureview-qml.html
  10745. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-main-cpp.html
  10746. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-plugin-pro.html
  10747. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-cpp.html
  10748. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-h.html
  10749. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-cpp.html
  10750. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-h.html
  10751. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qml-pro.html
  10752. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qml-qrc.html
  10753. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-pro.html
  10754. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-qml.html
  10755. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-example.html
  10756. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-explorer-cpp.html
  10757. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-explorer-h.html
  10758. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-import-pro.html
  10759. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-cpp.html
  10760. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-h.html
  10761. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-qmldir.html
  10762. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-sensoritem-cpp.html
  10763. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-sensoritem-h.html
  10764. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-main-cpp.html
  10765. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-qml-pro.html
  10766. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-qml-qrc.html
  10767. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-sensor-explorer-pro.html
  10768. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-sensor-explorer-qml.html
  10769. share/doc/qt5/qtsensors/qtsensors-sensorgestures-example.html
  10770. share/doc/qt5/qtsensors/qtsensors-sensorgestures-main-cpp.html
  10771. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-cpp.html
  10772. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-h.html
  10773. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-ui.html
  10774. share/doc/qt5/qtsensors/qtsensors-sensorgestures-sensorgestures-pro.html
  10775. share/doc/qt5/qtsensors/qtsensors-shakeit-example.html
  10776. share/doc/qt5/qtsensors/qtsensors-shakeit-main-cpp.html
  10777. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-pro.html
  10778. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-qml.html
  10779. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-qrc.html
  10780. share/doc/qt5/qtsensors/qtsensors.index
  10781. share/doc/qt5/qtsensors/qtsensors.qhp
  10782. share/doc/qt5/qtsensors/qtsensors.qhp.sha1
  10783. share/doc/qt5/qtsensors/qtsensors.tags
  10784. share/doc/qt5/qtsensors/senorfwbackend.html
  10785. share/doc/qt5/qtsensors/sensorgesture-emulator-topics.html
  10786. share/doc/qt5/qtsensors/sensorgesture-plugins-topics.html
  10787. share/doc/qt5/qtsensors/sensors-backend-topics.html
  10788. share/doc/qt5/qtsensors/style/offline-simple.css
  10789. share/doc/qt5/qtsensors/style/offline.css
  10790. share/doc/qt5/qtserialbus.qch
  10791. share/doc/qt5/qtserialbus/examples-manifest.xml
  10792. share/doc/qt5/qtserialbus/images/arrow_bc.png
  10793. share/doc/qt5/qtserialbus/images/bgrContent.png
  10794. share/doc/qt5/qtserialbus/images/btn_next.png
  10795. share/doc/qt5/qtserialbus/images/btn_prev.png
  10796. share/doc/qt5/qtserialbus/images/bullet_dn.png
  10797. share/doc/qt5/qtserialbus/images/bullet_sq.png
  10798. share/doc/qt5/qtserialbus/images/can-example.png
  10799. share/doc/qt5/qtserialbus/images/home.png
  10800. share/doc/qt5/qtserialbus/images/ico_note.png
  10801. share/doc/qt5/qtserialbus/images/ico_note_attention.png
  10802. share/doc/qt5/qtserialbus/images/ico_out.png
  10803. share/doc/qt5/qtserialbus/images/logo.png
  10804. share/doc/qt5/qtserialbus/images/modbusmaster.png
  10805. share/doc/qt5/qtserialbus/images/modbusserver.png
  10806. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/application-exit.png
  10807. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/clear.png
  10808. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/connect.png
  10809. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/disconnect.png
  10810. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/application-exit.png
  10811. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/connect.png
  10812. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/disconnect.png
  10813. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/settings.png
  10814. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/application-exit.png
  10815. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/connect.png
  10816. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/disconnect.png
  10817. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/settings.png
  10818. share/doc/qt5/qtserialbus/qcanbus-members.html
  10819. share/doc/qt5/qtserialbus/qcanbus.html
  10820. share/doc/qt5/qtserialbus/qcanbusdevice-filter-members.html
  10821. share/doc/qt5/qtserialbus/qcanbusdevice-filter.html
  10822. share/doc/qt5/qtserialbus/qcanbusdevice-members.html
  10823. share/doc/qt5/qtserialbus/qcanbusdevice.html
  10824. share/doc/qt5/qtserialbus/qcanbusdeviceinfo-members.html
  10825. share/doc/qt5/qtserialbus/qcanbusdeviceinfo.html
  10826. share/doc/qt5/qtserialbus/qcanbusfactory-members.html
  10827. share/doc/qt5/qtserialbus/qcanbusfactory.html
  10828. share/doc/qt5/qtserialbus/qcanbusfactoryv2-members.html
  10829. share/doc/qt5/qtserialbus/qcanbusfactoryv2.html
  10830. share/doc/qt5/qtserialbus/qcanbusframe-members.html
  10831. share/doc/qt5/qtserialbus/qcanbusframe-timestamp-members.html
  10832. share/doc/qt5/qtserialbus/qcanbusframe-timestamp.html
  10833. share/doc/qt5/qtserialbus/qcanbusframe.html
  10834. share/doc/qt5/qtserialbus/qmodbusclient-members.html
  10835. share/doc/qt5/qtserialbus/qmodbusclient.html
  10836. share/doc/qt5/qtserialbus/qmodbusdataunit-members.html
  10837. share/doc/qt5/qtserialbus/qmodbusdataunit.html
  10838. share/doc/qt5/qtserialbus/qmodbusdevice-members.html
  10839. share/doc/qt5/qtserialbus/qmodbusdevice.html
  10840. share/doc/qt5/qtserialbus/qmodbusdeviceidentification-members.html
  10841. share/doc/qt5/qtserialbus/qmodbusdeviceidentification.html
  10842. share/doc/qt5/qtserialbus/qmodbusexceptionresponse-members.html
  10843. share/doc/qt5/qtserialbus/qmodbusexceptionresponse.html
  10844. share/doc/qt5/qtserialbus/qmodbuspdu-members.html
  10845. share/doc/qt5/qtserialbus/qmodbuspdu.html
  10846. share/doc/qt5/qtserialbus/qmodbusreply-members.html
  10847. share/doc/qt5/qtserialbus/qmodbusreply.html
  10848. share/doc/qt5/qtserialbus/qmodbusrequest-members.html
  10849. share/doc/qt5/qtserialbus/qmodbusrequest.html
  10850. share/doc/qt5/qtserialbus/qmodbusresponse-members.html
  10851. share/doc/qt5/qtserialbus/qmodbusresponse.html
  10852. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster-members.html
  10853. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster.html
  10854. share/doc/qt5/qtserialbus/qmodbusrtuserialslave-members.html
  10855. share/doc/qt5/qtserialbus/qmodbusrtuserialslave.html
  10856. share/doc/qt5/qtserialbus/qmodbusserver-members.html
  10857. share/doc/qt5/qtserialbus/qmodbusserver.html
  10858. share/doc/qt5/qtserialbus/qmodbustcpclient-members.html
  10859. share/doc/qt5/qtserialbus/qmodbustcpclient.html
  10860. share/doc/qt5/qtserialbus/qmodbustcpserver-members.html
  10861. share/doc/qt5/qtserialbus/qmodbustcpserver.html
  10862. share/doc/qt5/qtserialbus/qtcanbus-backends.html
  10863. share/doc/qt5/qtserialbus/qtmodbus-backends.html
  10864. share/doc/qt5/qtserialbus/qtserialbus-can-bitratebox-cpp.html
  10865. share/doc/qt5/qtserialbus/qtserialbus-can-bitratebox-h.html
  10866. share/doc/qt5/qtserialbus/qtserialbus-can-can-pro.html
  10867. share/doc/qt5/qtserialbus/qtserialbus-can-can-qrc.html
  10868. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-cpp.html
  10869. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-h.html
  10870. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-ui.html
  10871. share/doc/qt5/qtserialbus/qtserialbus-can-example.html
  10872. share/doc/qt5/qtserialbus/qtserialbus-can-main-cpp.html
  10873. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-cpp.html
  10874. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-h.html
  10875. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-ui.html
  10876. share/doc/qt5/qtserialbus/qtserialbus-examples.html
  10877. share/doc/qt5/qtserialbus/qtserialbus-index.html
  10878. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-example.html
  10879. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-main-cpp.html
  10880. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-cpp.html
  10881. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-h.html
  10882. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-ui.html
  10883. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-master-pro.html
  10884. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-master-qrc.html
  10885. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-cpp.html
  10886. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-h.html
  10887. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-ui.html
  10888. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-writeregistermodel-cpp.html
  10889. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-writeregistermodel-h.html
  10890. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-example.html
  10891. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-main-cpp.html
  10892. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-cpp.html
  10893. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-h.html
  10894. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-ui.html
  10895. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-cpp.html
  10896. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-h.html
  10897. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-ui.html
  10898. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-slave-pro.html
  10899. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-slave-qrc.html
  10900. share/doc/qt5/qtserialbus/qtserialbus-module.html
  10901. share/doc/qt5/qtserialbus/qtserialbus-peakcan-overview.html
  10902. share/doc/qt5/qtserialbus/qtserialbus-socketcan-overview.html
  10903. share/doc/qt5/qtserialbus/qtserialbus-systeccan-overview.html
  10904. share/doc/qt5/qtserialbus/qtserialbus-tinycan-overview.html
  10905. share/doc/qt5/qtserialbus/qtserialbus-vectorcan-overview.html
  10906. share/doc/qt5/qtserialbus/qtserialbus.index
  10907. share/doc/qt5/qtserialbus/qtserialbus.qhp
  10908. share/doc/qt5/qtserialbus/qtserialbus.qhp.sha1
  10909. share/doc/qt5/qtserialbus/qtserialbus.tags
  10910. share/doc/qt5/qtserialbus/style/offline-simple.css
  10911. share/doc/qt5/qtserialbus/style/offline.css
  10912. share/doc/qt5/qtserialport.qch
  10913. share/doc/qt5/qtserialport/examples-manifest.xml
  10914. share/doc/qt5/qtserialport/images/arrow_bc.png
  10915. share/doc/qt5/qtserialport/images/bgrContent.png
  10916. share/doc/qt5/qtserialport/images/blockingmaster-example.png
  10917. share/doc/qt5/qtserialport/images/blockingslave-example.png
  10918. share/doc/qt5/qtserialport/images/btn_next.png
  10919. share/doc/qt5/qtserialport/images/btn_prev.png
  10920. share/doc/qt5/qtserialport/images/bullet_dn.png
  10921. share/doc/qt5/qtserialport/images/bullet_sq.png
  10922. share/doc/qt5/qtserialport/images/cenumerator-example.png
  10923. share/doc/qt5/qtserialport/images/creaderasync-example.png
  10924. share/doc/qt5/qtserialport/images/creadersync-example.png
  10925. share/doc/qt5/qtserialport/images/cwriterasync-example.png
  10926. share/doc/qt5/qtserialport/images/cwritersync-example.png
  10927. share/doc/qt5/qtserialport/images/enumerator-example.png
  10928. share/doc/qt5/qtserialport/images/home.png
  10929. share/doc/qt5/qtserialport/images/ico_note.png
  10930. share/doc/qt5/qtserialport/images/ico_note_attention.png
  10931. share/doc/qt5/qtserialport/images/ico_out.png
  10932. share/doc/qt5/qtserialport/images/logo.png
  10933. share/doc/qt5/qtserialport/images/terminal-example.png
  10934. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/application-exit.png
  10935. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/clear.png
  10936. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/connect.png
  10937. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/disconnect.png
  10938. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/settings.png
  10939. share/doc/qt5/qtserialport/qserialport-members.html
  10940. share/doc/qt5/qtserialport/qserialport-obsolete.html
  10941. share/doc/qt5/qtserialport/qserialport.html
  10942. share/doc/qt5/qtserialport/qserialportinfo-members.html
  10943. share/doc/qt5/qtserialport/qserialportinfo-obsolete.html
  10944. share/doc/qt5/qtserialport/qserialportinfo.html
  10945. share/doc/qt5/qtserialport/qtserialport-blockingmaster-blockingmaster-pro.html
  10946. share/doc/qt5/qtserialport/qtserialport-blockingmaster-dialog-cpp.html
  10947. share/doc/qt5/qtserialport/qtserialport-blockingmaster-dialog-h.html
  10948. share/doc/qt5/qtserialport/qtserialport-blockingmaster-example.html
  10949. share/doc/qt5/qtserialport/qtserialport-blockingmaster-main-cpp.html
  10950. share/doc/qt5/qtserialport/qtserialport-blockingmaster-masterthread-cpp.html
  10951. share/doc/qt5/qtserialport/qtserialport-blockingmaster-masterthread-h.html
  10952. share/doc/qt5/qtserialport/qtserialport-blockingslave-blockingslave-pro.html
  10953. share/doc/qt5/qtserialport/qtserialport-blockingslave-dialog-cpp.html
  10954. share/doc/qt5/qtserialport/qtserialport-blockingslave-dialog-h.html
  10955. share/doc/qt5/qtserialport/qtserialport-blockingslave-example.html
  10956. share/doc/qt5/qtserialport/qtserialport-blockingslave-main-cpp.html
  10957. share/doc/qt5/qtserialport/qtserialport-blockingslave-slavethread-cpp.html
  10958. share/doc/qt5/qtserialport/qtserialport-blockingslave-slavethread-h.html
  10959. share/doc/qt5/qtserialport/qtserialport-cenumerator-cenumerator-pro.html
  10960. share/doc/qt5/qtserialport/qtserialport-cenumerator-example.html
  10961. share/doc/qt5/qtserialport/qtserialport-cenumerator-main-cpp.html
  10962. share/doc/qt5/qtserialport/qtserialport-creaderasync-creaderasync-pro.html
  10963. share/doc/qt5/qtserialport/qtserialport-creaderasync-example.html
  10964. share/doc/qt5/qtserialport/qtserialport-creaderasync-main-cpp.html
  10965. share/doc/qt5/qtserialport/qtserialport-creaderasync-serialportreader-cpp.html
  10966. share/doc/qt5/qtserialport/qtserialport-creaderasync-serialportreader-h.html
  10967. share/doc/qt5/qtserialport/qtserialport-creadersync-creadersync-pro.html
  10968. share/doc/qt5/qtserialport/qtserialport-creadersync-example.html
  10969. share/doc/qt5/qtserialport/qtserialport-creadersync-main-cpp.html
  10970. share/doc/qt5/qtserialport/qtserialport-cwriterasync-cwriterasync-pro.html
  10971. share/doc/qt5/qtserialport/qtserialport-cwriterasync-example.html
  10972. share/doc/qt5/qtserialport/qtserialport-cwriterasync-main-cpp.html
  10973. share/doc/qt5/qtserialport/qtserialport-cwriterasync-serialportwriter-cpp.html
  10974. share/doc/qt5/qtserialport/qtserialport-cwriterasync-serialportwriter-h.html
  10975. share/doc/qt5/qtserialport/qtserialport-cwritersync-cwritersync-pro.html
  10976. share/doc/qt5/qtserialport/qtserialport-cwritersync-example.html
  10977. share/doc/qt5/qtserialport/qtserialport-cwritersync-main-cpp.html
  10978. share/doc/qt5/qtserialport/qtserialport-enumerator-enumerator-pro.html
  10979. share/doc/qt5/qtserialport/qtserialport-enumerator-example.html
  10980. share/doc/qt5/qtserialport/qtserialport-enumerator-main-cpp.html
  10981. share/doc/qt5/qtserialport/qtserialport-examples.html
  10982. share/doc/qt5/qtserialport/qtserialport-index.html
  10983. share/doc/qt5/qtserialport/qtserialport-module.html
  10984. share/doc/qt5/qtserialport/qtserialport-terminal-console-cpp.html
  10985. share/doc/qt5/qtserialport/qtserialport-terminal-console-h.html
  10986. share/doc/qt5/qtserialport/qtserialport-terminal-example.html
  10987. share/doc/qt5/qtserialport/qtserialport-terminal-main-cpp.html
  10988. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-cpp.html
  10989. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-h.html
  10990. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-ui.html
  10991. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-cpp.html
  10992. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-h.html
  10993. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-ui.html
  10994. share/doc/qt5/qtserialport/qtserialport-terminal-terminal-pro.html
  10995. share/doc/qt5/qtserialport/qtserialport-terminal-terminal-qrc.html
  10996. share/doc/qt5/qtserialport/qtserialport.index
  10997. share/doc/qt5/qtserialport/qtserialport.qhp
  10998. share/doc/qt5/qtserialport/qtserialport.qhp.sha1
  10999. share/doc/qt5/qtserialport/style/offline-simple.css
  11000. share/doc/qt5/qtserialport/style/offline.css
  11001. share/doc/qt5/qtsql.qch
  11002. share/doc/qt5/qtsql/database.html
  11003. share/doc/qt5/qtsql/examples-manifest.xml
  11004. share/doc/qt5/qtsql/images/arrow_bc.png
  11005. share/doc/qt5/qtsql/images/bgrContent.png
  11006. share/doc/qt5/qtsql/images/books-demo.png
  11007. share/doc/qt5/qtsql/images/btn_next.png
  11008. share/doc/qt5/qtsql/images/btn_prev.png
  11009. share/doc/qt5/qtsql/images/bullet_dn.png
  11010. share/doc/qt5/qtsql/images/bullet_sq.png
  11011. share/doc/qt5/qtsql/images/cachedtable-example.png
  11012. share/doc/qt5/qtsql/images/drilldown-example.png
  11013. share/doc/qt5/qtsql/images/foreignkeys.png
  11014. share/doc/qt5/qtsql/images/home.png
  11015. share/doc/qt5/qtsql/images/ico_note.png
  11016. share/doc/qt5/qtsql/images/ico_note_attention.png
  11017. share/doc/qt5/qtsql/images/ico_out.png
  11018. share/doc/qt5/qtsql/images/insertrowinmodelview.png
  11019. share/doc/qt5/qtsql/images/logo.png
  11020. share/doc/qt5/qtsql/images/masterdetail-example.png
  11021. share/doc/qt5/qtsql/images/noforeignkeys.png
  11022. share/doc/qt5/qtsql/images/qdatawidgetmapper-simple.png
  11023. share/doc/qt5/qtsql/images/querymodel-example.png
  11024. share/doc/qt5/qtsql/images/relationaltable.png
  11025. share/doc/qt5/qtsql/images/relationaltablemodel-example.png
  11026. share/doc/qt5/qtsql/images/sql-widget-mapper.png
  11027. share/doc/qt5/qtsql/images/sqlbrowser-demo.png
  11028. share/doc/qt5/qtsql/images/tablemodel-example.png
  11029. share/doc/qt5/qtsql/images/used-in-examples/books/images/star.png
  11030. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-creator.png
  11031. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-logo.png
  11032. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-project.png
  11033. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-quick.png
  11034. share/doc/qt5/qtsql/images/used-in-examples/masterdetail/images/icon.png
  11035. share/doc/qt5/qtsql/images/used-in-examples/masterdetail/images/image.png
  11036. share/doc/qt5/qtsql/images/widgetmapper-sql-mapping-table.png
  11037. share/doc/qt5/qtsql/images/widgetmapper-sql-mapping.png
  11038. share/doc/qt5/qtsql/qsql.html
  11039. share/doc/qt5/qtsql/qsqldatabase-members.html
  11040. share/doc/qt5/qtsql/qsqldatabase.html
  11041. share/doc/qt5/qtsql/qsqldriver-members.html
  11042. share/doc/qt5/qtsql/qsqldriver.html
  11043. share/doc/qt5/qtsql/qsqldrivercreator-members.html
  11044. share/doc/qt5/qtsql/qsqldrivercreator.html
  11045. share/doc/qt5/qtsql/qsqldrivercreatorbase-members.html
  11046. share/doc/qt5/qtsql/qsqldrivercreatorbase.html
  11047. share/doc/qt5/qtsql/qsqldriverplugin-members.html
  11048. share/doc/qt5/qtsql/qsqldriverplugin.html
  11049. share/doc/qt5/qtsql/qsqlerror-members.html
  11050. share/doc/qt5/qtsql/qsqlerror-obsolete.html
  11051. share/doc/qt5/qtsql/qsqlerror.html
  11052. share/doc/qt5/qtsql/qsqlfield-members.html
  11053. share/doc/qt5/qtsql/qsqlfield.html
  11054. share/doc/qt5/qtsql/qsqlindex-members.html
  11055. share/doc/qt5/qtsql/qsqlindex.html
  11056. share/doc/qt5/qtsql/qsqlquery-members.html
  11057. share/doc/qt5/qtsql/qsqlquery.html
  11058. share/doc/qt5/qtsql/qsqlquerymodel-members.html
  11059. share/doc/qt5/qtsql/qsqlquerymodel.html
  11060. share/doc/qt5/qtsql/qsqlrecord-members.html
  11061. share/doc/qt5/qtsql/qsqlrecord.html
  11062. share/doc/qt5/qtsql/qsqlrelation-members.html
  11063. share/doc/qt5/qtsql/qsqlrelation.html
  11064. share/doc/qt5/qtsql/qsqlrelationaldelegate-members.html
  11065. share/doc/qt5/qtsql/qsqlrelationaldelegate.html
  11066. share/doc/qt5/qtsql/qsqlrelationaltablemodel-members.html
  11067. share/doc/qt5/qtsql/qsqlrelationaltablemodel.html
  11068. share/doc/qt5/qtsql/qsqlresult-members.html
  11069. share/doc/qt5/qtsql/qsqlresult.html
  11070. share/doc/qt5/qtsql/qsqltablemodel-members.html
  11071. share/doc/qt5/qtsql/qsqltablemodel.html
  11072. share/doc/qt5/qtsql/qtsql-attribution-sqlite.html
  11073. share/doc/qt5/qtsql/qtsql-books-bookdelegate-cpp.html
  11074. share/doc/qt5/qtsql/qtsql-books-bookdelegate-h.html
  11075. share/doc/qt5/qtsql/qtsql-books-books-pro.html
  11076. share/doc/qt5/qtsql/qtsql-books-books-qrc.html
  11077. share/doc/qt5/qtsql/qtsql-books-bookwindow-cpp.html
  11078. share/doc/qt5/qtsql/qtsql-books-bookwindow-h.html
  11079. share/doc/qt5/qtsql/qtsql-books-bookwindow-ui.html
  11080. share/doc/qt5/qtsql/qtsql-books-example.html
  11081. share/doc/qt5/qtsql/qtsql-books-initdb-h.html
  11082. share/doc/qt5/qtsql/qtsql-books-main-cpp.html
  11083. share/doc/qt5/qtsql/qtsql-cachedtable-cachedtable-pro.html
  11084. share/doc/qt5/qtsql/qtsql-cachedtable-example.html
  11085. share/doc/qt5/qtsql/qtsql-cachedtable-main-cpp.html
  11086. share/doc/qt5/qtsql/qtsql-cachedtable-tableeditor-cpp.html
  11087. share/doc/qt5/qtsql/qtsql-cachedtable-tableeditor-h.html
  11088. share/doc/qt5/qtsql/qtsql-drilldown-drilldown-pro.html
  11089. share/doc/qt5/qtsql/qtsql-drilldown-drilldown-qrc.html
  11090. share/doc/qt5/qtsql/qtsql-drilldown-example.html
  11091. share/doc/qt5/qtsql/qtsql-drilldown-imageitem-cpp.html
  11092. share/doc/qt5/qtsql/qtsql-drilldown-imageitem-h.html
  11093. share/doc/qt5/qtsql/qtsql-drilldown-informationwindow-cpp.html
  11094. share/doc/qt5/qtsql/qtsql-drilldown-informationwindow-h.html
  11095. share/doc/qt5/qtsql/qtsql-drilldown-main-cpp.html
  11096. share/doc/qt5/qtsql/qtsql-drilldown-view-cpp.html
  11097. share/doc/qt5/qtsql/qtsql-drilldown-view-h.html
  11098. share/doc/qt5/qtsql/qtsql-index.html
  11099. share/doc/qt5/qtsql/qtsql-masterdetail-albumdetails-xml.html
  11100. share/doc/qt5/qtsql/qtsql-masterdetail-database-h.html
  11101. share/doc/qt5/qtsql/qtsql-masterdetail-dialog-cpp.html
  11102. share/doc/qt5/qtsql/qtsql-masterdetail-dialog-h.html
  11103. share/doc/qt5/qtsql/qtsql-masterdetail-example.html
  11104. share/doc/qt5/qtsql/qtsql-masterdetail-main-cpp.html
  11105. share/doc/qt5/qtsql/qtsql-masterdetail-mainwindow-cpp.html
  11106. share/doc/qt5/qtsql/qtsql-masterdetail-mainwindow-h.html
  11107. share/doc/qt5/qtsql/qtsql-masterdetail-masterdetail-pro.html
  11108. share/doc/qt5/qtsql/qtsql-masterdetail-masterdetail-qrc.html
  11109. share/doc/qt5/qtsql/qtsql-module.html
  11110. share/doc/qt5/qtsql/qtsql-querymodel-customsqlmodel-cpp.html
  11111. share/doc/qt5/qtsql/qtsql-querymodel-customsqlmodel-h.html
  11112. share/doc/qt5/qtsql/qtsql-querymodel-editablesqlmodel-cpp.html
  11113. share/doc/qt5/qtsql/qtsql-querymodel-editablesqlmodel-h.html
  11114. share/doc/qt5/qtsql/qtsql-querymodel-example.html
  11115. share/doc/qt5/qtsql/qtsql-querymodel-main-cpp.html
  11116. share/doc/qt5/qtsql/qtsql-querymodel-querymodel-pro.html
  11117. share/doc/qt5/qtsql/qtsql-relationaltablemodel-example.html
  11118. share/doc/qt5/qtsql/qtsql-relationaltablemodel-relationaltablemodel-cpp.html
  11119. share/doc/qt5/qtsql/qtsql-relationaltablemodel-relationaltablemodel-pro.html
  11120. share/doc/qt5/qtsql/qtsql-sqlbrowser-browser-cpp.html
  11121. share/doc/qt5/qtsql/qtsql-sqlbrowser-browser-h.html
  11122. share/doc/qt5/qtsql/qtsql-sqlbrowser-browserwidget-ui.html
  11123. share/doc/qt5/qtsql/qtsql-sqlbrowser-connectionwidget-cpp.html
  11124. share/doc/qt5/qtsql/qtsql-sqlbrowser-connectionwidget-h.html
  11125. share/doc/qt5/qtsql/qtsql-sqlbrowser-example.html
  11126. share/doc/qt5/qtsql/qtsql-sqlbrowser-main-cpp.html
  11127. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-cpp.html
  11128. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-h.html
  11129. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-ui.html
  11130. share/doc/qt5/qtsql/qtsql-sqlbrowser-sqlbrowser-pro.html
  11131. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-example.html
  11132. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-main-cpp.html
  11133. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-sqlwidgetmapper-pro.html
  11134. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-window-cpp.html
  11135. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-window-h.html
  11136. share/doc/qt5/qtsql/qtsql-tablemodel-example.html
  11137. share/doc/qt5/qtsql/qtsql-tablemodel-tablemodel-cpp.html
  11138. share/doc/qt5/qtsql/qtsql-tablemodel-tablemodel-pro.html
  11139. share/doc/qt5/qtsql/qtsql.index
  11140. share/doc/qt5/qtsql/qtsql.qhp
  11141. share/doc/qt5/qtsql/qtsql.qhp.sha1
  11142. share/doc/qt5/qtsql/qtsql.tags
  11143. share/doc/qt5/qtsql/sql-connecting.html
  11144. share/doc/qt5/qtsql/sql-driver.html
  11145. share/doc/qt5/qtsql/sql-forms.html
  11146. share/doc/qt5/qtsql/sql-model.html
  11147. share/doc/qt5/qtsql/sql-presenting.html
  11148. share/doc/qt5/qtsql/sql-programming.html
  11149. share/doc/qt5/qtsql/sql-sqlstatements.html
  11150. share/doc/qt5/qtsql/sql-types.html
  11151. share/doc/qt5/qtsql/style/offline-simple.css
  11152. share/doc/qt5/qtsql/style/offline.css
  11153. share/doc/qt5/qtsvg.qch
  11154. share/doc/qt5/qtsvg/examples-manifest.xml
  11155. share/doc/qt5/qtsvg/images/arrow_bc.png
  11156. share/doc/qt5/qtsvg/images/bgrContent.png
  11157. share/doc/qt5/qtsvg/images/btn_next.png
  11158. share/doc/qt5/qtsvg/images/btn_prev.png
  11159. share/doc/qt5/qtsvg/images/bullet_dn.png
  11160. share/doc/qt5/qtsvg/images/bullet_sq.png
  11161. share/doc/qt5/qtsvg/images/home.png
  11162. share/doc/qt5/qtsvg/images/ico_note.png
  11163. share/doc/qt5/qtsvg/images/ico_note_attention.png
  11164. share/doc/qt5/qtsvg/images/ico_out.png
  11165. share/doc/qt5/qtsvg/images/logo.png
  11166. share/doc/qt5/qtsvg/images/svggenerator-example.png
  11167. share/doc/qt5/qtsvg/images/svgviewer-example.png
  11168. share/doc/qt5/qtsvg/images/textobject-example.png
  11169. share/doc/qt5/qtsvg/qgraphicssvgitem-members.html
  11170. share/doc/qt5/qtsvg/qgraphicssvgitem-obsolete.html
  11171. share/doc/qt5/qtsvg/qgraphicssvgitem.html
  11172. share/doc/qt5/qtsvg/qsvggenerator-members.html
  11173. share/doc/qt5/qtsvg/qsvggenerator.html
  11174. share/doc/qt5/qtsvg/qsvgrenderer-members.html
  11175. share/doc/qt5/qtsvg/qsvgrenderer.html
  11176. share/doc/qt5/qtsvg/qsvgwidget-members.html
  11177. share/doc/qt5/qtsvg/qsvgwidget.html
  11178. share/doc/qt5/qtsvg/qtsvg-attribution-xsvg.html
  11179. share/doc/qt5/qtsvg/qtsvg-index.html
  11180. share/doc/qt5/qtsvg/qtsvg-module.html
  11181. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-example.html
  11182. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-files-heart-svg.html
  11183. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-main-cpp.html
  11184. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-resources-qrc.html
  11185. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-svgtextobject-cpp.html
  11186. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-svgtextobject-h.html
  11187. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-textobject-pro.html
  11188. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-window-cpp.html
  11189. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-window-h.html
  11190. share/doc/qt5/qtsvg/qtsvg-svggenerator-displaywidget-cpp.html
  11191. share/doc/qt5/qtsvg/qtsvg-svggenerator-displaywidget-h.html
  11192. share/doc/qt5/qtsvg/qtsvg-svggenerator-example.html
  11193. share/doc/qt5/qtsvg/qtsvg-svggenerator-forms-window-ui.html
  11194. share/doc/qt5/qtsvg/qtsvg-svggenerator-main-cpp.html
  11195. share/doc/qt5/qtsvg/qtsvg-svggenerator-svggenerator-pro.html
  11196. share/doc/qt5/qtsvg/qtsvg-svggenerator-svggenerator-qrc.html
  11197. share/doc/qt5/qtsvg/qtsvg-svggenerator-window-cpp.html
  11198. share/doc/qt5/qtsvg/qtsvg-svggenerator-window-h.html
  11199. share/doc/qt5/qtsvg/qtsvg-svgviewer-example.html
  11200. share/doc/qt5/qtsvg/qtsvg-svgviewer-exportdialog-cpp.html
  11201. share/doc/qt5/qtsvg/qtsvg-svgviewer-exportdialog-h.html
  11202. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-bubbles-svg.html
  11203. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-cubic-svg.html
  11204. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-spheres-svg.html
  11205. share/doc/qt5/qtsvg/qtsvg-svgviewer-main-cpp.html
  11206. share/doc/qt5/qtsvg/qtsvg-svgviewer-mainwindow-cpp.html
  11207. share/doc/qt5/qtsvg/qtsvg-svgviewer-mainwindow-h.html
  11208. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgview-cpp.html
  11209. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgview-h.html
  11210. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgviewer-pro.html
  11211. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgviewer-qrc.html
  11212. share/doc/qt5/qtsvg/qtsvg.index
  11213. share/doc/qt5/qtsvg/qtsvg.qhp
  11214. share/doc/qt5/qtsvg/qtsvg.qhp.sha1
  11215. share/doc/qt5/qtsvg/qtsvg.tags
  11216. share/doc/qt5/qtsvg/style/offline-simple.css
  11217. share/doc/qt5/qtsvg/style/offline.css
  11218. share/doc/qt5/qtsvg/svgrendering.html
  11219. share/doc/qt5/qttestlib.qch
  11220. share/doc/qt5/qttestlib/examples-manifest.xml
  11221. share/doc/qt5/qttestlib/images/arrow_bc.png
  11222. share/doc/qt5/qttestlib/images/bgrContent.png
  11223. share/doc/qt5/qttestlib/images/btn_next.png
  11224. share/doc/qt5/qttestlib/images/btn_prev.png
  11225. share/doc/qt5/qttestlib/images/bullet_dn.png
  11226. share/doc/qt5/qttestlib/images/bullet_sq.png
  11227. share/doc/qt5/qttestlib/images/home.png
  11228. share/doc/qt5/qttestlib/images/ico_note.png
  11229. share/doc/qt5/qttestlib/images/ico_note_attention.png
  11230. share/doc/qt5/qttestlib/images/ico_out.png
  11231. share/doc/qt5/qttestlib/images/logo.png
  11232. share/doc/qt5/qttestlib/qsignalspy-members.html
  11233. share/doc/qt5/qttestlib/qsignalspy.html
  11234. share/doc/qt5/qttestlib/qtest-obsolete.html
  11235. share/doc/qt5/qttestlib/qtest-overview.html
  11236. share/doc/qt5/qttestlib/qtest-qtoucheventsequence-members.html
  11237. share/doc/qt5/qttestlib/qtest-qtoucheventsequence.html
  11238. share/doc/qt5/qttestlib/qtest-tutorial.html
  11239. share/doc/qt5/qttestlib/qtest.html
  11240. share/doc/qt5/qttestlib/qtesteventlist-members.html
  11241. share/doc/qt5/qttestlib/qtesteventlist.html
  11242. share/doc/qt5/qttestlib/qttest-index.html
  11243. share/doc/qt5/qttestlib/qttest-module.html
  11244. share/doc/qt5/qttestlib/qttestlib-attribution-cycle.html
  11245. share/doc/qt5/qttestlib/qttestlib-attribution-linuxperf.html
  11246. share/doc/qt5/qttestlib/qttestlib-attribution-valgrind.html
  11247. share/doc/qt5/qttestlib/qttestlib-tutorial1-example.html
  11248. share/doc/qt5/qttestlib/qttestlib-tutorial1-testqstring-cpp.html
  11249. share/doc/qt5/qttestlib/qttestlib-tutorial1-tutorial1-pro.html
  11250. share/doc/qt5/qttestlib/qttestlib-tutorial2-example.html
  11251. share/doc/qt5/qttestlib/qttestlib-tutorial2-testqstring-cpp.html
  11252. share/doc/qt5/qttestlib/qttestlib-tutorial2-tutorial2-pro.html
  11253. share/doc/qt5/qttestlib/qttestlib-tutorial3-example.html
  11254. share/doc/qt5/qttestlib/qttestlib-tutorial3-testgui-cpp.html
  11255. share/doc/qt5/qttestlib/qttestlib-tutorial3-tutorial3-pro.html
  11256. share/doc/qt5/qttestlib/qttestlib-tutorial4-example.html
  11257. share/doc/qt5/qttestlib/qttestlib-tutorial4-testgui-cpp.html
  11258. share/doc/qt5/qttestlib/qttestlib-tutorial4-tutorial4-pro.html
  11259. share/doc/qt5/qttestlib/qttestlib-tutorial5-benchmarking-cpp.html
  11260. share/doc/qt5/qttestlib/qttestlib-tutorial5-example.html
  11261. share/doc/qt5/qttestlib/qttestlib-tutorial5-tutorial5-pro.html
  11262. share/doc/qt5/qttestlib/qttestlib.index
  11263. share/doc/qt5/qttestlib/qttestlib.qhp
  11264. share/doc/qt5/qttestlib/qttestlib.qhp.sha1
  11265. share/doc/qt5/qttestlib/qttestlib.tags
  11266. share/doc/qt5/qttestlib/style/offline-simple.css
  11267. share/doc/qt5/qttestlib/style/offline.css
  11268. share/doc/qt5/qtuitools.qch
  11269. share/doc/qt5/qtuitools/examples-manifest.xml
  11270. share/doc/qt5/qtuitools/examples-qtuitools.html
  11271. share/doc/qt5/qtuitools/images/arrow_bc.png
  11272. share/doc/qt5/qtuitools/images/bgrContent.png
  11273. share/doc/qt5/qtuitools/images/btn_next.png
  11274. share/doc/qt5/qtuitools/images/btn_prev.png
  11275. share/doc/qt5/qtuitools/images/bullet_dn.png
  11276. share/doc/qt5/qtuitools/images/bullet_sq.png
  11277. share/doc/qt5/qtuitools/images/home.png
  11278. share/doc/qt5/qtuitools/images/ico_note.png
  11279. share/doc/qt5/qtuitools/images/ico_note_attention.png
  11280. share/doc/qt5/qtuitools/images/ico_out.png
  11281. share/doc/qt5/qtuitools/images/logo.png
  11282. share/doc/qt5/qtuitools/images/multipleinheritance-example.png
  11283. share/doc/qt5/qtuitools/images/textfinder-example-find.png
  11284. share/doc/qt5/qtuitools/images/textfinder-example-find2.png
  11285. share/doc/qt5/qtuitools/images/textfinder-example-userinterface.png
  11286. share/doc/qt5/qtuitools/images/uitools-examples.png
  11287. share/doc/qt5/qtuitools/qtuitools-index.html
  11288. share/doc/qt5/qtuitools/qtuitools-module.html
  11289. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-cpp.html
  11290. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-h.html
  11291. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-ui.html
  11292. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-example.html
  11293. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-main-cpp.html
  11294. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-multipleinheritance-pro.html
  11295. share/doc/qt5/qtuitools/qtuitools-textfinder-example.html
  11296. share/doc/qt5/qtuitools/qtuitools-textfinder-forms-textfinder-ui.html
  11297. share/doc/qt5/qtuitools/qtuitools-textfinder-main-cpp.html
  11298. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-cpp.html
  11299. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-h.html
  11300. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-pro.html
  11301. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-qrc.html
  11302. share/doc/qt5/qtuitools/qtuitools.index
  11303. share/doc/qt5/qtuitools/qtuitools.qhp
  11304. share/doc/qt5/qtuitools/qtuitools.qhp.sha1
  11305. share/doc/qt5/qtuitools/quiloader-members.html
  11306. share/doc/qt5/qtuitools/quiloader.html
  11307. share/doc/qt5/qtuitools/style/offline-simple.css
  11308. share/doc/qt5/qtuitools/style/offline.css
  11309. share/doc/qt5/qtwaylandcompositor.qch
  11310. share/doc/qt5/qtwaylandcompositor/examples-manifest.xml
  11311. share/doc/qt5/qtwaylandcompositor/images/arrow_bc.png
  11312. share/doc/qt5/qtwaylandcompositor/images/bgrContent.png
  11313. share/doc/qt5/qtwaylandcompositor/images/btn_next.png
  11314. share/doc/qt5/qtwaylandcompositor/images/btn_prev.png
  11315. share/doc/qt5/qtwaylandcompositor/images/bullet_dn.png
  11316. share/doc/qt5/qtwaylandcompositor/images/bullet_sq.png
  11317. share/doc/qt5/qtwaylandcompositor/images/home.png
  11318. share/doc/qt5/qtwaylandcompositor/images/ico_note.png
  11319. share/doc/qt5/qtwaylandcompositor/images/ico_note_attention.png
  11320. share/doc/qt5/qtwaylandcompositor/images/ico_out.png
  11321. share/doc/qt5/qtwaylandcompositor/images/logo.png
  11322. share/doc/qt5/qtwaylandcompositor/images/used-in-examples/multi-output/images/background.jpg
  11323. share/doc/qt5/qtwaylandcompositor/images/used-in-examples/pure-qml/images/background.jpg
  11324. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-members.html
  11325. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication.html
  11326. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface-members.html
  11327. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface.html
  11328. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem-members.html
  11329. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem.html
  11330. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient-members.html
  11331. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient.html
  11332. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor-members.html
  11333. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor.html
  11334. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput-members.html
  11335. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput.html
  11336. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem-members.html
  11337. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem.html
  11338. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat-members.html
  11339. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat.html
  11340. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface-members.html
  11341. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface.html
  11342. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandview-members.html
  11343. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandview.html
  11344. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-members.html
  11345. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshell.html
  11346. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface-members.html
  11347. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface.html
  11348. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5-members.html
  11349. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5.html
  11350. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5-members.html
  11351. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5.html
  11352. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5-members.html
  11353. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5.html
  11354. share/doc/qt5/qtwaylandcompositor/qtwayland-compositor-qmlmodule.html
  11355. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-ivi-extension-protocol.html
  11356. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-protocol.html
  11357. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-txt-input-unstable.html
  11358. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-shell-protocol.html
  11359. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-examples.html
  11360. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-index.html
  11361. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-example.html
  11362. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-ivi-compositor-pro.html
  11363. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-ivi-compositor-qrc.html
  11364. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-main-cpp.html
  11365. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-main-qml.html
  11366. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-example.html
  11367. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-main-cpp.html
  11368. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-main-qml.html
  11369. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-minimal-qml-pro.html
  11370. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-minimal-qml-qrc.html
  11371. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-module.html
  11372. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-example.html
  11373. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-main-cpp.html
  11374. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-multi-output-pro.html
  11375. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-multi-output-qrc.html
  11376. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-gridscreen-qml.html
  11377. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-main-qml.html
  11378. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-shellchrome-qml.html
  11379. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-shellscreen-qml.html
  11380. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-example.html
  11381. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-main-cpp.html
  11382. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-multi-screen-pro.html
  11383. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-multi-screen-qrc.html
  11384. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-chrome-qml.html
  11385. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-main-qml.html
  11386. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-screen-qml.html
  11387. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-example.html
  11388. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-main-cpp.html
  11389. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-pure-qml-pro.html
  11390. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-pure-qml-qrc.html
  11391. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-chrome-qml.html
  11392. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-keyboard-qml.html
  11393. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-main-qml.html
  11394. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-screen-qml.html
  11395. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-compositor-cpp.html
  11396. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-compositor-h.html
  11397. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-example.html
  11398. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-main-cpp.html
  11399. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-qwindow-compositor-pro.html
  11400. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-qwindow-compositor-qrc.html
  11401. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-window-cpp.html
  11402. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-window-h.html
  11403. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-example.html
  11404. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-main-cpp.html
  11405. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-main-qml.html
  11406. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-spanning-screens-pro.html
  11407. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-spanning-screens-qrc.html
  11408. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.index
  11409. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.qhp
  11410. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.qhp.sha1
  11411. share/doc/qt5/qtwaylandcompositor/qwaylandbufferref-members.html
  11412. share/doc/qt5/qtwaylandcompositor/qwaylandbufferref.html
  11413. share/doc/qt5/qtwaylandcompositor/qwaylandclient-members.html
  11414. share/doc/qt5/qtwaylandcompositor/qwaylandclient.html
  11415. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor-members.html
  11416. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor.html
  11417. share/doc/qt5/qtwaylandcompositor/qwaylandiviapplication-members.html
  11418. share/doc/qt5/qtwaylandcompositor/qwaylandiviapplication.html
  11419. share/doc/qt5/qtwaylandcompositor/qwaylandivisurface-members.html
  11420. share/doc/qt5/qtwaylandcompositor/qwaylandivisurface.html
  11421. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard-members.html
  11422. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard.html
  11423. share/doc/qt5/qtwaylandcompositor/qwaylandoutput-members.html
  11424. share/doc/qt5/qtwaylandcompositor/qwaylandoutput.html
  11425. share/doc/qt5/qtwaylandcompositor/qwaylandoutputmode-members.html
  11426. share/doc/qt5/qtwaylandcompositor/qwaylandoutputmode.html
  11427. share/doc/qt5/qtwaylandcompositor/qwaylandpointer-members.html
  11428. share/doc/qt5/qtwaylandcompositor/qwaylandpointer.html
  11429. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem-members.html
  11430. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem.html
  11431. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem-members.html
  11432. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem.html
  11433. share/doc/qt5/qtwaylandcompositor/qwaylandseat-members.html
  11434. share/doc/qt5/qtwaylandcompositor/qwaylandseat.html
  11435. share/doc/qt5/qtwaylandcompositor/qwaylandsurface-members.html
  11436. share/doc/qt5/qtwaylandcompositor/qwaylandsurface.html
  11437. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber-members.html
  11438. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber.html
  11439. share/doc/qt5/qtwaylandcompositor/qwaylandtouch-members.html
  11440. share/doc/qt5/qtwaylandcompositor/qwaylandtouch.html
  11441. share/doc/qt5/qtwaylandcompositor/qwaylandview-members.html
  11442. share/doc/qt5/qtwaylandcompositor/qwaylandview.html
  11443. share/doc/qt5/qtwaylandcompositor/qwaylandwlshell-members.html
  11444. share/doc/qt5/qtwaylandcompositor/qwaylandwlshell.html
  11445. share/doc/qt5/qtwaylandcompositor/qwaylandwlshellsurface-members.html
  11446. share/doc/qt5/qtwaylandcompositor/qwaylandwlshellsurface.html
  11447. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv5-members.html
  11448. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv5.html
  11449. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv5-members.html
  11450. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv5.html
  11451. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev5-members.html
  11452. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev5.html
  11453. share/doc/qt5/qtwaylandcompositor/style/offline-simple.css
  11454. share/doc/qt5/qtwaylandcompositor/style/offline.css
  11455. share/doc/qt5/qtwebchannel.qch
  11456. share/doc/qt5/qtwebchannel/examples-manifest.xml
  11457. share/doc/qt5/qtwebchannel/images/arrow_bc.png
  11458. share/doc/qt5/qtwebchannel/images/bgrContent.png
  11459. share/doc/qt5/qtwebchannel/images/btn_next.png
  11460. share/doc/qt5/qtwebchannel/images/btn_prev.png
  11461. share/doc/qt5/qtwebchannel/images/bullet_dn.png
  11462. share/doc/qt5/qtwebchannel/images/bullet_sq.png
  11463. share/doc/qt5/qtwebchannel/images/chatclient-html.png
  11464. share/doc/qt5/qtwebchannel/images/chatclient-qml.png
  11465. share/doc/qt5/qtwebchannel/images/chatserver-cpp.png
  11466. share/doc/qt5/qtwebchannel/images/home.png
  11467. share/doc/qt5/qtwebchannel/images/ico_note.png
  11468. share/doc/qt5/qtwebchannel/images/ico_note_attention.png
  11469. share/doc/qt5/qtwebchannel/images/ico_out.png
  11470. share/doc/qt5/qtwebchannel/images/logo.png
  11471. share/doc/qt5/qtwebchannel/images/standalone-screenshot.png
  11472. share/doc/qt5/qtwebchannel/qml-qtwebchannel-webchannel-members.html
  11473. share/doc/qt5/qtwebchannel/qml-qtwebchannel-webchannel.html
  11474. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html-pro.html
  11475. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html.html
  11476. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-example.html
  11477. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-chatclient-qml-pro.html
  11478. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-example.html
  11479. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-loginform-ui-qml.html
  11480. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-mainform-ui-qml.html
  11481. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-qmlchatclient-qml.html
  11482. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp-pro.html
  11483. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp.html
  11484. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-h.html
  11485. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-example.html
  11486. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-main-cpp.html
  11487. share/doc/qt5/qtwebchannel/qtwebchannel-examples.html
  11488. share/doc/qt5/qtwebchannel/qtwebchannel-index.html
  11489. share/doc/qt5/qtwebchannel/qtwebchannel-javascript.html
  11490. share/doc/qt5/qtwebchannel/qtwebchannel-module.html
  11491. share/doc/qt5/qtwebchannel/qtwebchannel-qmlmodule.html
  11492. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-core-h.html
  11493. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-cpp.html
  11494. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-h.html
  11495. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-ui.html
  11496. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-example.html
  11497. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-index-html.html
  11498. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-main-cpp.html
  11499. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-standalone-pro.html
  11500. share/doc/qt5/qtwebchannel/qtwebchannel.index
  11501. share/doc/qt5/qtwebchannel/qtwebchannel.qhp
  11502. share/doc/qt5/qtwebchannel/qtwebchannel.qhp.sha1
  11503. share/doc/qt5/qtwebchannel/qtwebchannel.tags
  11504. share/doc/qt5/qtwebchannel/qwebchannel-members.html
  11505. share/doc/qt5/qtwebchannel/qwebchannel.html
  11506. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport-members.html
  11507. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport.html
  11508. share/doc/qt5/qtwebchannel/style/offline-simple.css
  11509. share/doc/qt5/qtwebchannel/style/offline.css
  11510. share/doc/qt5/qtwebsockets.qch
  11511. share/doc/qt5/qtwebsockets/echoclient.html
  11512. share/doc/qt5/qtwebsockets/echoserver.html
  11513. share/doc/qt5/qtwebsockets/examples-manifest.xml
  11514. share/doc/qt5/qtwebsockets/images/arrow_bc.png
  11515. share/doc/qt5/qtwebsockets/images/bgrContent.png
  11516. share/doc/qt5/qtwebsockets/images/btn_next.png
  11517. share/doc/qt5/qtwebsockets/images/btn_prev.png
  11518. share/doc/qt5/qtwebsockets/images/bullet_dn.png
  11519. share/doc/qt5/qtwebsockets/images/bullet_sq.png
  11520. share/doc/qt5/qtwebsockets/images/echoclient-html-example.png
  11521. share/doc/qt5/qtwebsockets/images/home.png
  11522. share/doc/qt5/qtwebsockets/images/ico_note.png
  11523. share/doc/qt5/qtwebsockets/images/ico_note_attention.png
  11524. share/doc/qt5/qtwebsockets/images/ico_out.png
  11525. share/doc/qt5/qtwebsockets/images/logo.png
  11526. share/doc/qt5/qtwebsockets/images/websockets-pictorial-representation.jpg
  11527. share/doc/qt5/qtwebsockets/qmaskgenerator-members.html
  11528. share/doc/qt5/qtwebsockets/qmaskgenerator.html
  11529. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocket-members.html
  11530. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocket.html
  11531. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocketserver-members.html
  11532. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocketserver.html
  11533. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-cpp.html
  11534. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-h.html
  11535. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-pro.html
  11536. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-example.html
  11537. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-main-cpp.html
  11538. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoclient-html.html
  11539. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-cpp.html
  11540. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-h.html
  11541. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-pro.html
  11542. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-example.html
  11543. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-main-cpp.html
  11544. share/doc/qt5/qtwebsockets/qtwebsockets-examples.html
  11545. share/doc/qt5/qtwebsockets/qtwebsockets-index.html
  11546. share/doc/qt5/qtwebsockets/qtwebsockets-module.html
  11547. share/doc/qt5/qtwebsockets/qtwebsockets-qmlmodule.html
  11548. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-data-qrc.html
  11549. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-example.html
  11550. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-main-cpp.html
  11551. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-qml-qmlwebsocketclient-main-qml.html
  11552. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-qmlwebsocketclient-pro.html
  11553. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-data-qrc.html
  11554. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-example.html
  11555. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-main-cpp.html
  11556. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-qml-qmlwebsocketserver-main-qml.html
  11557. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-qmlwebsocketserver-pro.html
  11558. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatclient-html.html
  11559. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatserver-cpp.html
  11560. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatserver-h.html
  11561. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-example.html
  11562. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-main-cpp.html
  11563. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-simplechat-pro.html
  11564. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-example.html
  11565. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-main-cpp.html
  11566. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-cpp.html
  11567. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-h.html
  11568. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-pro.html
  11569. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-example.html
  11570. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-main-cpp.html
  11571. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-securesocketclient-qrc.html
  11572. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoclient-html.html
  11573. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-cpp.html
  11574. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-h.html
  11575. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-pro.html
  11576. share/doc/qt5/qtwebsockets/qtwebsockets-testing.html
  11577. share/doc/qt5/qtwebsockets/qtwebsockets.index
  11578. share/doc/qt5/qtwebsockets/qtwebsockets.qhp
  11579. share/doc/qt5/qtwebsockets/qtwebsockets.qhp.sha1
  11580. share/doc/qt5/qtwebsockets/qtwebsockets.tags
  11581. share/doc/qt5/qtwebsockets/qwebsocket-members.html
  11582. share/doc/qt5/qtwebsockets/qwebsocket.html
  11583. share/doc/qt5/qtwebsockets/qwebsocketcorsauthenticator-members.html
  11584. share/doc/qt5/qtwebsockets/qwebsocketcorsauthenticator.html
  11585. share/doc/qt5/qtwebsockets/qwebsocketprotocol.html
  11586. share/doc/qt5/qtwebsockets/qwebsocketserver-members.html
  11587. share/doc/qt5/qtwebsockets/qwebsocketserver.html
  11588. share/doc/qt5/qtwebsockets/style/offline-simple.css
  11589. share/doc/qt5/qtwebsockets/style/offline.css
  11590. share/doc/qt5/qtwebsockets/websockets-overview.html
  11591. share/doc/qt5/qtwebview.qch
  11592. share/doc/qt5/qtwebview/examples-manifest.xml
  11593. share/doc/qt5/qtwebview/images/arrow_bc.png
  11594. share/doc/qt5/qtwebview/images/bgrContent.png
  11595. share/doc/qt5/qtwebview/images/btn_next.png
  11596. share/doc/qt5/qtwebview/images/btn_prev.png
  11597. share/doc/qt5/qtwebview/images/bullet_dn.png
  11598. share/doc/qt5/qtwebview/images/bullet_sq.png
  11599. share/doc/qt5/qtwebview/images/home.png
  11600. share/doc/qt5/qtwebview/images/ico_note.png
  11601. share/doc/qt5/qtwebview/images/ico_note_attention.png
  11602. share/doc/qt5/qtwebview/images/ico_out.png
  11603. share/doc/qt5/qtwebview/images/logo.png
  11604. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/left-32.png
  11605. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/refresh-32.png
  11606. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/right-32.png
  11607. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/stop-32.png
  11608. share/doc/qt5/qtwebview/images/webview-example.jpg
  11609. share/doc/qt5/qtwebview/qml-qtwebview-webview-members.html
  11610. share/doc/qt5/qtwebview/qml-qtwebview-webview.html
  11611. share/doc/qt5/qtwebview/qml-qtwebview-webviewloadrequest-members.html
  11612. share/doc/qt5/qtwebview/qml-qtwebview-webviewloadrequest.html
  11613. share/doc/qt5/qtwebview/qtwebview-examples.html
  11614. share/doc/qt5/qtwebview/qtwebview-index.html
  11615. share/doc/qt5/qtwebview/qtwebview-minibrowser-android-loadprogressstyle-qml.html
  11616. share/doc/qt5/qtwebview/qtwebview-minibrowser-example.html
  11617. share/doc/qt5/qtwebview/qtwebview-minibrowser-loadprogressstyle-qml.html
  11618. share/doc/qt5/qtwebview/qtwebview-minibrowser-main-cpp.html
  11619. share/doc/qt5/qtwebview/qtwebview-minibrowser-main-qml.html
  11620. share/doc/qt5/qtwebview/qtwebview-minibrowser-minibrowser-pro.html
  11621. share/doc/qt5/qtwebview/qtwebview-minibrowser-qml-qrc.html
  11622. share/doc/qt5/qtwebview/qtwebview-module.html
  11623. share/doc/qt5/qtwebview/qtwebview-qmlmodule.html
  11624. share/doc/qt5/qtwebview/qtwebview.html
  11625. share/doc/qt5/qtwebview/qtwebview.index
  11626. share/doc/qt5/qtwebview/qtwebview.qhp
  11627. share/doc/qt5/qtwebview/qtwebview.qhp.sha1
  11628. share/doc/qt5/qtwebview/style/offline-simple.css
  11629. share/doc/qt5/qtwebview/style/offline.css
  11630. share/doc/qt5/qtwidgets.qch
  11631. share/doc/qt5/qtwidgets/application-windows.html
  11632. share/doc/qt5/qtwidgets/dialogs.html
  11633. share/doc/qt5/qtwidgets/examples-desktop.html
  11634. share/doc/qt5/qtwidgets/examples-dialogs.html
  11635. share/doc/qt5/qtwidgets/examples-graphicsview.html
  11636. share/doc/qt5/qtwidgets/examples-itemviews.html
  11637. share/doc/qt5/qtwidgets/examples-mainwindow.html
  11638. share/doc/qt5/qtwidgets/examples-manifest.xml
  11639. share/doc/qt5/qtwidgets/examples-painting.html
  11640. share/doc/qt5/qtwidgets/examples-richtext.html
  11641. share/doc/qt5/qtwidgets/examples-widgets.html
  11642. share/doc/qt5/qtwidgets/focus.html
  11643. share/doc/qt5/qtwidgets/gallery.html
  11644. share/doc/qt5/qtwidgets/gestures-overview.html
  11645. share/doc/qt5/qtwidgets/graphicsview.html
  11646. share/doc/qt5/qtwidgets/guibooks.html
  11647. share/doc/qt5/qtwidgets/images/addressbook-adddialog.png
  11648. share/doc/qt5/qtwidgets/images/addressbook-classes.png
  11649. share/doc/qt5/qtwidgets/images/addressbook-editdialog.png
  11650. share/doc/qt5/qtwidgets/images/addressbook-example.png
  11651. share/doc/qt5/qtwidgets/images/addressbook-filemenu.png
  11652. share/doc/qt5/qtwidgets/images/addressbook-newaddresstab.png
  11653. share/doc/qt5/qtwidgets/images/addressbook-signals.png
  11654. share/doc/qt5/qtwidgets/images/addressbook-toolsmenu.png
  11655. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-labeled-layout.png
  11656. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-labeled-screenshot.png
  11657. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-screenshot.png
  11658. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-contact.png
  11659. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-flowchart.png
  11660. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-successful.png
  11661. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-labeled-layout.png
  11662. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-signals-and-slots.png
  11663. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-stretch-effects.png
  11664. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-labeled-layout.png
  11665. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-linkedlist.png
  11666. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-screenshot.png
  11667. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part4-remove.png
  11668. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-finddialog.png
  11669. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-notfound.png
  11670. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-screenshot.png
  11671. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-signals-and-slots.png
  11672. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-load.png
  11673. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-save.png
  11674. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-screenshot.png
  11675. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part7-screenshot.png
  11676. share/doc/qt5/qtwidgets/images/addressbook-tutorial-screenshot.png
  11677. share/doc/qt5/qtwidgets/images/affine-demo.png
  11678. share/doc/qt5/qtwidgets/images/analogclock-example.png
  11679. share/doc/qt5/qtwidgets/images/analogclock-viewport.png
  11680. share/doc/qt5/qtwidgets/images/animatedtiles-example.png
  11681. share/doc/qt5/qtwidgets/images/application-menus.png
  11682. share/doc/qt5/qtwidgets/images/application.png
  11683. share/doc/qt5/qtwidgets/images/arrow_bc.png
  11684. share/doc/qt5/qtwidgets/images/assistant-toolbar.png
  11685. share/doc/qt5/qtwidgets/images/basicdrawing-example.png
  11686. share/doc/qt5/qtwidgets/images/basicgraphicslayouts-example.png
  11687. share/doc/qt5/qtwidgets/images/basiclayouts-example.png
  11688. share/doc/qt5/qtwidgets/images/basicsortfiltermodel-example.png
  11689. share/doc/qt5/qtwidgets/images/bgrContent.png
  11690. share/doc/qt5/qtwidgets/images/blurpickereffect-example.png
  11691. share/doc/qt5/qtwidgets/images/borderlayout-example.png
  11692. share/doc/qt5/qtwidgets/images/boxes-demo.png
  11693. share/doc/qt5/qtwidgets/images/branchindicatorimage.png
  11694. share/doc/qt5/qtwidgets/images/btn_next.png
  11695. share/doc/qt5/qtwidgets/images/btn_prev.png
  11696. share/doc/qt5/qtwidgets/images/bullet_dn.png
  11697. share/doc/qt5/qtwidgets/images/bullet_sq.png
  11698. share/doc/qt5/qtwidgets/images/button.png
  11699. share/doc/qt5/qtwidgets/images/buttonbox-gnomelayout-horizontal.png
  11700. share/doc/qt5/qtwidgets/images/buttonbox-gnomelayout-vertical.png
  11701. share/doc/qt5/qtwidgets/images/buttonbox-kdelayout-horizontal.png
  11702. share/doc/qt5/qtwidgets/images/buttonbox-kdelayout-vertical.png
  11703. share/doc/qt5/qtwidgets/images/buttonbox-mac-modeless-horizontal.png
  11704. share/doc/qt5/qtwidgets/images/buttonbox-mac-modeless-vertical.png
  11705. share/doc/qt5/qtwidgets/images/buttonbox-maclayout-horizontal.png
  11706. share/doc/qt5/qtwidgets/images/buttonbox-maclayout-vertical.png
  11707. share/doc/qt5/qtwidgets/images/buttonbox-winlayout-horizontal.png
  11708. share/doc/qt5/qtwidgets/images/buttonbox-winlayout-vertical.png
  11709. share/doc/qt5/qtwidgets/images/calculator-example.png
  11710. share/doc/qt5/qtwidgets/images/calculator-ugly.png
  11711. share/doc/qt5/qtwidgets/images/calendar-example.png
  11712. share/doc/qt5/qtwidgets/images/calendarwidgetexample.png
  11713. share/doc/qt5/qtwidgets/images/charactermap-example.png
  11714. share/doc/qt5/qtwidgets/images/chart-example.png
  11715. share/doc/qt5/qtwidgets/images/checkbox.png
  11716. share/doc/qt5/qtwidgets/images/checkboxes-exclusive.png
  11717. share/doc/qt5/qtwidgets/images/checkboxes-non-exclusive.png
  11718. share/doc/qt5/qtwidgets/images/checkboxexample.png
  11719. share/doc/qt5/qtwidgets/images/chip-demo.png
  11720. share/doc/qt5/qtwidgets/images/classwizard-flow.png
  11721. share/doc/qt5/qtwidgets/images/classwizard.png
  11722. share/doc/qt5/qtwidgets/images/clock.png
  11723. share/doc/qt5/qtwidgets/images/codecs-example.png
  11724. share/doc/qt5/qtwidgets/images/codeeditor-example.png
  11725. share/doc/qt5/qtwidgets/images/collidingmice-example.png
  11726. share/doc/qt5/qtwidgets/images/coloreditorfactoryimage.png
  11727. share/doc/qt5/qtwidgets/images/columnview.png
  11728. share/doc/qt5/qtwidgets/images/combobox.png
  11729. share/doc/qt5/qtwidgets/images/comboboximage.png
  11730. share/doc/qt5/qtwidgets/images/combowidgetmapper-example.png
  11731. share/doc/qt5/qtwidgets/images/completer-example-country.png
  11732. share/doc/qt5/qtwidgets/images/completer-example-dirmodel.png
  11733. share/doc/qt5/qtwidgets/images/completer-example-qdirmodel.png
  11734. share/doc/qt5/qtwidgets/images/completer-example-word.png
  11735. share/doc/qt5/qtwidgets/images/completer-example.png
  11736. share/doc/qt5/qtwidgets/images/composition-demo.png
  11737. share/doc/qt5/qtwidgets/images/concentriccircles-example.png
  11738. share/doc/qt5/qtwidgets/images/conceptualpushbuttontree.png
  11739. share/doc/qt5/qtwidgets/images/customcompleter-example.png
  11740. share/doc/qt5/qtwidgets/images/customcompleter-insertcompletion.png
  11741. share/doc/qt5/qtwidgets/images/customsortfiltermodel-example.png
  11742. share/doc/qt5/qtwidgets/images/deform-demo.png
  11743. share/doc/qt5/qtwidgets/images/designer-stylesheet-options.png
  11744. share/doc/qt5/qtwidgets/images/designer-stylesheet-usage.png
  11745. share/doc/qt5/qtwidgets/images/designer-validator-highlighter.png
  11746. share/doc/qt5/qtwidgets/images/desktop-examples.png
  11747. share/doc/qt5/qtwidgets/images/diagramscene.png
  11748. share/doc/qt5/qtwidgets/images/dialog-examples.png
  11749. share/doc/qt5/qtwidgets/images/digitalclock-example.png
  11750. share/doc/qt5/qtwidgets/images/dirview-example.png
  11751. share/doc/qt5/qtwidgets/images/dockwidget.png
  11752. share/doc/qt5/qtwidgets/images/dockwidgetimage.png
  11753. share/doc/qt5/qtwidgets/images/dockwidgets-example.png
  11754. share/doc/qt5/qtwidgets/images/draganddroppuzzle-example.png
  11755. share/doc/qt5/qtwidgets/images/dragdroprobot-example.png
  11756. share/doc/qt5/qtwidgets/images/draggableicons-example.png
  11757. share/doc/qt5/qtwidgets/images/draggabletext-example.png
  11758. share/doc/qt5/qtwidgets/images/dropsite-example.png
  11759. share/doc/qt5/qtwidgets/images/dummy_tree.png
  11760. share/doc/qt5/qtwidgets/images/easing-example.png
  11761. share/doc/qt5/qtwidgets/images/echopluginexample.png
  11762. share/doc/qt5/qtwidgets/images/elasticnodes-example.png
  11763. share/doc/qt5/qtwidgets/images/elidedlabel-example.png
  11764. share/doc/qt5/qtwidgets/images/embeddeddialogs-demo.png
  11765. share/doc/qt5/qtwidgets/images/example_model.png
  11766. share/doc/qt5/qtwidgets/images/extension-example.png
  11767. share/doc/qt5/qtwidgets/images/extension_more.png
  11768. share/doc/qt5/qtwidgets/images/factorial-example.png
  11769. share/doc/qt5/qtwidgets/images/fademessageeffect-example-faded.png
  11770. share/doc/qt5/qtwidgets/images/fademessageeffect-example.png
  11771. share/doc/qt5/qtwidgets/images/fetchmore-example.png
  11772. share/doc/qt5/qtwidgets/images/filedialogurls.png
  11773. share/doc/qt5/qtwidgets/images/findfiles-example.png
  11774. share/doc/qt5/qtwidgets/images/findfiles_progress_dialog.png
  11775. share/doc/qt5/qtwidgets/images/flowlayout-example.png
  11776. share/doc/qt5/qtwidgets/images/fontsampler-example.png
  11777. share/doc/qt5/qtwidgets/images/frames.png
  11778. share/doc/qt5/qtwidgets/images/fridgemagnets-example.png
  11779. share/doc/qt5/qtwidgets/images/frozencolumn-example.png
  11780. share/doc/qt5/qtwidgets/images/frozencolumn-tableview.png
  11781. share/doc/qt5/qtwidgets/images/fusion-calendarwidget.png
  11782. share/doc/qt5/qtwidgets/images/fusion-colordialog.png
  11783. share/doc/qt5/qtwidgets/images/fusion-combobox.png
  11784. share/doc/qt5/qtwidgets/images/fusion-fontdialog.png
  11785. share/doc/qt5/qtwidgets/images/fusion-label.png
  11786. share/doc/qt5/qtwidgets/images/fusion-menu.png
  11787. share/doc/qt5/qtwidgets/images/fusion-progressdialog.png
  11788. share/doc/qt5/qtwidgets/images/fusion-pushbutton-menu.png
  11789. share/doc/qt5/qtwidgets/images/fusion-statusbar-sizegrip.png
  11790. share/doc/qt5/qtwidgets/images/fusion-style.png
  11791. share/doc/qt5/qtwidgets/images/fusion-tabbar-truncated.png
  11792. share/doc/qt5/qtwidgets/images/fusion-tabbar.png
  11793. share/doc/qt5/qtwidgets/images/fusion-tabwidget.png
  11794. share/doc/qt5/qtwidgets/images/geometry.png
  11795. share/doc/qt5/qtwidgets/images/gradients-demo.png
  11796. share/doc/qt5/qtwidgets/images/graphicsanchorlayout-example.png
  11797. share/doc/qt5/qtwidgets/images/graphicseffect-blur.png
  11798. share/doc/qt5/qtwidgets/images/graphicseffect-colorize.png
  11799. share/doc/qt5/qtwidgets/images/graphicseffect-drop-shadow.png
  11800. share/doc/qt5/qtwidgets/images/graphicseffect-opacity.png
  11801. share/doc/qt5/qtwidgets/images/graphicseffect-plain.png
  11802. share/doc/qt5/qtwidgets/images/graphicseffect-widget.png
  11803. share/doc/qt5/qtwidgets/images/graphicsflowlayout-example.png
  11804. share/doc/qt5/qtwidgets/images/graphicssimpleanchorlayout-example.png
  11805. share/doc/qt5/qtwidgets/images/graphicsview-ellipseitem-pie.png
  11806. share/doc/qt5/qtwidgets/images/graphicsview-ellipseitem.png
  11807. share/doc/qt5/qtwidgets/images/graphicsview-examples.png
  11808. share/doc/qt5/qtwidgets/images/graphicsview-items.png
  11809. share/doc/qt5/qtwidgets/images/graphicsview-lineitem.png
  11810. share/doc/qt5/qtwidgets/images/graphicsview-parentchild.png
  11811. share/doc/qt5/qtwidgets/images/graphicsview-pathitem.png
  11812. share/doc/qt5/qtwidgets/images/graphicsview-pixmapitem.png
  11813. share/doc/qt5/qtwidgets/images/graphicsview-polygonitem.png
  11814. share/doc/qt5/qtwidgets/images/graphicsview-rectitem.png
  11815. share/doc/qt5/qtwidgets/images/graphicsview-simpletextitem.png
  11816. share/doc/qt5/qtwidgets/images/graphicsview-textitem.png
  11817. share/doc/qt5/qtwidgets/images/graphicsview-view.png
  11818. share/doc/qt5/qtwidgets/images/graphicsview-zorder.png
  11819. share/doc/qt5/qtwidgets/images/gridlayout.png
  11820. share/doc/qt5/qtwidgets/images/groupbox-example.png
  11821. share/doc/qt5/qtwidgets/images/groupbox.png
  11822. share/doc/qt5/qtwidgets/images/groupboximage.png
  11823. share/doc/qt5/qtwidgets/images/header.png
  11824. share/doc/qt5/qtwidgets/images/headerimage.png
  11825. share/doc/qt5/qtwidgets/images/home.png
  11826. share/doc/qt5/qtwidgets/images/i18n-example.png
  11827. share/doc/qt5/qtwidgets/images/ico_note.png
  11828. share/doc/qt5/qtwidgets/images/ico_note_attention.png
  11829. share/doc/qt5/qtwidgets/images/ico_out.png
  11830. share/doc/qt5/qtwidgets/images/icons-example.png
  11831. share/doc/qt5/qtwidgets/images/icons-view-menu.png
  11832. share/doc/qt5/qtwidgets/images/icons_find_normal.png
  11833. share/doc/qt5/qtwidgets/images/icons_find_normal_disabled.png
  11834. share/doc/qt5/qtwidgets/images/icons_images_groupbox.png
  11835. share/doc/qt5/qtwidgets/images/icons_monkey.png
  11836. share/doc/qt5/qtwidgets/images/icons_monkey_active.png
  11837. share/doc/qt5/qtwidgets/images/icons_monkey_mess.png
  11838. share/doc/qt5/qtwidgets/images/icons_preview_area.png
  11839. share/doc/qt5/qtwidgets/images/icons_qt_extended_16x16.png
  11840. share/doc/qt5/qtwidgets/images/icons_qt_extended_17x17.png
  11841. share/doc/qt5/qtwidgets/images/icons_qt_extended_32x32.png
  11842. share/doc/qt5/qtwidgets/images/icons_qt_extended_33x33.png
  11843. share/doc/qt5/qtwidgets/images/icons_qt_extended_48x48.png
  11844. share/doc/qt5/qtwidgets/images/icons_qt_extended_64x64.png
  11845. share/doc/qt5/qtwidgets/images/icons_qt_extended_8x8.png
  11846. share/doc/qt5/qtwidgets/images/icons_size_groupbox.png
  11847. share/doc/qt5/qtwidgets/images/icons_size_spinbox.png
  11848. share/doc/qt5/qtwidgets/images/imagecomposition-example.png
  11849. share/doc/qt5/qtwidgets/images/imagegestures-example.jpg
  11850. share/doc/qt5/qtwidgets/images/imageviewer-example.png
  11851. share/doc/qt5/qtwidgets/images/imageviewer-fit_to_window_1.png
  11852. share/doc/qt5/qtwidgets/images/imageviewer-fit_to_window_2.png
  11853. share/doc/qt5/qtwidgets/images/imageviewer-original_size.png
  11854. share/doc/qt5/qtwidgets/images/imageviewer-zoom_in_1.png
  11855. share/doc/qt5/qtwidgets/images/imageviewer-zoom_in_2.png
  11856. share/doc/qt5/qtwidgets/images/inputdialogs.png
  11857. share/doc/qt5/qtwidgets/images/interview-demo.png
  11858. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-indexes.png
  11859. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-items.png
  11860. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-model.png
  11861. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-values.png
  11862. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel.png
  11863. share/doc/qt5/qtwidgets/images/itemviews-examples.png
  11864. share/doc/qt5/qtwidgets/images/itemviewspuzzle-example.png
  11865. share/doc/qt5/qtwidgets/images/layout1.png
  11866. share/doc/qt5/qtwidgets/images/layout2.png
  11867. share/doc/qt5/qtwidgets/images/licensewizard-example.png
  11868. share/doc/qt5/qtwidgets/images/licensewizard-flow.png
  11869. share/doc/qt5/qtwidgets/images/lineedits-example.png
  11870. share/doc/qt5/qtwidgets/images/list_table_tree.png
  11871. share/doc/qt5/qtwidgets/images/listview.png
  11872. share/doc/qt5/qtwidgets/images/logo.png
  11873. share/doc/qt5/qtwidgets/images/macos-lineedit.png
  11874. share/doc/qt5/qtwidgets/images/macos-progressbar.png
  11875. share/doc/qt5/qtwidgets/images/macos-style.png
  11876. share/doc/qt5/qtwidgets/images/macos-style2.png
  11877. share/doc/qt5/qtwidgets/images/macos-tabwidget.png
  11878. share/doc/qt5/qtwidgets/images/mainwindow-demo.png
  11879. share/doc/qt5/qtwidgets/images/mainwindow-docks-example.png
  11880. share/doc/qt5/qtwidgets/images/mainwindow-docks.png
  11881. share/doc/qt5/qtwidgets/images/mainwindow-examples.png
  11882. share/doc/qt5/qtwidgets/images/mainwindowlayout.png
  11883. share/doc/qt5/qtwidgets/images/mdi-cascade.png
  11884. share/doc/qt5/qtwidgets/images/mdi-example.png
  11885. share/doc/qt5/qtwidgets/images/mdi-tile.png
  11886. share/doc/qt5/qtwidgets/images/menu.png
  11887. share/doc/qt5/qtwidgets/images/menubar.png
  11888. share/doc/qt5/qtwidgets/images/menubarimage.png
  11889. share/doc/qt5/qtwidgets/images/menuimage.png
  11890. share/doc/qt5/qtwidgets/images/menus-example.png
  11891. share/doc/qt5/qtwidgets/images/modelview-combobox.png
  11892. share/doc/qt5/qtwidgets/images/modelview-header.png
  11893. share/doc/qt5/qtwidgets/images/modelview-models.png
  11894. share/doc/qt5/qtwidgets/images/modelview-overview.png
  11895. share/doc/qt5/qtwidgets/images/modelview-roles.png
  11896. share/doc/qt5/qtwidgets/images/modelview-tablemodel.png
  11897. share/doc/qt5/qtwidgets/images/modelview-treemodel.png
  11898. share/doc/qt5/qtwidgets/images/modelview.png
  11899. share/doc/qt5/qtwidgets/images/mousebutton-buttontester.png
  11900. share/doc/qt5/qtwidgets/images/move-blocks-chart.png
  11901. share/doc/qt5/qtwidgets/images/moveblocks-example.png
  11902. share/doc/qt5/qtwidgets/images/movie-example.png
  11903. share/doc/qt5/qtwidgets/images/msgbox1.png
  11904. share/doc/qt5/qtwidgets/images/msgbox2.png
  11905. share/doc/qt5/qtwidgets/images/msgbox3.png
  11906. share/doc/qt5/qtwidgets/images/msgbox4.png
  11907. share/doc/qt5/qtwidgets/images/orderform-example-detailsdialog.png
  11908. share/doc/qt5/qtwidgets/images/orderform-example.png
  11909. share/doc/qt5/qtwidgets/images/padnavigator-example.png
  11910. share/doc/qt5/qtwidgets/images/painterpaths-example.png
  11911. share/doc/qt5/qtwidgets/images/painting-examples.png
  11912. share/doc/qt5/qtwidgets/images/paintsystem-icon.png
  11913. share/doc/qt5/qtwidgets/images/paintsystem-stylepainter.png
  11914. share/doc/qt5/qtwidgets/images/pangesture.png
  11915. share/doc/qt5/qtwidgets/images/parent-child-widgets.png
  11916. share/doc/qt5/qtwidgets/images/pathstroke-demo.png
  11917. share/doc/qt5/qtwidgets/images/pinchgesture.png
  11918. share/doc/qt5/qtwidgets/images/pingpong-example.png
  11919. share/doc/qt5/qtwidgets/images/pixelator-example.png
  11920. share/doc/qt5/qtwidgets/images/plugandpaint-plugindialog.png
  11921. share/doc/qt5/qtwidgets/images/plugandpaint.png
  11922. share/doc/qt5/qtwidgets/images/progressBar-stylesheet.png
  11923. share/doc/qt5/qtwidgets/images/progressBar2-stylesheet.png
  11924. share/doc/qt5/qtwidgets/images/progressbar.png
  11925. share/doc/qt5/qtwidgets/images/progressbarimage.png
  11926. share/doc/qt5/qtwidgets/images/propagation-custom.png
  11927. share/doc/qt5/qtwidgets/images/propagation-standard.png
  11928. share/doc/qt5/qtwidgets/images/pushbutton.png
  11929. share/doc/qt5/qtwidgets/images/qactiongroup-align.png
  11930. share/doc/qt5/qtwidgets/images/qcalendarwidget-grid.png
  11931. share/doc/qt5/qtwidgets/images/qcalendarwidget-maximum.png
  11932. share/doc/qt5/qtwidgets/images/qcalendarwidget-minimum.png
  11933. share/doc/qt5/qtwidgets/images/qcolumnview.png
  11934. share/doc/qt5/qtwidgets/images/qcompleter.png
  11935. share/doc/qt5/qtwidgets/images/qdesktopwidget.png
  11936. share/doc/qt5/qtwidgets/images/qerrormessage.png
  11937. share/doc/qt5/qtwidgets/images/qformlayout-kde.png
  11938. share/doc/qt5/qtwidgets/images/qformlayout-mac.png
  11939. share/doc/qt5/qtwidgets/images/qformlayout-qpe.png
  11940. share/doc/qt5/qtwidgets/images/qformlayout-win.png
  11941. share/doc/qt5/qtwidgets/images/qformlayout-with-6-children.png
  11942. share/doc/qt5/qtwidgets/images/qgraphicsproxywidget-embed.png
  11943. share/doc/qt5/qtwidgets/images/qgridlayout-with-5-children.png
  11944. share/doc/qt5/qtwidgets/images/qhboxlayout-with-5-children.png
  11945. share/doc/qt5/qtwidgets/images/qmdisubwindowlayout.png
  11946. share/doc/qt5/qtwidgets/images/qmessagebox-crit.png
  11947. share/doc/qt5/qtwidgets/images/qmessagebox-info.png
  11948. share/doc/qt5/qtwidgets/images/qmessagebox-quest.png
  11949. share/doc/qt5/qtwidgets/images/qmessagebox-warn.png
  11950. share/doc/qt5/qtwidgets/images/qscrollarea-noscrollbars.png
  11951. share/doc/qt5/qtwidgets/images/qscrollarea-onescrollbar.png
  11952. share/doc/qt5/qtwidgets/images/qscrollarea-twoscrollbars.png
  11953. share/doc/qt5/qtwidgets/images/qscrollbar-picture.png
  11954. share/doc/qt5/qtwidgets/images/qscrollbar-values.png
  11955. share/doc/qt5/qtwidgets/images/qspinbox-plusminus.png
  11956. share/doc/qt5/qtwidgets/images/qspinbox-updown.png
  11957. share/doc/qt5/qtwidgets/images/qstyle-comboboxes.png
  11958. share/doc/qt5/qtwidgets/images/qstyleoptiontoolbar-position.png
  11959. share/doc/qt5/qtwidgets/images/qtableview-resized.png
  11960. share/doc/qt5/qtwidgets/images/qtwizard-aero1.png
  11961. share/doc/qt5/qtwidgets/images/qtwizard-aero2.png
  11962. share/doc/qt5/qtwidgets/images/qtwizard-classic1.png
  11963. share/doc/qt5/qtwidgets/images/qtwizard-classic2.png
  11964. share/doc/qt5/qtwidgets/images/qtwizard-mac1.png
  11965. share/doc/qt5/qtwidgets/images/qtwizard-mac2.png
  11966. share/doc/qt5/qtwidgets/images/qtwizard-macpage.png
  11967. share/doc/qt5/qtwidgets/images/qtwizard-modern1.png
  11968. share/doc/qt5/qtwidgets/images/qtwizard-modern2.png
  11969. share/doc/qt5/qtwidgets/images/qtwizard-nonmacpage.png
  11970. share/doc/qt5/qtwidgets/images/qundoview.png
  11971. share/doc/qt5/qtwidgets/images/qvboxlayout-with-5-children.png
  11972. share/doc/qt5/qtwidgets/images/readonlytable_role.png
  11973. share/doc/qt5/qtwidgets/images/regexp-example.png
  11974. share/doc/qt5/qtwidgets/images/regularexpression-example.png
  11975. share/doc/qt5/qtwidgets/images/richtext-examples.png
  11976. share/doc/qt5/qtwidgets/images/rogue-example.png
  11977. share/doc/qt5/qtwidgets/images/rogue-statechart.png
  11978. share/doc/qt5/qtwidgets/images/rubberband.png
  11979. share/doc/qt5/qtwidgets/images/rubberbandimage.png
  11980. share/doc/qt5/qtwidgets/images/screenshot-example.png
  11981. share/doc/qt5/qtwidgets/images/scribble-example.png
  11982. share/doc/qt5/qtwidgets/images/scrollbar.png
  11983. share/doc/qt5/qtwidgets/images/scrollbarimage.png
  11984. share/doc/qt5/qtwidgets/images/sdi-example.png
  11985. share/doc/qt5/qtwidgets/images/selected-items1.png
  11986. share/doc/qt5/qtwidgets/images/selected-items2.png
  11987. share/doc/qt5/qtwidgets/images/selected-items3.png
  11988. share/doc/qt5/qtwidgets/images/selection-extended.png
  11989. share/doc/qt5/qtwidgets/images/selection-multi.png
  11990. share/doc/qt5/qtwidgets/images/selection-single.png
  11991. share/doc/qt5/qtwidgets/images/selection2.png
  11992. share/doc/qt5/qtwidgets/images/settingseditor-example.png
  11993. share/doc/qt5/qtwidgets/images/shapedclock-dragging.png
  11994. share/doc/qt5/qtwidgets/images/shapedclock-example.png
  11995. share/doc/qt5/qtwidgets/images/shareddirmodel.png
  11996. share/doc/qt5/qtwidgets/images/sharedmodel-tableviews.png
  11997. share/doc/qt5/qtwidgets/images/sharedselection-tableviews.png
  11998. share/doc/qt5/qtwidgets/images/signals-n-slots-aw-nat.png
  11999. share/doc/qt5/qtwidgets/images/simpleanchorlayout-example.png
  12000. share/doc/qt5/qtwidgets/images/simpledommodel-example.png
  12001. share/doc/qt5/qtwidgets/images/simpletreemodel-example.png
  12002. share/doc/qt5/qtwidgets/images/simplewidgetmapper-example.png
  12003. share/doc/qt5/qtwidgets/images/sizegrip.png
  12004. share/doc/qt5/qtwidgets/images/sizegripimage.png
  12005. share/doc/qt5/qtwidgets/images/slider.png
  12006. share/doc/qt5/qtwidgets/images/sliderimage.png
  12007. share/doc/qt5/qtwidgets/images/sliders-example.png
  12008. share/doc/qt5/qtwidgets/images/spinbox.png
  12009. share/doc/qt5/qtwidgets/images/spinboxdelegate-example.png
  12010. share/doc/qt5/qtwidgets/images/spinboxes-example.png
  12011. share/doc/qt5/qtwidgets/images/spinboximage.png
  12012. share/doc/qt5/qtwidgets/images/spreadsheet-demo.png
  12013. share/doc/qt5/qtwidgets/images/standard-views.png
  12014. share/doc/qt5/qtwidgets/images/standarddialogs-example.png
  12015. share/doc/qt5/qtwidgets/images/standardwidget.png
  12016. share/doc/qt5/qtwidgets/images/stardelegate.png
  12017. share/doc/qt5/qtwidgets/images/states-example.png
  12018. share/doc/qt5/qtwidgets/images/stickman-example.png
  12019. share/doc/qt5/qtwidgets/images/stickman-example1.png
  12020. share/doc/qt5/qtwidgets/images/stickman-example2.png
  12021. share/doc/qt5/qtwidgets/images/stickman-example3.png
  12022. share/doc/qt5/qtwidgets/images/stringlistmodel.png
  12023. share/doc/qt5/qtwidgets/images/stylepluginexample.png
  12024. share/doc/qt5/qtwidgets/images/styles-3d.png
  12025. share/doc/qt5/qtwidgets/images/styles-aliasing.png
  12026. share/doc/qt5/qtwidgets/images/styles-disabledwood.png
  12027. share/doc/qt5/qtwidgets/images/styles-enabledwood.png
  12028. share/doc/qt5/qtwidgets/images/styles-woodbuttons.png
  12029. share/doc/qt5/qtwidgets/images/stylesheet-border-image-normal.png
  12030. share/doc/qt5/qtwidgets/images/stylesheet-border-image-stretched.png
  12031. share/doc/qt5/qtwidgets/images/stylesheet-border-image-wrong.png
  12032. share/doc/qt5/qtwidgets/images/stylesheet-boxmodel.png
  12033. share/doc/qt5/qtwidgets/images/stylesheet-branch-closed.png
  12034. share/doc/qt5/qtwidgets/images/stylesheet-branch-end.png
  12035. share/doc/qt5/qtwidgets/images/stylesheet-branch-more.png
  12036. share/doc/qt5/qtwidgets/images/stylesheet-branch-open.png
  12037. share/doc/qt5/qtwidgets/images/stylesheet-coffee-cleanlooks.png
  12038. share/doc/qt5/qtwidgets/images/stylesheet-pagefold-mac.png
  12039. share/doc/qt5/qtwidgets/images/stylesheet-pagefold.png
  12040. share/doc/qt5/qtwidgets/images/stylesheet-redbutton1.png
  12041. share/doc/qt5/qtwidgets/images/stylesheet-redbutton2.png
  12042. share/doc/qt5/qtwidgets/images/stylesheet-redbutton3.png
  12043. share/doc/qt5/qtwidgets/images/stylesheet-scrollbar1.png
  12044. share/doc/qt5/qtwidgets/images/stylesheet-scrollbar2.png
  12045. share/doc/qt5/qtwidgets/images/stylesheet-treeview.png
  12046. share/doc/qt5/qtwidgets/images/stylesheet-vline.png
  12047. share/doc/qt5/qtwidgets/images/sub-attaq-demo.png
  12048. share/doc/qt5/qtwidgets/images/swipegesture.png
  12049. share/doc/qt5/qtwidgets/images/syntaxhighlighter-example.png
  12050. share/doc/qt5/qtwidgets/images/system-tray.png
  12051. share/doc/qt5/qtwidgets/images/systemtray-editor.png
  12052. share/doc/qt5/qtwidgets/images/systemtray-example.png
  12053. share/doc/qt5/qtwidgets/images/tab.png
  12054. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet1.png
  12055. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet2.png
  12056. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet3.png
  12057. share/doc/qt5/qtwidgets/images/tabdialog-example.png
  12058. share/doc/qt5/qtwidgets/images/tableWidget-stylesheet.png
  12059. share/doc/qt5/qtwidgets/images/tabletexample.png
  12060. share/doc/qt5/qtwidgets/images/tableview.png
  12061. share/doc/qt5/qtwidgets/images/tabwidget.png
  12062. share/doc/qt5/qtwidgets/images/tetrix-example.png
  12063. share/doc/qt5/qtwidgets/images/textedit-demo.png
  12064. share/doc/qt5/qtwidgets/images/titlebar.png
  12065. share/doc/qt5/qtwidgets/images/titlebarimage.png
  12066. share/doc/qt5/qtwidgets/images/toolbar.png
  12067. share/doc/qt5/qtwidgets/images/toolbarimage.png
  12068. share/doc/qt5/qtwidgets/images/toolbox.png
  12069. share/doc/qt5/qtwidgets/images/toolboximage.png
  12070. share/doc/qt5/qtwidgets/images/toolbutton.png
  12071. share/doc/qt5/qtwidgets/images/toolbuttonimage.png
  12072. share/doc/qt5/qtwidgets/images/tooltips-example.png
  12073. share/doc/qt5/qtwidgets/images/trafficlight-example.png
  12074. share/doc/qt5/qtwidgets/images/trafficlight-example1.png
  12075. share/doc/qt5/qtwidgets/images/trafficlight-example2.png
  12076. share/doc/qt5/qtwidgets/images/transformations-example.png
  12077. share/doc/qt5/qtwidgets/images/tree_2_with_algorithm.png
  12078. share/doc/qt5/qtwidgets/images/treemodel-structure.png
  12079. share/doc/qt5/qtwidgets/images/treemodelcompleter-example.png
  12080. share/doc/qt5/qtwidgets/images/treeview.png
  12081. share/doc/qt5/qtwidgets/images/trivialwizard-example-conclusion.png
  12082. share/doc/qt5/qtwidgets/images/trivialwizard-example-flow.png
  12083. share/doc/qt5/qtwidgets/images/trivialwizard-example-introduction.png
  12084. share/doc/qt5/qtwidgets/images/trivialwizard-example-registration.png
  12085. share/doc/qt5/qtwidgets/images/undodemo.png
  12086. share/doc/qt5/qtwidgets/images/undoframeworkexample.png
  12087. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/Time-For-Lunch-2.jpg
  12088. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/centered.png
  12089. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/ellipse.png
  12090. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/figure8.png
  12091. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/kinetic.png
  12092. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/random.png
  12093. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/tile.png
  12094. share/doc/qt5/qtwidgets/images/used-in-examples/animation/easing/images/qt-logo.png
  12095. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/bad.png
  12096. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/heart.png
  12097. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/trash.png
  12098. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/background.png
  12099. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/banner.png
  12100. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo1.png
  12101. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo2.png
  12102. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo3.png
  12103. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark1.png
  12104. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark2.png
  12105. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/logo.png
  12106. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/watermark.png
  12107. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/boat.png
  12108. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/car.png
  12109. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/house.png
  12110. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-calculator.png
  12111. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-text-editor.png
  12112. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/background.jpg
  12113. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/help-browser.png
  12114. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-group-chat.png
  12115. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-mail.png
  12116. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-web-browser.png
  12117. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/office-calendar.png
  12118. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/system-users.png
  12119. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/basicgraphicslayouts/images/block.png
  12120. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/collidingmice/images/cheese.jpg
  12121. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background1.png
  12122. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background2.png
  12123. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background3.png
  12124. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background4.png
  12125. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bold.png
  12126. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bringtofront.png
  12127. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/delete.png
  12128. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/floodfill.png
  12129. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/italic.png
  12130. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linecolor.png
  12131. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linepointer.png
  12132. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/pointer.png
  12133. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/sendtoback.png
  12134. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/textpointer.png
  12135. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/underline.png
  12136. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/dragdroprobot/images/head.png
  12137. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/artsfftscope.png
  12138. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/blue_angle_swirl.jpg
  12139. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_contacts.png
  12140. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_journal.png
  12141. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_mail.png
  12142. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_notes.png
  12143. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kopeteavailable.png
  12144. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/metacontact_online.png
  12145. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/minitools.png
  12146. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/5days.jpg
  12147. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/details.jpg
  12148. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/place.jpg
  12149. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/tabbar.jpg
  12150. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/title.jpg
  12151. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/weather-few-clouds.png
  12152. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/customsortfiltermodel/images/find.png
  12153. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/folder.png
  12154. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/interview.png
  12155. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/services.png
  12156. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/pixelator/images/qt.png
  12157. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/spreadsheet/images/interview.png
  12158. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/copy.png
  12159. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/cut.png
  12160. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/new.png
  12161. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/open.png
  12162. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/paste.png
  12163. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/save.png
  12164. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/new.png
  12165. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/print.png
  12166. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/save.png
  12167. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/undo.png
  12168. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/copy.png
  12169. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/cut.png
  12170. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/new.png
  12171. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/open.png
  12172. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/paste.png
  12173. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/save.png
  12174. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/copy.png
  12175. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/cut.png
  12176. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/new.png
  12177. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/open.png
  12178. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/paste.png
  12179. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/save.png
  12180. share/doc/qt5/qtwidgets/images/used-in-examples/painting/basicdrawing/images/brick.png
  12181. share/doc/qt5/qtwidgets/images/used-in-examples/painting/basicdrawing/images/qt-logo.png
  12182. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/background.png
  12183. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/blackrectangle.png
  12184. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/butterfly.png
  12185. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/checker.png
  12186. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/logo32.png
  12187. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcopy.png
  12188. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcut.png
  12189. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editpaste.png
  12190. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editredo.png
  12191. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editundo.png
  12192. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/exportpdf.png
  12193. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filenew.png
  12194. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileopen.png
  12195. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileprint.png
  12196. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filesave.png
  12197. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textbold.png
  12198. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textcenter.png
  12199. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textitalic.png
  12200. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textjustify.png
  12201. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textleft.png
  12202. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textright.png
  12203. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textunder.png
  12204. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomin.png
  12205. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomout.png
  12206. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcopy.png
  12207. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcut.png
  12208. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editpaste.png
  12209. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editredo.png
  12210. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editundo.png
  12211. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/exportpdf.png
  12212. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filenew.png
  12213. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileopen.png
  12214. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileprint.png
  12215. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filesave.png
  12216. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textbold.png
  12217. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textcenter.png
  12218. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textitalic.png
  12219. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textjustify.png
  12220. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textleft.png
  12221. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textright.png
  12222. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textunder.png
  12223. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomin.png
  12224. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomout.png
  12225. share/doc/qt5/qtwidgets/images/used-in-examples/tools/regularexpression/images/copy.png
  12226. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undoframework/images/cross.png
  12227. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/designer.png
  12228. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/find_disabled.png
  12229. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/find_normal.png
  12230. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_128x128.png
  12231. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_16x16.png
  12232. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_32x32.png
  12233. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_64x64.png
  12234. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_128x128.png
  12235. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_16x16.png
  12236. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_32x32.png
  12237. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_64x64.png
  12238. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_16x16.png
  12239. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_32x32.png
  12240. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_48x48.png
  12241. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/styles/images/woodbackground.png
  12242. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/styles/images/woodbutton.png
  12243. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked.png
  12244. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_hover.png
  12245. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_pressed.png
  12246. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked.png
  12247. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_hover.png
  12248. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_pressed.png
  12249. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow.png
  12250. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow_disabled.png
  12251. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/frame.png
  12252. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pagefold.png
  12253. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton.png
  12254. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_hover.png
  12255. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_pressed.png
  12256. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked.png
  12257. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_hover.png
  12258. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_pressed.png
  12259. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked.png
  12260. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_hover.png
  12261. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_pressed.png
  12262. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/sizegrip.png
  12263. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown.png
  12264. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_hover.png
  12265. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_off.png
  12266. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_pressed.png
  12267. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup.png
  12268. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_hover.png
  12269. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_off.png
  12270. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_pressed.png
  12271. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow.png
  12272. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow_disabled.png
  12273. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-airbrush.png
  12274. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-eraser.png
  12275. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-felt-marker.png
  12276. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-pencil.png
  12277. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/circle.png
  12278. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/square.png
  12279. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/triangle.png
  12280. share/doc/qt5/qtwidgets/images/weatheranchorlayout-example.png
  12281. share/doc/qt5/qtwidgets/images/whatsthis.png
  12282. share/doc/qt5/qtwidgets/images/widget-examples.png
  12283. share/doc/qt5/qtwidgets/images/widgetdelegate.png
  12284. share/doc/qt5/qtwidgets/images/widgetmapper-combo-mapping.png
  12285. share/doc/qt5/qtwidgets/images/widgetmapper-simple-mapping.png
  12286. share/doc/qt5/qtwidgets/images/widgetmapper.png
  12287. share/doc/qt5/qtwidgets/images/widgets-tutorial-childwidget.png
  12288. share/doc/qt5/qtwidgets/images/widgets-tutorial-nestedlayouts.png
  12289. share/doc/qt5/qtwidgets/images/widgets-tutorial-toplevel.png
  12290. share/doc/qt5/qtwidgets/images/widgets-tutorial-windowlayout.png
  12291. share/doc/qt5/qtwidgets/images/wiggly-example.png
  12292. share/doc/qt5/qtwidgets/images/windowflags-example.png
  12293. share/doc/qt5/qtwidgets/images/windowflags_controllerwindow.png
  12294. share/doc/qt5/qtwidgets/images/windowflags_previewwindow.png
  12295. share/doc/qt5/qtwidgets/images/windows-checkbox.png
  12296. share/doc/qt5/qtwidgets/images/windows-combobox.png
  12297. share/doc/qt5/qtwidgets/images/windows-dateedit.png
  12298. share/doc/qt5/qtwidgets/images/windows-datetimeedit.png
  12299. share/doc/qt5/qtwidgets/images/windows-dial.png
  12300. share/doc/qt5/qtwidgets/images/windows-groupbox.png
  12301. share/doc/qt5/qtwidgets/images/windows-label.png
  12302. share/doc/qt5/qtwidgets/images/windows-lcdnumber.png
  12303. share/doc/qt5/qtwidgets/images/windows-lineedit.png
  12304. share/doc/qt5/qtwidgets/images/windows-listview.png
  12305. share/doc/qt5/qtwidgets/images/windows-progressbar.png
  12306. share/doc/qt5/qtwidgets/images/windows-radiobutton.png
  12307. share/doc/qt5/qtwidgets/images/windows-slider.png
  12308. share/doc/qt5/qtwidgets/images/windows-spinbox.png
  12309. share/doc/qt5/qtwidgets/images/windows-style.png
  12310. share/doc/qt5/qtwidgets/images/windows-style2.png
  12311. share/doc/qt5/qtwidgets/images/windows-tableview.png
  12312. share/doc/qt5/qtwidgets/images/windows-tabwidget.png
  12313. share/doc/qt5/qtwidgets/images/windows-timeedit.png
  12314. share/doc/qt5/qtwidgets/images/windows-treeview.png
  12315. share/doc/qt5/qtwidgets/images/windows-vista-style.png
  12316. share/doc/qt5/qtwidgets/images/windowstabimage.png
  12317. share/doc/qt5/qtwidgets/images/windowsvista-fontcombobox.png
  12318. share/doc/qt5/qtwidgets/images/windowsvista-pushbutton.png
  12319. share/doc/qt5/qtwidgets/images/windowsvista-radiobutton.png
  12320. share/doc/qt5/qtwidgets/images/woodbackground.png
  12321. share/doc/qt5/qtwidgets/images/woodbutton.png
  12322. share/doc/qt5/qtwidgets/layout.html
  12323. share/doc/qt5/qtwidgets/mainwindow.html
  12324. share/doc/qt5/qtwidgets/model-view-programming.html
  12325. share/doc/qt5/qtwidgets/modelview-part2-main-cpp.html
  12326. share/doc/qt5/qtwidgets/modelview.html
  12327. share/doc/qt5/qtwidgets/qabstractbutton-members.html
  12328. share/doc/qt5/qtwidgets/qabstractbutton.html
  12329. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem-members.html
  12330. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem.html
  12331. share/doc/qt5/qtwidgets/qabstractitemdelegate-members.html
  12332. share/doc/qt5/qtwidgets/qabstractitemdelegate-obsolete.html
  12333. share/doc/qt5/qtwidgets/qabstractitemdelegate.html
  12334. share/doc/qt5/qtwidgets/qabstractitemview-members.html
  12335. share/doc/qt5/qtwidgets/qabstractitemview-obsolete.html
  12336. share/doc/qt5/qtwidgets/qabstractitemview.html
  12337. share/doc/qt5/qtwidgets/qabstractscrollarea-members.html
  12338. share/doc/qt5/qtwidgets/qabstractscrollarea.html
  12339. share/doc/qt5/qtwidgets/qabstractslider-members.html
  12340. share/doc/qt5/qtwidgets/qabstractslider.html
  12341. share/doc/qt5/qtwidgets/qabstractspinbox-members.html
  12342. share/doc/qt5/qtwidgets/qabstractspinbox.html
  12343. share/doc/qt5/qtwidgets/qaccessiblewidget-members.html
  12344. share/doc/qt5/qtwidgets/qaccessiblewidget.html
  12345. share/doc/qt5/qtwidgets/qaction-members.html
  12346. share/doc/qt5/qtwidgets/qaction.html
  12347. share/doc/qt5/qtwidgets/qactiongroup-members.html
  12348. share/doc/qt5/qtwidgets/qactiongroup.html
  12349. share/doc/qt5/qtwidgets/qapplication-members.html
  12350. share/doc/qt5/qtwidgets/qapplication-obsolete.html
  12351. share/doc/qt5/qtwidgets/qapplication.html
  12352. share/doc/qt5/qtwidgets/qboxlayout-members.html
  12353. share/doc/qt5/qtwidgets/qboxlayout.html
  12354. share/doc/qt5/qtwidgets/qbuttongroup-members.html
  12355. share/doc/qt5/qtwidgets/qbuttongroup.html
  12356. share/doc/qt5/qtwidgets/qcalendarwidget-members.html
  12357. share/doc/qt5/qtwidgets/qcalendarwidget.html
  12358. share/doc/qt5/qtwidgets/qcheckbox-members.html
  12359. share/doc/qt5/qtwidgets/qcheckbox.html
  12360. share/doc/qt5/qtwidgets/qcolordialog-members.html
  12361. share/doc/qt5/qtwidgets/qcolordialog-obsolete.html
  12362. share/doc/qt5/qtwidgets/qcolordialog.html
  12363. share/doc/qt5/qtwidgets/qcolormap-members.html
  12364. share/doc/qt5/qtwidgets/qcolormap.html
  12365. share/doc/qt5/qtwidgets/qcolumnview-members.html
  12366. share/doc/qt5/qtwidgets/qcolumnview.html
  12367. share/doc/qt5/qtwidgets/qcombobox-members.html
  12368. share/doc/qt5/qtwidgets/qcombobox-obsolete.html
  12369. share/doc/qt5/qtwidgets/qcombobox.html
  12370. share/doc/qt5/qtwidgets/qcommandlinkbutton-members.html
  12371. share/doc/qt5/qtwidgets/qcommandlinkbutton.html
  12372. share/doc/qt5/qtwidgets/qcommonstyle-members.html
  12373. share/doc/qt5/qtwidgets/qcommonstyle.html
  12374. share/doc/qt5/qtwidgets/qcompleter-members.html
  12375. share/doc/qt5/qtwidgets/qcompleter.html
  12376. share/doc/qt5/qtwidgets/qdatawidgetmapper-members.html
  12377. share/doc/qt5/qtwidgets/qdatawidgetmapper.html
  12378. share/doc/qt5/qtwidgets/qdateedit-members.html
  12379. share/doc/qt5/qtwidgets/qdateedit.html
  12380. share/doc/qt5/qtwidgets/qdatetimeedit-members.html
  12381. share/doc/qt5/qtwidgets/qdatetimeedit.html
  12382. share/doc/qt5/qtwidgets/qdesktopwidget-members.html
  12383. share/doc/qt5/qtwidgets/qdesktopwidget-obsolete.html
  12384. share/doc/qt5/qtwidgets/qdesktopwidget.html
  12385. share/doc/qt5/qtwidgets/qdial-members.html
  12386. share/doc/qt5/qtwidgets/qdial.html
  12387. share/doc/qt5/qtwidgets/qdialog-members.html
  12388. share/doc/qt5/qtwidgets/qdialog-obsolete.html
  12389. share/doc/qt5/qtwidgets/qdialog.html
  12390. share/doc/qt5/qtwidgets/qdialogbuttonbox-members.html
  12391. share/doc/qt5/qtwidgets/qdialogbuttonbox.html
  12392. share/doc/qt5/qtwidgets/qdirmodel-members.html
  12393. share/doc/qt5/qtwidgets/qdirmodel.html
  12394. share/doc/qt5/qtwidgets/qdockwidget-members.html
  12395. share/doc/qt5/qtwidgets/qdockwidget.html
  12396. share/doc/qt5/qtwidgets/qdoublespinbox-members.html
  12397. share/doc/qt5/qtwidgets/qdoublespinbox.html
  12398. share/doc/qt5/qtwidgets/qdrawutil-h.html
  12399. share/doc/qt5/qtwidgets/qerrormessage-members.html
  12400. share/doc/qt5/qtwidgets/qerrormessage.html
  12401. share/doc/qt5/qtwidgets/qfiledialog-members.html
  12402. share/doc/qt5/qtwidgets/qfiledialog-obsolete.html
  12403. share/doc/qt5/qtwidgets/qfiledialog.html
  12404. share/doc/qt5/qtwidgets/qfileiconprovider-members.html
  12405. share/doc/qt5/qtwidgets/qfileiconprovider.html
  12406. share/doc/qt5/qtwidgets/qfilesystemmodel-members.html
  12407. share/doc/qt5/qtwidgets/qfilesystemmodel.html
  12408. share/doc/qt5/qtwidgets/qfocusframe-members.html
  12409. share/doc/qt5/qtwidgets/qfocusframe.html
  12410. share/doc/qt5/qtwidgets/qfontcombobox-members.html
  12411. share/doc/qt5/qtwidgets/qfontcombobox.html
  12412. share/doc/qt5/qtwidgets/qfontdialog-members.html
  12413. share/doc/qt5/qtwidgets/qfontdialog.html
  12414. share/doc/qt5/qtwidgets/qformlayout-members.html
  12415. share/doc/qt5/qtwidgets/qformlayout-takerowresult-members.html
  12416. share/doc/qt5/qtwidgets/qformlayout-takerowresult.html
  12417. share/doc/qt5/qtwidgets/qformlayout.html
  12418. share/doc/qt5/qtwidgets/qframe-members.html
  12419. share/doc/qt5/qtwidgets/qframe.html
  12420. share/doc/qt5/qtwidgets/qgesture-members.html
  12421. share/doc/qt5/qtwidgets/qgesture.html
  12422. share/doc/qt5/qtwidgets/qgestureevent-members.html
  12423. share/doc/qt5/qtwidgets/qgestureevent.html
  12424. share/doc/qt5/qtwidgets/qgesturerecognizer-members.html
  12425. share/doc/qt5/qtwidgets/qgesturerecognizer.html
  12426. share/doc/qt5/qtwidgets/qgraphicsanchor-members.html
  12427. share/doc/qt5/qtwidgets/qgraphicsanchor.html
  12428. share/doc/qt5/qtwidgets/qgraphicsanchorlayout-members.html
  12429. share/doc/qt5/qtwidgets/qgraphicsanchorlayout.html
  12430. share/doc/qt5/qtwidgets/qgraphicsblureffect-members.html
  12431. share/doc/qt5/qtwidgets/qgraphicsblureffect.html
  12432. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect-members.html
  12433. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect.html
  12434. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect-members.html
  12435. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect.html
  12436. share/doc/qt5/qtwidgets/qgraphicseffect-members.html
  12437. share/doc/qt5/qtwidgets/qgraphicseffect.html
  12438. share/doc/qt5/qtwidgets/qgraphicsellipseitem-members.html
  12439. share/doc/qt5/qtwidgets/qgraphicsellipseitem.html
  12440. share/doc/qt5/qtwidgets/qgraphicsgridlayout-members.html
  12441. share/doc/qt5/qtwidgets/qgraphicsgridlayout.html
  12442. share/doc/qt5/qtwidgets/qgraphicsitem-members.html
  12443. share/doc/qt5/qtwidgets/qgraphicsitem-obsolete.html
  12444. share/doc/qt5/qtwidgets/qgraphicsitem.html
  12445. share/doc/qt5/qtwidgets/qgraphicsitemanimation-members.html
  12446. share/doc/qt5/qtwidgets/qgraphicsitemanimation-obsolete.html
  12447. share/doc/qt5/qtwidgets/qgraphicsitemanimation.html
  12448. share/doc/qt5/qtwidgets/qgraphicsitemgroup-members.html
  12449. share/doc/qt5/qtwidgets/qgraphicsitemgroup.html
  12450. share/doc/qt5/qtwidgets/qgraphicslayout-members.html
  12451. share/doc/qt5/qtwidgets/qgraphicslayout.html
  12452. share/doc/qt5/qtwidgets/qgraphicslayoutitem-members.html
  12453. share/doc/qt5/qtwidgets/qgraphicslayoutitem.html
  12454. share/doc/qt5/qtwidgets/qgraphicslinearlayout-members.html
  12455. share/doc/qt5/qtwidgets/qgraphicslinearlayout.html
  12456. share/doc/qt5/qtwidgets/qgraphicslineitem-members.html
  12457. share/doc/qt5/qtwidgets/qgraphicslineitem.html
  12458. share/doc/qt5/qtwidgets/qgraphicsobject-members.html
  12459. share/doc/qt5/qtwidgets/qgraphicsobject.html
  12460. share/doc/qt5/qtwidgets/qgraphicsopacityeffect-members.html
  12461. share/doc/qt5/qtwidgets/qgraphicsopacityeffect.html
  12462. share/doc/qt5/qtwidgets/qgraphicspathitem-members.html
  12463. share/doc/qt5/qtwidgets/qgraphicspathitem.html
  12464. share/doc/qt5/qtwidgets/qgraphicspixmapitem-members.html
  12465. share/doc/qt5/qtwidgets/qgraphicspixmapitem.html
  12466. share/doc/qt5/qtwidgets/qgraphicspolygonitem-members.html
  12467. share/doc/qt5/qtwidgets/qgraphicspolygonitem.html
  12468. share/doc/qt5/qtwidgets/qgraphicsproxywidget-members.html
  12469. share/doc/qt5/qtwidgets/qgraphicsproxywidget.html
  12470. share/doc/qt5/qtwidgets/qgraphicsrectitem-members.html
  12471. share/doc/qt5/qtwidgets/qgraphicsrectitem.html
  12472. share/doc/qt5/qtwidgets/qgraphicsrotation-members.html
  12473. share/doc/qt5/qtwidgets/qgraphicsrotation.html
  12474. share/doc/qt5/qtwidgets/qgraphicsscale-members.html
  12475. share/doc/qt5/qtwidgets/qgraphicsscale.html
  12476. share/doc/qt5/qtwidgets/qgraphicsscene-members.html
  12477. share/doc/qt5/qtwidgets/qgraphicsscene-obsolete.html
  12478. share/doc/qt5/qtwidgets/qgraphicsscene.html
  12479. share/doc/qt5/qtwidgets/qgraphicsscenecontextmenuevent-members.html
  12480. share/doc/qt5/qtwidgets/qgraphicsscenecontextmenuevent.html
  12481. share/doc/qt5/qtwidgets/qgraphicsscenedragdropevent-members.html
  12482. share/doc/qt5/qtwidgets/qgraphicsscenedragdropevent.html
  12483. share/doc/qt5/qtwidgets/qgraphicssceneevent-members.html
  12484. share/doc/qt5/qtwidgets/qgraphicssceneevent.html
  12485. share/doc/qt5/qtwidgets/qgraphicsscenehelpevent-members.html
  12486. share/doc/qt5/qtwidgets/qgraphicsscenehelpevent.html
  12487. share/doc/qt5/qtwidgets/qgraphicsscenehoverevent-members.html
  12488. share/doc/qt5/qtwidgets/qgraphicsscenehoverevent.html
  12489. share/doc/qt5/qtwidgets/qgraphicsscenemouseevent-members.html
  12490. share/doc/qt5/qtwidgets/qgraphicsscenemouseevent.html
  12491. share/doc/qt5/qtwidgets/qgraphicsscenemoveevent-members.html
  12492. share/doc/qt5/qtwidgets/qgraphicsscenemoveevent.html
  12493. share/doc/qt5/qtwidgets/qgraphicssceneresizeevent-members.html
  12494. share/doc/qt5/qtwidgets/qgraphicssceneresizeevent.html
  12495. share/doc/qt5/qtwidgets/qgraphicsscenewheelevent-members.html
  12496. share/doc/qt5/qtwidgets/qgraphicsscenewheelevent.html
  12497. share/doc/qt5/qtwidgets/qgraphicssimpletextitem-members.html
  12498. share/doc/qt5/qtwidgets/qgraphicssimpletextitem.html
  12499. share/doc/qt5/qtwidgets/qgraphicstextitem-members.html
  12500. share/doc/qt5/qtwidgets/qgraphicstextitem.html
  12501. share/doc/qt5/qtwidgets/qgraphicstransform-members.html
  12502. share/doc/qt5/qtwidgets/qgraphicstransform.html
  12503. share/doc/qt5/qtwidgets/qgraphicsview-members.html
  12504. share/doc/qt5/qtwidgets/qgraphicsview-obsolete.html
  12505. share/doc/qt5/qtwidgets/qgraphicsview.html
  12506. share/doc/qt5/qtwidgets/qgraphicswidget-members.html
  12507. share/doc/qt5/qtwidgets/qgraphicswidget.html
  12508. share/doc/qt5/qtwidgets/qgridlayout-members.html
  12509. share/doc/qt5/qtwidgets/qgridlayout.html
  12510. share/doc/qt5/qtwidgets/qgroupbox-members.html
  12511. share/doc/qt5/qtwidgets/qgroupbox.html
  12512. share/doc/qt5/qtwidgets/qhboxlayout-members.html
  12513. share/doc/qt5/qtwidgets/qhboxlayout.html
  12514. share/doc/qt5/qtwidgets/qheaderview-members.html
  12515. share/doc/qt5/qtwidgets/qheaderview-obsolete.html
  12516. share/doc/qt5/qtwidgets/qheaderview.html
  12517. share/doc/qt5/qtwidgets/qinputdialog-members.html
  12518. share/doc/qt5/qtwidgets/qinputdialog-obsolete.html
  12519. share/doc/qt5/qtwidgets/qinputdialog.html
  12520. share/doc/qt5/qtwidgets/qitemdelegate-members.html
  12521. share/doc/qt5/qtwidgets/qitemdelegate.html
  12522. share/doc/qt5/qtwidgets/qitemeditorcreator-members.html
  12523. share/doc/qt5/qtwidgets/qitemeditorcreator.html
  12524. share/doc/qt5/qtwidgets/qitemeditorcreatorbase-members.html
  12525. share/doc/qt5/qtwidgets/qitemeditorcreatorbase.html
  12526. share/doc/qt5/qtwidgets/qitemeditorfactory-members.html
  12527. share/doc/qt5/qtwidgets/qitemeditorfactory.html
  12528. share/doc/qt5/qtwidgets/qkeyeventtransition-members.html
  12529. share/doc/qt5/qtwidgets/qkeyeventtransition.html
  12530. share/doc/qt5/qtwidgets/qkeysequenceedit-members.html
  12531. share/doc/qt5/qtwidgets/qkeysequenceedit.html
  12532. share/doc/qt5/qtwidgets/qlabel-members.html
  12533. share/doc/qt5/qtwidgets/qlabel.html
  12534. share/doc/qt5/qtwidgets/qlayout-members.html
  12535. share/doc/qt5/qtwidgets/qlayout-obsolete.html
  12536. share/doc/qt5/qtwidgets/qlayout.html
  12537. share/doc/qt5/qtwidgets/qlayoutitem-members.html
  12538. share/doc/qt5/qtwidgets/qlayoutitem.html
  12539. share/doc/qt5/qtwidgets/qlcdnumber-members.html
  12540. share/doc/qt5/qtwidgets/qlcdnumber.html
  12541. share/doc/qt5/qtwidgets/qlineedit-members.html
  12542. share/doc/qt5/qtwidgets/qlineedit.html
  12543. share/doc/qt5/qtwidgets/qlistview-members.html
  12544. share/doc/qt5/qtwidgets/qlistview.html
  12545. share/doc/qt5/qtwidgets/qlistwidget-members.html
  12546. share/doc/qt5/qtwidgets/qlistwidget-obsolete.html
  12547. share/doc/qt5/qtwidgets/qlistwidget.html
  12548. share/doc/qt5/qtwidgets/qlistwidgetitem-members.html
  12549. share/doc/qt5/qtwidgets/qlistwidgetitem-obsolete.html
  12550. share/doc/qt5/qtwidgets/qlistwidgetitem.html
  12551. share/doc/qt5/qtwidgets/qmaccocoaviewcontainer-members.html
  12552. share/doc/qt5/qtwidgets/qmaccocoaviewcontainer.html
  12553. share/doc/qt5/qtwidgets/qmacnativewidget-members.html
  12554. share/doc/qt5/qtwidgets/qmacnativewidget.html
  12555. share/doc/qt5/qtwidgets/qmainwindow-members.html
  12556. share/doc/qt5/qtwidgets/qmainwindow.html
  12557. share/doc/qt5/qtwidgets/qmdiarea-members.html
  12558. share/doc/qt5/qtwidgets/qmdiarea.html
  12559. share/doc/qt5/qtwidgets/qmdisubwindow-members.html
  12560. share/doc/qt5/qtwidgets/qmdisubwindow.html
  12561. share/doc/qt5/qtwidgets/qmenu-members.html
  12562. share/doc/qt5/qtwidgets/qmenu-obsolete.html
  12563. share/doc/qt5/qtwidgets/qmenu.html
  12564. share/doc/qt5/qtwidgets/qmenubar-members.html
  12565. share/doc/qt5/qtwidgets/qmenubar.html
  12566. share/doc/qt5/qtwidgets/qmessagebox-members.html
  12567. share/doc/qt5/qtwidgets/qmessagebox-obsolete.html
  12568. share/doc/qt5/qtwidgets/qmessagebox.html
  12569. share/doc/qt5/qtwidgets/qmouseeventtransition-members.html
  12570. share/doc/qt5/qtwidgets/qmouseeventtransition.html
  12571. share/doc/qt5/qtwidgets/qopenglwidget-members.html
  12572. share/doc/qt5/qtwidgets/qopenglwidget.html
  12573. share/doc/qt5/qtwidgets/qpangesture-members.html
  12574. share/doc/qt5/qtwidgets/qpangesture.html
  12575. share/doc/qt5/qtwidgets/qpinchgesture-members.html
  12576. share/doc/qt5/qtwidgets/qpinchgesture.html
  12577. share/doc/qt5/qtwidgets/qplaintextdocumentlayout-members.html
  12578. share/doc/qt5/qtwidgets/qplaintextdocumentlayout.html
  12579. share/doc/qt5/qtwidgets/qplaintextedit-members.html
  12580. share/doc/qt5/qtwidgets/qplaintextedit.html
  12581. share/doc/qt5/qtwidgets/qprogressbar-members.html
  12582. share/doc/qt5/qtwidgets/qprogressbar.html
  12583. share/doc/qt5/qtwidgets/qprogressdialog-members.html
  12584. share/doc/qt5/qtwidgets/qprogressdialog.html
  12585. share/doc/qt5/qtwidgets/qproxystyle-members.html
  12586. share/doc/qt5/qtwidgets/qproxystyle.html
  12587. share/doc/qt5/qtwidgets/qpushbutton-members.html
  12588. share/doc/qt5/qtwidgets/qpushbutton.html
  12589. share/doc/qt5/qtwidgets/qradiobutton-members.html
  12590. share/doc/qt5/qtwidgets/qradiobutton.html
  12591. share/doc/qt5/qtwidgets/qrubberband-members.html
  12592. share/doc/qt5/qtwidgets/qrubberband.html
  12593. share/doc/qt5/qtwidgets/qscrollarea-members.html
  12594. share/doc/qt5/qtwidgets/qscrollarea.html
  12595. share/doc/qt5/qtwidgets/qscrollbar-members.html
  12596. share/doc/qt5/qtwidgets/qscrollbar.html
  12597. share/doc/qt5/qtwidgets/qscroller-members.html
  12598. share/doc/qt5/qtwidgets/qscroller.html
  12599. share/doc/qt5/qtwidgets/qscrollerproperties-members.html
  12600. share/doc/qt5/qtwidgets/qscrollerproperties.html
  12601. share/doc/qt5/qtwidgets/qshortcut-members.html
  12602. share/doc/qt5/qtwidgets/qshortcut.html
  12603. share/doc/qt5/qtwidgets/qsizegrip-members.html
  12604. share/doc/qt5/qtwidgets/qsizegrip.html
  12605. share/doc/qt5/qtwidgets/qsizepolicy-members.html
  12606. share/doc/qt5/qtwidgets/qsizepolicy.html
  12607. share/doc/qt5/qtwidgets/qslider-members.html
  12608. share/doc/qt5/qtwidgets/qslider.html
  12609. share/doc/qt5/qtwidgets/qspaceritem-members.html
  12610. share/doc/qt5/qtwidgets/qspaceritem.html
  12611. share/doc/qt5/qtwidgets/qspinbox-members.html
  12612. share/doc/qt5/qtwidgets/qspinbox.html
  12613. share/doc/qt5/qtwidgets/qsplashscreen-members.html
  12614. share/doc/qt5/qtwidgets/qsplashscreen.html
  12615. share/doc/qt5/qtwidgets/qsplitter-members.html
  12616. share/doc/qt5/qtwidgets/qsplitter-obsolete.html
  12617. share/doc/qt5/qtwidgets/qsplitter.html
  12618. share/doc/qt5/qtwidgets/qsplitterhandle-members.html
  12619. share/doc/qt5/qtwidgets/qsplitterhandle.html
  12620. share/doc/qt5/qtwidgets/qstackedlayout-members.html
  12621. share/doc/qt5/qtwidgets/qstackedlayout.html
  12622. share/doc/qt5/qtwidgets/qstackedwidget-members.html
  12623. share/doc/qt5/qtwidgets/qstackedwidget.html
  12624. share/doc/qt5/qtwidgets/qstandarditemeditorcreator-members.html
  12625. share/doc/qt5/qtwidgets/qstandarditemeditorcreator.html
  12626. share/doc/qt5/qtwidgets/qstatusbar-members.html
  12627. share/doc/qt5/qtwidgets/qstatusbar.html
  12628. share/doc/qt5/qtwidgets/qstyle-members.html
  12629. share/doc/qt5/qtwidgets/qstyle-obsolete.html
  12630. share/doc/qt5/qtwidgets/qstyle.html
  12631. share/doc/qt5/qtwidgets/qstyleditemdelegate-members.html
  12632. share/doc/qt5/qtwidgets/qstyleditemdelegate.html
  12633. share/doc/qt5/qtwidgets/qstylefactory-members.html
  12634. share/doc/qt5/qtwidgets/qstylefactory.html
  12635. share/doc/qt5/qtwidgets/qstylehintreturn-members.html
  12636. share/doc/qt5/qtwidgets/qstylehintreturn.html
  12637. share/doc/qt5/qtwidgets/qstylehintreturnmask-members.html
  12638. share/doc/qt5/qtwidgets/qstylehintreturnmask.html
  12639. share/doc/qt5/qtwidgets/qstylehintreturnvariant-members.html
  12640. share/doc/qt5/qtwidgets/qstylehintreturnvariant.html
  12641. share/doc/qt5/qtwidgets/qstyleoption-members.html
  12642. share/doc/qt5/qtwidgets/qstyleoption-obsolete.html
  12643. share/doc/qt5/qtwidgets/qstyleoption.html
  12644. share/doc/qt5/qtwidgets/qstyleoptionbutton-members.html
  12645. share/doc/qt5/qtwidgets/qstyleoptionbutton.html
  12646. share/doc/qt5/qtwidgets/qstyleoptioncombobox-members.html
  12647. share/doc/qt5/qtwidgets/qstyleoptioncombobox.html
  12648. share/doc/qt5/qtwidgets/qstyleoptioncomplex-members.html
  12649. share/doc/qt5/qtwidgets/qstyleoptioncomplex.html
  12650. share/doc/qt5/qtwidgets/qstyleoptiondockwidget-members.html
  12651. share/doc/qt5/qtwidgets/qstyleoptiondockwidget-obsolete.html
  12652. share/doc/qt5/qtwidgets/qstyleoptiondockwidget.html
  12653. share/doc/qt5/qtwidgets/qstyleoptionfocusrect-members.html
  12654. share/doc/qt5/qtwidgets/qstyleoptionfocusrect.html
  12655. share/doc/qt5/qtwidgets/qstyleoptionframe-members.html
  12656. share/doc/qt5/qtwidgets/qstyleoptionframe-obsolete.html
  12657. share/doc/qt5/qtwidgets/qstyleoptionframe.html
  12658. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem-members.html
  12659. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem-obsolete.html
  12660. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem.html
  12661. share/doc/qt5/qtwidgets/qstyleoptiongroupbox-members.html
  12662. share/doc/qt5/qtwidgets/qstyleoptiongroupbox.html
  12663. share/doc/qt5/qtwidgets/qstyleoptionheader-members.html
  12664. share/doc/qt5/qtwidgets/qstyleoptionheader.html
  12665. share/doc/qt5/qtwidgets/qstyleoptionmenuitem-members.html
  12666. share/doc/qt5/qtwidgets/qstyleoptionmenuitem.html
  12667. share/doc/qt5/qtwidgets/qstyleoptionprogressbar-members.html
  12668. share/doc/qt5/qtwidgets/qstyleoptionprogressbar-obsolete.html
  12669. share/doc/qt5/qtwidgets/qstyleoptionprogressbar.html
  12670. share/doc/qt5/qtwidgets/qstyleoptionrubberband-members.html
  12671. share/doc/qt5/qtwidgets/qstyleoptionrubberband.html
  12672. share/doc/qt5/qtwidgets/qstyleoptionsizegrip-members.html
  12673. share/doc/qt5/qtwidgets/qstyleoptionsizegrip.html
  12674. share/doc/qt5/qtwidgets/qstyleoptionslider-members.html
  12675. share/doc/qt5/qtwidgets/qstyleoptionslider.html
  12676. share/doc/qt5/qtwidgets/qstyleoptionspinbox-members.html
  12677. share/doc/qt5/qtwidgets/qstyleoptionspinbox.html
  12678. share/doc/qt5/qtwidgets/qstyleoptiontab-members.html
  12679. share/doc/qt5/qtwidgets/qstyleoptiontab-obsolete.html
  12680. share/doc/qt5/qtwidgets/qstyleoptiontab.html
  12681. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase-members.html
  12682. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase-obsolete.html
  12683. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase.html
  12684. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe-members.html
  12685. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe-obsolete.html
  12686. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe.html
  12687. share/doc/qt5/qtwidgets/qstyleoptiontitlebar-members.html
  12688. share/doc/qt5/qtwidgets/qstyleoptiontitlebar.html
  12689. share/doc/qt5/qtwidgets/qstyleoptiontoolbar-members.html
  12690. share/doc/qt5/qtwidgets/qstyleoptiontoolbar.html
  12691. share/doc/qt5/qtwidgets/qstyleoptiontoolbox-members.html
  12692. share/doc/qt5/qtwidgets/qstyleoptiontoolbox-obsolete.html
  12693. share/doc/qt5/qtwidgets/qstyleoptiontoolbox.html
  12694. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton-members.html
  12695. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton.html
  12696. share/doc/qt5/qtwidgets/qstyleoptionviewitem-members.html
  12697. share/doc/qt5/qtwidgets/qstyleoptionviewitem-obsolete.html
  12698. share/doc/qt5/qtwidgets/qstyleoptionviewitem.html
  12699. share/doc/qt5/qtwidgets/qstylepainter-members.html
  12700. share/doc/qt5/qtwidgets/qstylepainter.html
  12701. share/doc/qt5/qtwidgets/qstyleplugin-members.html
  12702. share/doc/qt5/qtwidgets/qstyleplugin.html
  12703. share/doc/qt5/qtwidgets/qswipegesture-members.html
  12704. share/doc/qt5/qtwidgets/qswipegesture.html
  12705. share/doc/qt5/qtwidgets/qsystemtrayicon-members.html
  12706. share/doc/qt5/qtwidgets/qsystemtrayicon.html
  12707. share/doc/qt5/qtwidgets/qtabbar-members.html
  12708. share/doc/qt5/qtwidgets/qtabbar.html
  12709. share/doc/qt5/qtwidgets/qtableview-members.html
  12710. share/doc/qt5/qtwidgets/qtableview-obsolete.html
  12711. share/doc/qt5/qtwidgets/qtableview.html
  12712. share/doc/qt5/qtwidgets/qtablewidget-members.html
  12713. share/doc/qt5/qtwidgets/qtablewidget-obsolete.html
  12714. share/doc/qt5/qtwidgets/qtablewidget.html
  12715. share/doc/qt5/qtwidgets/qtablewidgetitem-members.html
  12716. share/doc/qt5/qtwidgets/qtablewidgetitem-obsolete.html
  12717. share/doc/qt5/qtwidgets/qtablewidgetitem.html
  12718. share/doc/qt5/qtwidgets/qtablewidgetselectionrange-members.html
  12719. share/doc/qt5/qtwidgets/qtablewidgetselectionrange.html
  12720. share/doc/qt5/qtwidgets/qtabwidget-members.html
  12721. share/doc/qt5/qtwidgets/qtabwidget.html
  12722. share/doc/qt5/qtwidgets/qtapandholdgesture-members.html
  12723. share/doc/qt5/qtwidgets/qtapandholdgesture.html
  12724. share/doc/qt5/qtwidgets/qtapgesture-members.html
  12725. share/doc/qt5/qtwidgets/qtapgesture.html
  12726. share/doc/qt5/qtwidgets/qtextbrowser-members.html
  12727. share/doc/qt5/qtwidgets/qtextbrowser.html
  12728. share/doc/qt5/qtwidgets/qtextedit-extraselection-members.html
  12729. share/doc/qt5/qtwidgets/qtextedit-extraselection.html
  12730. share/doc/qt5/qtwidgets/qtextedit-members.html
  12731. share/doc/qt5/qtwidgets/qtextedit.html
  12732. share/doc/qt5/qtwidgets/qtilerules-members.html
  12733. share/doc/qt5/qtwidgets/qtilerules.html
  12734. share/doc/qt5/qtwidgets/qtimeedit-members.html
  12735. share/doc/qt5/qtwidgets/qtimeedit.html
  12736. share/doc/qt5/qtwidgets/qtoolbar-members.html
  12737. share/doc/qt5/qtwidgets/qtoolbar.html
  12738. share/doc/qt5/qtwidgets/qtoolbox-members.html
  12739. share/doc/qt5/qtwidgets/qtoolbox.html
  12740. share/doc/qt5/qtwidgets/qtoolbutton-members.html
  12741. share/doc/qt5/qtwidgets/qtoolbutton.html
  12742. share/doc/qt5/qtwidgets/qtooltip-members.html
  12743. share/doc/qt5/qtwidgets/qtooltip.html
  12744. share/doc/qt5/qtwidgets/qtreeview-members.html
  12745. share/doc/qt5/qtwidgets/qtreeview-obsolete.html
  12746. share/doc/qt5/qtwidgets/qtreeview.html
  12747. share/doc/qt5/qtwidgets/qtreewidget-members.html
  12748. share/doc/qt5/qtwidgets/qtreewidget-obsolete.html
  12749. share/doc/qt5/qtwidgets/qtreewidget.html
  12750. share/doc/qt5/qtwidgets/qtreewidgetitem-members.html
  12751. share/doc/qt5/qtwidgets/qtreewidgetitem-obsolete.html
  12752. share/doc/qt5/qtwidgets/qtreewidgetitem.html
  12753. share/doc/qt5/qtwidgets/qtreewidgetitemiterator-members.html
  12754. share/doc/qt5/qtwidgets/qtreewidgetitemiterator.html
  12755. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-pro.html
  12756. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-qrc.html
  12757. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-example.html
  12758. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-main-cpp.html
  12759. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-animation-h.html
  12760. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-easing-pro.html
  12761. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-easing-qrc.html
  12762. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-example.html
  12763. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-form-ui.html
  12764. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-main-cpp.html
  12765. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-window-cpp.html
  12766. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-window-h.html
  12767. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-example.html
  12768. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-main-cpp.html
  12769. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-moveblocks-pro.html
  12770. share/doc/qt5/qtwidgets/qtwidgets-animation-states-example.html
  12771. share/doc/qt5/qtwidgets/qtwidgets-animation-states-main-cpp.html
  12772. share/doc/qt5/qtwidgets/qtwidgets-animation-states-states-pro.html
  12773. share/doc/qt5/qtwidgets/qtwidgets-animation-states-states-qrc.html
  12774. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-animation-cpp.html
  12775. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-animation-h.html
  12776. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-example.html
  12777. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-graphicsview-cpp.html
  12778. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-graphicsview-h.html
  12779. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-lifecycle-cpp.html
  12780. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-lifecycle-h.html
  12781. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-main-cpp.html
  12782. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-node-cpp.html
  12783. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-node-h.html
  12784. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-rectbutton-cpp.html
  12785. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-rectbutton-h.html
  12786. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-cpp.html
  12787. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-h.html
  12788. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-pro.html
  12789. share/doc/qt5/qtwidgets/qtwidgets-animation-stickman-stickman-qrc.html
  12790. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-animationmanager-cpp.html
  12791. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-animationmanager-h.html
  12792. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-boat-cpp.html
  12793. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-boat-h.html
  12794. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-boat-p-h.html
  12795. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-bomb-cpp.html
  12796. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-bomb-h.html
  12797. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-data-xml.html
  12798. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-example.html
  12799. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-graphicsscene-cpp.html
  12800. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-graphicsscene-h.html
  12801. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-main-cpp.html
  12802. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-mainwindow-cpp.html
  12803. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-mainwindow-h.html
  12804. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-background-n810-svg.html
  12805. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-background-svg.html
  12806. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-boat-svg.html
  12807. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-bomb-svg.html
  12808. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sand-svg.html
  12809. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-see-svg.html
  12810. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sky-svg.html
  12811. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sub-attaq-svg.html
  12812. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-submarine-svg.html
  12813. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-surface-svg.html
  12814. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-torpedo-svg.html
  12815. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pixmapitem-cpp.html
  12816. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-pixmapitem-h.html
  12817. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-progressitem-cpp.html
  12818. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-progressitem-h.html
  12819. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-qanimationstate-cpp.html
  12820. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-qanimationstate-h.html
  12821. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-states-cpp.html
  12822. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-states-h.html
  12823. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-sub-attaq-pro.html
  12824. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-subattaq-qrc.html
  12825. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-submarine-cpp.html
  12826. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-submarine-h.html
  12827. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-submarine-p-h.html
  12828. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-textinformationitem-cpp.html
  12829. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-textinformationitem-h.html
  12830. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-torpedo-cpp.html
  12831. share/doc/qt5/qtwidgets/qtwidgets-animation-sub-attaq-torpedo-h.html
  12832. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-example.html
  12833. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-main-cpp.html
  12834. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-screenshot-cpp.html
  12835. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-screenshot-h.html
  12836. share/doc/qt5/qtwidgets/qtwidgets-desktop-screenshot-screenshot-pro.html
  12837. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-example.html
  12838. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-main-cpp.html
  12839. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-systray-pro.html
  12840. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-systray-qrc.html
  12841. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-window-cpp.html
  12842. share/doc/qt5/qtwidgets/qtwidgets-desktop-systray-window-h.html
  12843. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-cpp.html
  12844. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-h.html
  12845. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-pro.html
  12846. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-qrc.html
  12847. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-example.html
  12848. share/doc/qt5/qtwidgets/qtwidgets-dialogs-classwizard-main-cpp.html
  12849. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-example.html
  12850. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-extension-pro.html
  12851. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-finddialog-cpp.html
  12852. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-finddialog-h.html
  12853. share/doc/qt5/qtwidgets/qtwidgets-dialogs-extension-main-cpp.html
  12854. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-example.html
  12855. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-findfiles-pro.html
  12856. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-main-cpp.html
  12857. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-window-cpp.html
  12858. share/doc/qt5/qtwidgets/qtwidgets-dialogs-findfiles-window-h.html
  12859. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-example.html
  12860. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-cpp.html
  12861. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-h.html
  12862. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-pro.html
  12863. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-qrc.html
  12864. share/doc/qt5/qtwidgets/qtwidgets-dialogs-licensewizard-main-cpp.html
  12865. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-dialog-cpp.html
  12866. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-dialog-h.html
  12867. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-example.html
  12868. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-main-cpp.html
  12869. share/doc/qt5/qtwidgets/qtwidgets-dialogs-standarddialogs-standarddialogs-pro.html
  12870. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-example.html
  12871. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-main-cpp.html
  12872. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-cpp.html
  12873. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-h.html
  12874. share/doc/qt5/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-pro.html
  12875. share/doc/qt5/qtwidgets/qtwidgets-dialogs-trivialwizard-example.html
  12876. share/doc/qt5/qtwidgets/qtwidgets-dialogs-trivialwizard-trivialwizard-cpp.html
  12877. share/doc/qt5/qtwidgets/qtwidgets-dialogs-trivialwizard-trivialwizard-pro.html
  12878. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-draggableicons-pro.html
  12879. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-draggableicons-qrc.html
  12880. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-dragwidget-cpp.html
  12881. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-dragwidget-h.html
  12882. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-example.html
  12883. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggableicons-main-cpp.html
  12884. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-draggabletext-pro.html
  12885. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-draggabletext-qrc.html
  12886. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-dragwidget-cpp.html
  12887. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-dragwidget-h.html
  12888. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-example.html
  12889. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-draggabletext-main-cpp.html
  12890. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-droparea-cpp.html
  12891. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-droparea-h.html
  12892. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-dropsite-pro.html
  12893. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-dropsitewindow-cpp.html
  12894. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-dropsitewindow-h.html
  12895. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-example.html
  12896. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-dropsite-main-cpp.html
  12897. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-draglabel-cpp.html
  12898. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-draglabel-h.html
  12899. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-dragwidget-cpp.html
  12900. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-dragwidget-h.html
  12901. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-example.html
  12902. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-fridgemagnets-pro.html
  12903. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-fridgemagnets-qrc.html
  12904. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-fridgemagnets-main-cpp.html
  12905. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-example.html
  12906. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-main-cpp.html
  12907. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-mainwindow-cpp.html
  12908. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-mainwindow-h.html
  12909. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-pieceslist-cpp.html
  12910. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-pieceslist-h.html
  12911. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzle-pro.html
  12912. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzle-qrc.html
  12913. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzlewidget-cpp.html
  12914. share/doc/qt5/qtwidgets/qtwidgets-draganddrop-puzzle-puzzlewidget-h.html
  12915. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blureffect-cpp.html
  12916. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blureffect-h.html
  12917. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-cpp.html
  12918. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-h.html
  12919. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-pro.html
  12920. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-qrc.html
  12921. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-example.html
  12922. share/doc/qt5/qtwidgets/qtwidgets-effects-blurpicker-main-cpp.html
  12923. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-example.html
  12924. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-cpp.html
  12925. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-h.html
  12926. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-pro.html
  12927. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-fademessage-qrc.html
  12928. share/doc/qt5/qtwidgets/qtwidgets-effects-fademessage-main-cpp.html
  12929. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-example.html
  12930. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-imagegestures-pro.html
  12931. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-imagewidget-cpp.html
  12932. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-imagewidget-h.html
  12933. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-main-cpp.html
  12934. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-mainwidget-cpp.html
  12935. share/doc/qt5/qtwidgets/qtwidgets-gestures-imagegestures-mainwidget-h.html
  12936. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-anchorlayout-anchorlayout-pro.html
  12937. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-anchorlayout-example.html
  12938. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-anchorlayout-main-cpp.html
  12939. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-pro.html
  12940. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-qrc.html
  12941. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-example.html
  12942. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-cpp.html
  12943. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-h.html
  12944. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-main-cpp.html
  12945. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-window-cpp.html
  12946. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-window-h.html
  12947. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-3rdparty-fbm-h.html
  12948. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-boxes-pro.html
  12949. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-boxes-qrc.html
  12950. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-example.html
  12951. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glbuffers-cpp.html
  12952. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glbuffers-h.html
  12953. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glextensions-cpp.html
  12954. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-glextensions-h.html
  12955. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-gltrianglemesh-h.html
  12956. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-main-cpp.html
  12957. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-qtbox-cpp.html
  12958. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-qtbox-h.html
  12959. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-roundedbox-cpp.html
  12960. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-roundedbox-h.html
  12961. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-scene-cpp.html
  12962. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-scene-h.html
  12963. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-trackball-cpp.html
  12964. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-boxes-trackball-h.html
  12965. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-chip-cpp.html
  12966. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-chip-h.html
  12967. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-chip-pro.html
  12968. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-example.html
  12969. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-images-qrc.html
  12970. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-main-cpp.html
  12971. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-mainwindow-cpp.html
  12972. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-mainwindow-h.html
  12973. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-view-cpp.html
  12974. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-chip-view-h.html
  12975. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-collidingmice-pro.html
  12976. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-example.html
  12977. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-main-cpp.html
  12978. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-mice-qrc.html
  12979. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-mouse-cpp.html
  12980. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-collidingmice-mouse-h.html
  12981. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-arrow-cpp.html
  12982. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-arrow-h.html
  12983. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramitem-cpp.html
  12984. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramitem-h.html
  12985. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-cpp.html
  12986. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-h.html
  12987. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-pro.html
  12988. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-qrc.html
  12989. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramtextitem-cpp.html
  12990. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramtextitem-h.html
  12991. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-example.html
  12992. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-main-cpp.html
  12993. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-mainwindow-cpp.html
  12994. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-diagramscene-mainwindow-h.html
  12995. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-coloritem-cpp.html
  12996. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-coloritem-h.html
  12997. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-dragdroprobot-pro.html
  12998. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-example.html
  12999. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-main-cpp.html
  13000. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-cpp.html
  13001. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-h.html
  13002. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-qrc.html
  13003. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-edge-cpp.html
  13004. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-edge-h.html
  13005. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-elasticnodes-pro.html
  13006. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-example.html
  13007. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-graphwidget-cpp.html
  13008. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-graphwidget-h.html
  13009. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-main-cpp.html
  13010. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-node-cpp.html
  13011. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-elasticnodes-node-h.html
  13012. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-customproxy-cpp.html
  13013. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-customproxy-h.html
  13014. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-cpp.html
  13015. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-h.html
  13016. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-ui.html
  13017. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-pro.html
  13018. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-qrc.html
  13019. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-example.html
  13020. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-main-cpp.html
  13021. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-example.html
  13022. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-cpp.html
  13023. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-h.html
  13024. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-pro.html
  13025. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-main-cpp.html
  13026. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-window-cpp.html
  13027. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-flowlayout-window-h.html
  13028. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-example.html
  13029. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-flippablepad-cpp.html
  13030. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-flippablepad-h.html
  13031. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-form-ui.html
  13032. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-main-cpp.html
  13033. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-cpp.html
  13034. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-h.html
  13035. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-pro.html
  13036. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-qrc.html
  13037. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-roundrectitem-cpp.html
  13038. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-roundrectitem-h.html
  13039. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-splashitem-cpp.html
  13040. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-padnavigator-splashitem-h.html
  13041. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-example.html
  13042. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-main-cpp.html
  13043. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-simpleanchorlayout-pro.html
  13044. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-example.html
  13045. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-main-cpp.html
  13046. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-pro.html
  13047. share/doc/qt5/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-qrc.html
  13048. share/doc/qt5/qtwidgets/qtwidgets-index.html
  13049. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-adddialog-cpp.html
  13050. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-adddialog-h.html
  13051. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-addressbook-pro.html
  13052. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-addresswidget-cpp.html
  13053. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-addresswidget-h.html
  13054. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-example.html
  13055. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-main-cpp.html
  13056. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-mainwindow-cpp.html
  13057. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-mainwindow-h.html
  13058. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-newaddresstab-cpp.html
  13059. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-newaddresstab-h.html
  13060. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-tablemodel-cpp.html
  13061. share/doc/qt5/qtwidgets/qtwidgets-itemviews-addressbook-tablemodel-h.html
  13062. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-basicsortfiltermodel-pro.html
  13063. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-example.html
  13064. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-main-cpp.html
  13065. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-window-cpp.html
  13066. share/doc/qt5/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-window-h.html
  13067. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-chart-pro.html
  13068. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-chart-qrc.html
  13069. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-example.html
  13070. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-main-cpp.html
  13071. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-mainwindow-cpp.html
  13072. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-mainwindow-h.html
  13073. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-pieview-cpp.html
  13074. share/doc/qt5/qtwidgets/qtwidgets-itemviews-chart-pieview-h.html
  13075. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-coloreditorfactory-pro.html
  13076. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-colorlisteditor-cpp.html
  13077. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-colorlisteditor-h.html
  13078. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-example.html
  13079. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-main-cpp.html
  13080. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-window-cpp.html
  13081. share/doc/qt5/qtwidgets/qtwidgets-itemviews-coloreditorfactory-window-h.html
  13082. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-combowidgetmapper-pro.html
  13083. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-example.html
  13084. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-main-cpp.html
  13085. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-window-cpp.html
  13086. share/doc/qt5/qtwidgets/qtwidgets-itemviews-combowidgetmapper-window-h.html
  13087. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-pro.html
  13088. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-qrc.html
  13089. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-example.html
  13090. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-filterwidget-cpp.html
  13091. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-filterwidget-h.html
  13092. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-main-cpp.html
  13093. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-cpp.html
  13094. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-h.html
  13095. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-window-cpp.html
  13096. share/doc/qt5/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-window-h.html
  13097. share/doc/qt5/qtwidgets/qtwidgets-itemviews-dirview-dirview-pro.html
  13098. share/doc/qt5/qtwidgets/qtwidgets-itemviews-dirview-example.html
  13099. share/doc/qt5/qtwidgets/qtwidgets-itemviews-dirview-main-cpp.html
  13100. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-editabletreemodel-pro.html
  13101. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-editabletreemodel-qrc.html
  13102. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-example.html
  13103. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-main-cpp.html
  13104. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-cpp.html
  13105. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-h.html
  13106. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-ui.html
  13107. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treeitem-cpp.html
  13108. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treeitem-h.html
  13109. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treemodel-cpp.html
  13110. share/doc/qt5/qtwidgets/qtwidgets-itemviews-editabletreemodel-treemodel-h.html
  13111. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-example.html
  13112. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-fetchmore-pro.html
  13113. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-filelistmodel-cpp.html
  13114. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-filelistmodel-h.html
  13115. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-main-cpp.html
  13116. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-window-cpp.html
  13117. share/doc/qt5/qtwidgets/qtwidgets-itemviews-fetchmore-window-h.html
  13118. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-example.html
  13119. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-freezetablewidget-cpp.html
  13120. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-freezetablewidget-h.html
  13121. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-frozencolumn-pro.html
  13122. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-grades-qrc.html
  13123. share/doc/qt5/qtwidgets/qtwidgets-itemviews-frozencolumn-main-cpp.html
  13124. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-example.html
  13125. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-interview-pro.html
  13126. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-interview-qrc.html
  13127. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-main-cpp.html
  13128. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-model-cpp.html
  13129. share/doc/qt5/qtwidgets/qtwidgets-itemviews-interview-model-h.html
  13130. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-example.html
  13131. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-imagemodel-cpp.html
  13132. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-imagemodel-h.html
  13133. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-images-qrc.html
  13134. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-main-cpp.html
  13135. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-mainwindow-cpp.html
  13136. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-mainwindow-h.html
  13137. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-pixelator-pro.html
  13138. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-pixeldelegate-cpp.html
  13139. share/doc/qt5/qtwidgets/qtwidgets-itemviews-pixelator-pixeldelegate-h.html
  13140. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-example.html
  13141. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-main-cpp.html
  13142. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-mainwindow-cpp.html
  13143. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-mainwindow-h.html
  13144. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-piecesmodel-cpp.html
  13145. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-piecesmodel-h.html
  13146. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzle-pro.html
  13147. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzle-qrc.html
  13148. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzlewidget-cpp.html
  13149. share/doc/qt5/qtwidgets/qtwidgets-itemviews-puzzle-puzzlewidget-h.html
  13150. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-domitem-cpp.html
  13151. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-domitem-h.html
  13152. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-dommodel-cpp.html
  13153. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-dommodel-h.html
  13154. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-example.html
  13155. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-main-cpp.html
  13156. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-mainwindow-cpp.html
  13157. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-mainwindow-h.html
  13158. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpledommodel-simpledommodel-pro.html
  13159. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-example.html
  13160. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-main-cpp.html
  13161. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-simpletreemodel-pro.html
  13162. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-simpletreemodel-qrc.html
  13163. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treeitem-cpp.html
  13164. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treeitem-h.html
  13165. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treemodel-cpp.html
  13166. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simpletreemodel-treemodel-h.html
  13167. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-example.html
  13168. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-main-cpp.html
  13169. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-simplewidgetmapper-pro.html
  13170. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-window-cpp.html
  13171. share/doc/qt5/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-window-h.html
  13172. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-delegate-cpp.html
  13173. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-delegate-h.html
  13174. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-example.html
  13175. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-main-cpp.html
  13176. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spinboxdelegate-spinboxdelegate-pro.html
  13177. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-example.html
  13178. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-main-cpp.html
  13179. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-printview-cpp.html
  13180. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-printview-h.html
  13181. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-cpp.html
  13182. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-h.html
  13183. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-pro.html
  13184. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-qrc.html
  13185. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-cpp.html
  13186. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-h.html
  13187. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetitem-cpp.html
  13188. share/doc/qt5/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetitem-h.html
  13189. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-example.html
  13190. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-main-cpp.html
  13191. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-cpp.html
  13192. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-h.html
  13193. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-pro.html
  13194. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stareditor-cpp.html
  13195. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-stareditor-h.html
  13196. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-starrating-cpp.html
  13197. share/doc/qt5/qtwidgets/qtwidgets-itemviews-stardelegate-starrating-h.html
  13198. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-basiclayouts-pro.html
  13199. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-dialog-cpp.html
  13200. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-dialog-h.html
  13201. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-example.html
  13202. share/doc/qt5/qtwidgets/qtwidgets-layouts-basiclayouts-main-cpp.html
  13203. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-cpp.html
  13204. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-h.html
  13205. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-pro.html
  13206. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-example.html
  13207. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-main-cpp.html
  13208. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-window-cpp.html
  13209. share/doc/qt5/qtwidgets/qtwidgets-layouts-borderlayout-window-h.html
  13210. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-dialog-cpp.html
  13211. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-dialog-h.html
  13212. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-dynamiclayouts-pro.html
  13213. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-example.html
  13214. share/doc/qt5/qtwidgets/qtwidgets-layouts-dynamiclayouts-main-cpp.html
  13215. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-example.html
  13216. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-cpp.html
  13217. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-h.html
  13218. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-pro.html
  13219. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-main-cpp.html
  13220. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-window-cpp.html
  13221. share/doc/qt5/qtwidgets/qtwidgets-layouts-flowlayout-window-h.html
  13222. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-application-pro.html
  13223. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-application-qrc.html
  13224. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-example.html
  13225. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-main-cpp.html
  13226. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-mainwindow-cpp.html
  13227. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-application-mainwindow-h.html
  13228. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-dockwidgets-pro.html
  13229. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-dockwidgets-qrc.html
  13230. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-example.html
  13231. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-main-cpp.html
  13232. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-mainwindow-cpp.html
  13233. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-dockwidgets-mainwindow-h.html
  13234. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-colorswatch-cpp.html
  13235. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-colorswatch-h.html
  13236. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-example.html
  13237. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-main-cpp.html
  13238. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-cpp.html
  13239. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-h.html
  13240. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-pro.html
  13241. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-qrc.html
  13242. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-toolbar-cpp.html
  13243. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mainwindow-toolbar-h.html
  13244. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-example.html
  13245. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-main-cpp.html
  13246. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mainwindow-cpp.html
  13247. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mainwindow-h.html
  13248. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdi-pro.html
  13249. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdi-qrc.html
  13250. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdichild-cpp.html
  13251. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-mdi-mdichild-h.html
  13252. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-example.html
  13253. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-main-cpp.html
  13254. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-mainwindow-cpp.html
  13255. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-mainwindow-h.html
  13256. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-menus-menus-pro.html
  13257. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-example.html
  13258. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-main-cpp.html
  13259. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-mainwindow-cpp.html
  13260. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-mainwindow-h.html
  13261. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-sdi-pro.html
  13262. share/doc/qt5/qtwidgets/qtwidgets-mainwindows-sdi-sdi-qrc.html
  13263. share/doc/qt5/qtwidgets/qtwidgets-module.html
  13264. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-affine-pro.html
  13265. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-affine-qrc.html
  13266. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-example.html
  13267. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-main-cpp.html
  13268. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-xform-cpp.html
  13269. share/doc/qt5/qtwidgets/qtwidgets-painting-affine-xform-h.html
  13270. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-basicdrawing-pro.html
  13271. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-basicdrawing-qrc.html
  13272. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-example.html
  13273. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-main-cpp.html
  13274. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-renderarea-cpp.html
  13275. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-renderarea-h.html
  13276. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-window-cpp.html
  13277. share/doc/qt5/qtwidgets/qtwidgets-painting-basicdrawing-window-h.html
  13278. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-cpp.html
  13279. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-h.html
  13280. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-pro.html
  13281. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-composition-qrc.html
  13282. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-example.html
  13283. share/doc/qt5/qtwidgets/qtwidgets-painting-composition-main-cpp.html
  13284. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-circlewidget-cpp.html
  13285. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-circlewidget-h.html
  13286. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-concentriccircles-pro.html
  13287. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-example.html
  13288. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-main-cpp.html
  13289. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-window-cpp.html
  13290. share/doc/qt5/qtwidgets/qtwidgets-painting-concentriccircles-window-h.html
  13291. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-deform-pro.html
  13292. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-deform-qrc.html
  13293. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-example.html
  13294. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-main-cpp.html
  13295. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-pathdeform-cpp.html
  13296. share/doc/qt5/qtwidgets/qtwidgets-painting-deform-pathdeform-h.html
  13297. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-example.html
  13298. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-fontsampler-pro.html
  13299. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-main-cpp.html
  13300. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-mainwindow-cpp.html
  13301. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-mainwindow-h.html
  13302. share/doc/qt5/qtwidgets/qtwidgets-painting-fontsampler-mainwindowbase-ui.html
  13303. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-example.html
  13304. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-cpp.html
  13305. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-h.html
  13306. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-pro.html
  13307. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-gradients-qrc.html
  13308. share/doc/qt5/qtwidgets/qtwidgets-painting-gradients-main-cpp.html
  13309. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-example.html
  13310. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposer-cpp.html
  13311. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposer-h.html
  13312. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposition-pro.html
  13313. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposition-qrc.html
  13314. share/doc/qt5/qtwidgets/qtwidgets-painting-imagecomposition-main-cpp.html
  13315. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-example.html
  13316. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-main-cpp.html
  13317. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-painterpaths-pro.html
  13318. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-renderarea-cpp.html
  13319. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-renderarea-h.html
  13320. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-window-cpp.html
  13321. share/doc/qt5/qtwidgets/qtwidgets-painting-painterpaths-window-h.html
  13322. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-example.html
  13323. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-main-cpp.html
  13324. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-cpp.html
  13325. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-h.html
  13326. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-pro.html
  13327. share/doc/qt5/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-qrc.html
  13328. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-example.html
  13329. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-main-cpp.html
  13330. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-renderarea-cpp.html
  13331. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-renderarea-h.html
  13332. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-transformations-pro.html
  13333. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-window-cpp.html
  13334. share/doc/qt5/qtwidgets/qtwidgets-painting-transformations-window-h.html
  13335. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-calendar-pro.html
  13336. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-example.html
  13337. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-main-cpp.html
  13338. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-mainwindow-cpp.html
  13339. share/doc/qt5/qtwidgets/qtwidgets-richtext-calendar-mainwindow-h.html
  13340. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-detailsdialog-cpp.html
  13341. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-detailsdialog-h.html
  13342. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-example.html
  13343. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-main-cpp.html
  13344. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-mainwindow-cpp.html
  13345. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-mainwindow-h.html
  13346. share/doc/qt5/qtwidgets/qtwidgets-richtext-orderform-orderform-pro.html
  13347. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-example.html
  13348. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-highlighter-cpp.html
  13349. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-highlighter-h.html
  13350. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-main-cpp.html
  13351. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-mainwindow-cpp.html
  13352. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-mainwindow-h.html
  13353. share/doc/qt5/qtwidgets/qtwidgets-richtext-syntaxhighlighter-syntaxhighlighter-pro.html
  13354. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-example.html
  13355. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-main-cpp.html
  13356. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-cpp.html
  13357. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-h.html
  13358. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-pro.html
  13359. share/doc/qt5/qtwidgets/qtwidgets-richtext-textedit-textedit-qrc.html
  13360. share/doc/qt5/qtwidgets/qtwidgets-statemachine-eventtransitions-eventtransitions-pro.html
  13361. share/doc/qt5/qtwidgets/qtwidgets-statemachine-eventtransitions-example.html
  13362. share/doc/qt5/qtwidgets/qtwidgets-statemachine-eventtransitions-main-cpp.html
  13363. share/doc/qt5/qtwidgets/qtwidgets-statemachine-factorial-example.html
  13364. share/doc/qt5/qtwidgets/qtwidgets-statemachine-factorial-factorial-pro.html
  13365. share/doc/qt5/qtwidgets/qtwidgets-statemachine-factorial-main-cpp.html
  13366. share/doc/qt5/qtwidgets/qtwidgets-statemachine-pingpong-example.html
  13367. share/doc/qt5/qtwidgets/qtwidgets-statemachine-pingpong-main-cpp.html
  13368. share/doc/qt5/qtwidgets/qtwidgets-statemachine-pingpong-pingpong-pro.html
  13369. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-example.html
  13370. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-main-cpp.html
  13371. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-movementtransition-h.html
  13372. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-rogue-pro.html
  13373. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-window-cpp.html
  13374. share/doc/qt5/qtwidgets/qtwidgets-statemachine-rogue-window-h.html
  13375. share/doc/qt5/qtwidgets/qtwidgets-statemachine-trafficlight-example.html
  13376. share/doc/qt5/qtwidgets/qtwidgets-statemachine-trafficlight-main-cpp.html
  13377. share/doc/qt5/qtwidgets/qtwidgets-statemachine-trafficlight-trafficlight-pro.html
  13378. share/doc/qt5/qtwidgets/qtwidgets-statemachine-twowaybutton-example.html
  13379. share/doc/qt5/qtwidgets/qtwidgets-statemachine-twowaybutton-main-cpp.html
  13380. share/doc/qt5/qtwidgets/qtwidgets-statemachine-twowaybutton-twowaybutton-pro.html
  13381. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-codecs-pro.html
  13382. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-example.html
  13383. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-main-cpp.html
  13384. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-mainwindow-cpp.html
  13385. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-mainwindow-h.html
  13386. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-previewform-cpp.html
  13387. share/doc/qt5/qtwidgets/qtwidgets-tools-codecs-previewform-h.html
  13388. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-completer-pro.html
  13389. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-completer-qrc.html
  13390. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-example.html
  13391. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-fsmodel-cpp.html
  13392. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-fsmodel-h.html
  13393. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-main-cpp.html
  13394. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-mainwindow-cpp.html
  13395. share/doc/qt5/qtwidgets/qtwidgets-tools-completer-mainwindow-h.html
  13396. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-customcompleter-pro.html
  13397. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-customcompleter-qrc.html
  13398. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-example.html
  13399. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-main-cpp.html
  13400. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-mainwindow-cpp.html
  13401. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-mainwindow-h.html
  13402. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-textedit-cpp.html
  13403. share/doc/qt5/qtwidgets/qtwidgets-tools-customcompleter-textedit-h.html
  13404. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echoplugin-pro.html
  13405. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echointerface-h.html
  13406. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-cpp.html
  13407. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-h.html
  13408. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-pro.html
  13409. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-echowindow-main-cpp.html
  13410. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-example.html
  13411. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-plugin-echoplugin-cpp.html
  13412. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-plugin-echoplugin-h.html
  13413. share/doc/qt5/qtwidgets/qtwidgets-tools-echoplugin-plugin-plugin-pro.html
  13414. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-example.html
  13415. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-i18n-pro.html
  13416. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-i18n-qrc.html
  13417. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-languagechooser-cpp.html
  13418. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-languagechooser-h.html
  13419. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-main-cpp.html
  13420. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-mainwindow-cpp.html
  13421. share/doc/qt5/qtwidgets/qtwidgets-tools-i18n-mainwindow-h.html
  13422. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-app-pro.html
  13423. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-example.html
  13424. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-interfaces-h.html
  13425. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-main-cpp.html
  13426. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-mainwindow-cpp.html
  13427. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-mainwindow-h.html
  13428. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-paintarea-cpp.html
  13429. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-paintarea-h.html
  13430. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-plugindialog-cpp.html
  13431. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-app-plugindialog-h.html
  13432. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictools-pro.html
  13433. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-cpp.html
  13434. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-h.html
  13435. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-example.html
  13436. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-example.html
  13437. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafilters-pro.html
  13438. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-cpp.html
  13439. share/doc/qt5/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-h.html
  13440. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-example.html
  13441. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-main-cpp.html
  13442. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-regexp-pro.html
  13443. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-regexpdialog-cpp.html
  13444. share/doc/qt5/qtwidgets/qtwidgets-tools-regexp-regexpdialog-h.html
  13445. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-example.html
  13446. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-main-cpp.html
  13447. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpression-pro.html
  13448. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpression-qrc.html
  13449. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpressiondialog-cpp.html
  13450. share/doc/qt5/qtwidgets/qtwidgets-tools-regularexpression-regularexpressiondialog-h.html
  13451. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-example.html
  13452. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-locationdialog-cpp.html
  13453. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-locationdialog-h.html
  13454. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-main-cpp.html
  13455. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-mainwindow-cpp.html
  13456. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-mainwindow-h.html
  13457. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-settingseditor-pro.html
  13458. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-settingstree-cpp.html
  13459. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-settingstree-h.html
  13460. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-variantdelegate-cpp.html
  13461. share/doc/qt5/qtwidgets/qtwidgets-tools-settingseditor-variantdelegate-h.html
  13462. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-example.html
  13463. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-plugin-pro.html
  13464. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyle-cpp.html
  13465. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyle-h.html
  13466. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyleplugin-cpp.html
  13467. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyleplugin-h.html
  13468. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-styleplugin-pro.html
  13469. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-main-cpp.html
  13470. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-cpp.html
  13471. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-h.html
  13472. share/doc/qt5/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-pro.html
  13473. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-example.html
  13474. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-main-cpp.html
  13475. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-mainwindow-cpp.html
  13476. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-mainwindow-h.html
  13477. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-cpp.html
  13478. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-h.html
  13479. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-pro.html
  13480. share/doc/qt5/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-qrc.html
  13481. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-commands-cpp.html
  13482. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-commands-h.html
  13483. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-document-cpp.html
  13484. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-document-h.html
  13485. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-example.html
  13486. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-main-cpp.html
  13487. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-mainwindow-cpp.html
  13488. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-mainwindow-h.html
  13489. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-mainwindow-ui.html
  13490. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-undo-pro.html
  13491. share/doc/qt5/qtwidgets/qtwidgets-tools-undo-undo-qrc.html
  13492. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-commands-cpp.html
  13493. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-commands-h.html
  13494. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramitem-cpp.html
  13495. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramitem-h.html
  13496. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramscene-cpp.html
  13497. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-diagramscene-h.html
  13498. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-example.html
  13499. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-main-cpp.html
  13500. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-mainwindow-cpp.html
  13501. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-mainwindow-h.html
  13502. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-undoframework-pro.html
  13503. share/doc/qt5/qtwidgets/qtwidgets-tools-undoframework-undoframework-qrc.html
  13504. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-addressbook-cpp.html
  13505. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-addressbook-h.html
  13506. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-example.html
  13507. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-main-cpp.html
  13508. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part1-part1-pro.html
  13509. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-addressbook-cpp.html
  13510. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-addressbook-h.html
  13511. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-example.html
  13512. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-main-cpp.html
  13513. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part2-part2-pro.html
  13514. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-addressbook-cpp.html
  13515. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-addressbook-h.html
  13516. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-example.html
  13517. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-main-cpp.html
  13518. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part3-part3-pro.html
  13519. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-addressbook-cpp.html
  13520. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-addressbook-h.html
  13521. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-example.html
  13522. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-main-cpp.html
  13523. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part4-part4-pro.html
  13524. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-addressbook-cpp.html
  13525. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-addressbook-h.html
  13526. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-example.html
  13527. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-finddialog-cpp.html
  13528. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-finddialog-h.html
  13529. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-main-cpp.html
  13530. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part5-part5-pro.html
  13531. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-addressbook-cpp.html
  13532. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-addressbook-h.html
  13533. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-example.html
  13534. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-finddialog-cpp.html
  13535. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-finddialog-h.html
  13536. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-main-cpp.html
  13537. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part6-part6-pro.html
  13538. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-addressbook-cpp.html
  13539. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-addressbook-h.html
  13540. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-example.html
  13541. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-finddialog-cpp.html
  13542. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-finddialog-h.html
  13543. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-main-cpp.html
  13544. share/doc/qt5/qtwidgets/qtwidgets-tutorials-addressbook-part7-part7-pro.html
  13545. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-childwidget-childwidget-pro.html
  13546. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-childwidget-example.html
  13547. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-childwidget-main-cpp.html
  13548. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-example.html
  13549. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-main-cpp.html
  13550. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-nestedlayouts-pro.html
  13551. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-toplevel-example.html
  13552. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-toplevel-main-cpp.html
  13553. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-toplevel-toplevel-pro.html
  13554. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-example.html
  13555. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-main-cpp.html
  13556. share/doc/qt5/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-windowlayout-pro.html
  13557. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-analogclock-cpp.html
  13558. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-analogclock-h.html
  13559. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-analogclock-pro.html
  13560. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-example.html
  13561. share/doc/qt5/qtwidgets/qtwidgets-widgets-analogclock-main-cpp.html
  13562. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-button-cpp.html
  13563. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-button-h.html
  13564. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-calculator-cpp.html
  13565. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-calculator-h.html
  13566. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-calculator-pro.html
  13567. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-example.html
  13568. share/doc/qt5/qtwidgets/qtwidgets-widgets-calculator-main-cpp.html
  13569. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-calendarwidget-pro.html
  13570. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-example.html
  13571. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-main-cpp.html
  13572. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-window-cpp.html
  13573. share/doc/qt5/qtwidgets/qtwidgets-widgets-calendarwidget-window-h.html
  13574. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-charactermap-pro.html
  13575. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-characterwidget-cpp.html
  13576. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-characterwidget-h.html
  13577. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-example.html
  13578. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-main-cpp.html
  13579. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-mainwindow-cpp.html
  13580. share/doc/qt5/qtwidgets/qtwidgets-widgets-charactermap-mainwindow-h.html
  13581. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-cpp.html
  13582. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-h.html
  13583. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-pro.html
  13584. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-example.html
  13585. share/doc/qt5/qtwidgets/qtwidgets-widgets-codeeditor-main-cpp.html
  13586. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-cpp.html
  13587. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-h.html
  13588. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-pro.html
  13589. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-example.html
  13590. share/doc/qt5/qtwidgets/qtwidgets-widgets-digitalclock-main-cpp.html
  13591. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-cpp.html
  13592. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-h.html
  13593. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-pro.html
  13594. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-example.html
  13595. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-main-cpp.html
  13596. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-testwidget-cpp.html
  13597. share/doc/qt5/qtwidgets/qtwidgets-widgets-elidedlabel-testwidget-h.html
  13598. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-example.html
  13599. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-groupbox-pro.html
  13600. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-main-cpp.html
  13601. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-window-cpp.html
  13602. share/doc/qt5/qtwidgets/qtwidgets-widgets-groupbox-window-h.html
  13603. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-example.html
  13604. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconpreviewarea-cpp.html
  13605. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconpreviewarea-h.html
  13606. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-icons-pro.html
  13607. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconsizespinbox-cpp.html
  13608. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-iconsizespinbox-h.html
  13609. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-imagedelegate-cpp.html
  13610. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-imagedelegate-h.html
  13611. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-main-cpp.html
  13612. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-mainwindow-cpp.html
  13613. share/doc/qt5/qtwidgets/qtwidgets-widgets-icons-mainwindow-h.html
  13614. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-example.html
  13615. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-cpp.html
  13616. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-h.html
  13617. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-pro.html
  13618. share/doc/qt5/qtwidgets/qtwidgets-widgets-imageviewer-main-cpp.html
  13619. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-example.html
  13620. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-lineedits-pro.html
  13621. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-main-cpp.html
  13622. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-window-cpp.html
  13623. share/doc/qt5/qtwidgets/qtwidgets-widgets-lineedits-window-h.html
  13624. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-buttontester-cpp.html
  13625. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-buttontester-h.html
  13626. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-example.html
  13627. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-main-cpp.html
  13628. share/doc/qt5/qtwidgets/qtwidgets-widgets-mousebuttons-mousebuttons-pro.html
  13629. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-example.html
  13630. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-main-cpp.html
  13631. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-movie-pro.html
  13632. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-movieplayer-cpp.html
  13633. share/doc/qt5/qtwidgets/qtwidgets-widgets-movie-movieplayer-h.html
  13634. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-example.html
  13635. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-main-cpp.html
  13636. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-mainwindow-cpp.html
  13637. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-mainwindow-h.html
  13638. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-scribble-pro.html
  13639. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-scribblearea-cpp.html
  13640. share/doc/qt5/qtwidgets/qtwidgets-widgets-scribble-scribblearea-h.html
  13641. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-example.html
  13642. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-main-cpp.html
  13643. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-cpp.html
  13644. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-h.html
  13645. share/doc/qt5/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-pro.html
  13646. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-example.html
  13647. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-main-cpp.html
  13648. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-sliders-pro.html
  13649. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-slidersgroup-cpp.html
  13650. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-slidersgroup-h.html
  13651. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-window-cpp.html
  13652. share/doc/qt5/qtwidgets/qtwidgets-widgets-sliders-window-h.html
  13653. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-example.html
  13654. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-main-cpp.html
  13655. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-spinboxes-pro.html
  13656. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-window-cpp.html
  13657. share/doc/qt5/qtwidgets/qtwidgets-widgets-spinboxes-window-h.html
  13658. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-example.html
  13659. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-main-cpp.html
  13660. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-norwegianwoodstyle-cpp.html
  13661. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-norwegianwoodstyle-h.html
  13662. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-styles-pro.html
  13663. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-styles-qrc.html
  13664. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-widgetgallery-cpp.html
  13665. share/doc/qt5/qtwidgets/qtwidgets-widgets-styles-widgetgallery-h.html
  13666. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-example.html
  13667. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-layouts-default-ui.html
  13668. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-layouts-pagefold-ui.html
  13669. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-main-cpp.html
  13670. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-cpp.html
  13671. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-h.html
  13672. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-ui.html
  13673. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheet-pro.html
  13674. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheet-qrc.html
  13675. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-cpp.html
  13676. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-h.html
  13677. share/doc/qt5/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-ui.html
  13678. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-example.html
  13679. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-images-qrc.html
  13680. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-main-cpp.html
  13681. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-mainwindow-cpp.html
  13682. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-mainwindow-h.html
  13683. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tablet-pro.html
  13684. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletapplication-cpp.html
  13685. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletapplication-h.html
  13686. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletcanvas-cpp.html
  13687. share/doc/qt5/qtwidgets/qtwidgets-widgets-tablet-tabletcanvas-h.html
  13688. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-example.html
  13689. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-main-cpp.html
  13690. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrix-pro.html
  13691. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixboard-cpp.html
  13692. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixboard-h.html
  13693. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixpiece-cpp.html
  13694. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixpiece-h.html
  13695. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixwindow-cpp.html
  13696. share/doc/qt5/qtwidgets/qtwidgets-widgets-tetrix-tetrixwindow-h.html
  13697. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-example.html
  13698. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-main-cpp.html
  13699. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-shapeitem-cpp.html
  13700. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-shapeitem-h.html
  13701. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-sortingbox-cpp.html
  13702. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-sortingbox-h.html
  13703. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-tooltips-pro.html
  13704. share/doc/qt5/qtwidgets/qtwidgets-widgets-tooltips-tooltips-qrc.html
  13705. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-example.html
  13706. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-ledwidget-cpp.html
  13707. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-ledwidget-h.html
  13708. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-localeselector-cpp.html
  13709. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-localeselector-h.html
  13710. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-main-cpp.html
  13711. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-validators-pro.html
  13712. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-validators-qrc.html
  13713. share/doc/qt5/qtwidgets/qtwidgets-widgets-validators-validators-ui.html
  13714. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-dialog-cpp.html
  13715. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-dialog-h.html
  13716. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-example.html
  13717. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-main-cpp.html
  13718. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-wiggly-pro.html
  13719. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-wigglywidget-cpp.html
  13720. share/doc/qt5/qtwidgets/qtwidgets-widgets-wiggly-wigglywidget-h.html
  13721. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-controllerwindow-cpp.html
  13722. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-controllerwindow-h.html
  13723. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-example.html
  13724. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-main-cpp.html
  13725. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-previewwindow-cpp.html
  13726. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-previewwindow-h.html
  13727. share/doc/qt5/qtwidgets/qtwidgets-widgets-windowflags-windowflags-pro.html
  13728. share/doc/qt5/qtwidgets/qtwidgets.index
  13729. share/doc/qt5/qtwidgets/qtwidgets.qhp
  13730. share/doc/qt5/qtwidgets/qtwidgets.qhp.sha1
  13731. share/doc/qt5/qtwidgets/qtwidgets.tags
  13732. share/doc/qt5/qtwidgets/qundocommand-members.html
  13733. share/doc/qt5/qtwidgets/qundocommand.html
  13734. share/doc/qt5/qtwidgets/qundogroup-members.html
  13735. share/doc/qt5/qtwidgets/qundogroup.html
  13736. share/doc/qt5/qtwidgets/qundostack-members.html
  13737. share/doc/qt5/qtwidgets/qundostack.html
  13738. share/doc/qt5/qtwidgets/qundoview-members.html
  13739. share/doc/qt5/qtwidgets/qundoview.html
  13740. share/doc/qt5/qtwidgets/qvboxlayout-members.html
  13741. share/doc/qt5/qtwidgets/qvboxlayout.html
  13742. share/doc/qt5/qtwidgets/qwhatsthis-members.html
  13743. share/doc/qt5/qtwidgets/qwhatsthis.html
  13744. share/doc/qt5/qtwidgets/qwidget-members.html
  13745. share/doc/qt5/qtwidgets/qwidget-obsolete.html
  13746. share/doc/qt5/qtwidgets/qwidget-styling.html
  13747. share/doc/qt5/qtwidgets/qwidget.html
  13748. share/doc/qt5/qtwidgets/qwidgetaction-members.html
  13749. share/doc/qt5/qtwidgets/qwidgetaction.html
  13750. share/doc/qt5/qtwidgets/qwidgetitem-members.html
  13751. share/doc/qt5/qtwidgets/qwidgetitem.html
  13752. share/doc/qt5/qtwidgets/qwizard-members.html
  13753. share/doc/qt5/qtwidgets/qwizard.html
  13754. share/doc/qt5/qtwidgets/qwizardpage-members.html
  13755. share/doc/qt5/qtwidgets/qwizardpage.html
  13756. share/doc/qt5/qtwidgets/standard-dialogs.html
  13757. share/doc/qt5/qtwidgets/style-reference.html
  13758. share/doc/qt5/qtwidgets/style/offline-simple.css
  13759. share/doc/qt5/qtwidgets/style/offline.css
  13760. share/doc/qt5/qtwidgets/stylesheet-customizing.html
  13761. share/doc/qt5/qtwidgets/stylesheet-designer.html
  13762. share/doc/qt5/qtwidgets/stylesheet-examples.html
  13763. share/doc/qt5/qtwidgets/stylesheet-reference.html
  13764. share/doc/qt5/qtwidgets/stylesheet-syntax.html
  13765. share/doc/qt5/qtwidgets/stylesheet.html
  13766. share/doc/qt5/qtwidgets/textedit-example.html
  13767. share/doc/qt5/qtwidgets/tutorials-addressbook.html
  13768. share/doc/qt5/qtwidgets/widget-classes.html
  13769. share/doc/qt5/qtwidgets/widgets-tutorial.html
  13770. share/doc/qt5/qtwinextras.qch
  13771. share/doc/qt5/qtwinextras/examples-manifest.xml
  13772. share/doc/qt5/qtwinextras/examples-qtwinextras.html
  13773. share/doc/qt5/qtwinextras/images/arrow_bc.png
  13774. share/doc/qt5/qtwinextras/images/bgrContent.png
  13775. share/doc/qt5/qtwinextras/images/btn_next.png
  13776. share/doc/qt5/qtwinextras/images/btn_prev.png
  13777. share/doc/qt5/qtwinextras/images/bullet_dn.png
  13778. share/doc/qt5/qtwinextras/images/bullet_sq.png
  13779. share/doc/qt5/qtwinextras/images/glass.png
  13780. share/doc/qt5/qtwinextras/images/home.png
  13781. share/doc/qt5/qtwinextras/images/ico_note.png
  13782. share/doc/qt5/qtwinextras/images/ico_note_attention.png
  13783. share/doc/qt5/qtwinextras/images/ico_out.png
  13784. share/doc/qt5/qtwinextras/images/jumplist.png
  13785. share/doc/qt5/qtwinextras/images/logo.png
  13786. share/doc/qt5/qtwinextras/images/peek-on.png
  13787. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-composited.png
  13788. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-non-composited.png
  13789. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-taskbar.png
  13790. share/doc/qt5/qtwinextras/images/qtwinextras-musicplayer-thumbnail.png
  13791. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-composited.png
  13792. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-non-composited.png
  13793. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-taskbar.png
  13794. share/doc/qt5/qtwinextras/images/qtwinextras-quickplayer-thumbnail.png
  13795. share/doc/qt5/qtwinextras/images/taskbar-button.png
  13796. share/doc/qt5/qtwinextras/images/taskbar-progress-indeterminate.png
  13797. share/doc/qt5/qtwinextras/images/taskbar-progress-paused.png
  13798. share/doc/qt5/qtwinextras/images/taskbar-progress-stopped.png
  13799. share/doc/qt5/qtwinextras/images/taskbar-progress.png
  13800. share/doc/qt5/qtwinextras/images/thumbbar.png
  13801. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-pause-16.png
  13802. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-pause-32.png
  13803. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-play-16.png
  13804. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-play-32.png
  13805. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-seek-backward-32.png
  13806. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-seek-forward-32.png
  13807. share/doc/qt5/qtwinextras/images/used-in-examples/quickplayer/images/media-stop-32.png
  13808. share/doc/qt5/qtwinextras/qml-qtwinextras-dwmfeatures-members.html
  13809. share/doc/qt5/qtwinextras/qml-qtwinextras-dwmfeatures.html
  13810. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplist-members.html
  13811. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplist.html
  13812. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistcategory-members.html
  13813. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistcategory.html
  13814. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistdestination-members.html
  13815. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistdestination.html
  13816. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistlink-members.html
  13817. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistlink.html
  13818. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistseparator-members.html
  13819. share/doc/qt5/qtwinextras/qml-qtwinextras-jumplistseparator.html
  13820. share/doc/qt5/qtwinextras/qml-qtwinextras-taskbarbutton-members.html
  13821. share/doc/qt5/qtwinextras/qml-qtwinextras-taskbarbutton.html
  13822. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbar-members.html
  13823. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbar.html
  13824. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbutton-members.html
  13825. share/doc/qt5/qtwinextras/qml-qtwinextras-thumbnailtoolbutton.html
  13826. share/doc/qt5/qtwinextras/qtwin.html
  13827. share/doc/qt5/qtwinextras/qtwinextras-iconextractor-example.html
  13828. share/doc/qt5/qtwinextras/qtwinextras-iconextractor-iconextractor-pro.html
  13829. share/doc/qt5/qtwinextras/qtwinextras-iconextractor-main-cpp.html
  13830. share/doc/qt5/qtwinextras/qtwinextras-index.html
  13831. share/doc/qt5/qtwinextras/qtwinextras-module.html
  13832. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-example.html
  13833. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-main-cpp.html
  13834. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-musicplayer-cpp.html
  13835. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-musicplayer-h.html
  13836. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-musicplayer-pro.html
  13837. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-volumebutton-cpp.html
  13838. share/doc/qt5/qtwinextras/qtwinextras-musicplayer-volumebutton-h.html
  13839. share/doc/qt5/qtwinextras/qtwinextras-overview.html
  13840. share/doc/qt5/qtwinextras/qtwinextras-qmlmodule.html
  13841. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-example.html
  13842. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-main-cpp.html
  13843. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-qml-main-qml.html
  13844. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-quickplayer-pro.html
  13845. share/doc/qt5/qtwinextras/qtwinextras-quickplayer-quickplayer-qrc.html
  13846. share/doc/qt5/qtwinextras/qtwinextras.index
  13847. share/doc/qt5/qtwinextras/qtwinextras.qhp
  13848. share/doc/qt5/qtwinextras/qtwinextras.qhp.sha1
  13849. share/doc/qt5/qtwinextras/qwinjumplist-members.html
  13850. share/doc/qt5/qtwinextras/qwinjumplist.html
  13851. share/doc/qt5/qtwinextras/qwinjumplistcategory-members.html
  13852. share/doc/qt5/qtwinextras/qwinjumplistcategory.html
  13853. share/doc/qt5/qtwinextras/qwinjumplistitem-members.html
  13854. share/doc/qt5/qtwinextras/qwinjumplistitem.html
  13855. share/doc/qt5/qtwinextras/qwinmime-members.html
  13856. share/doc/qt5/qtwinextras/qwinmime.html
  13857. share/doc/qt5/qtwinextras/qwintaskbarbutton-members.html
  13858. share/doc/qt5/qtwinextras/qwintaskbarbutton.html
  13859. share/doc/qt5/qtwinextras/qwintaskbarprogress-members.html
  13860. share/doc/qt5/qtwinextras/qwintaskbarprogress.html
  13861. share/doc/qt5/qtwinextras/qwinthumbnailtoolbar-members.html
  13862. share/doc/qt5/qtwinextras/qwinthumbnailtoolbar.html
  13863. share/doc/qt5/qtwinextras/qwinthumbnailtoolbutton-members.html
  13864. share/doc/qt5/qtwinextras/qwinthumbnailtoolbutton.html
  13865. share/doc/qt5/qtwinextras/style/offline-simple.css
  13866. share/doc/qt5/qtwinextras/style/offline.css
  13867. share/doc/qt5/qtx11extras.qch
  13868. share/doc/qt5/qtx11extras/images/arrow_bc.png
  13869. share/doc/qt5/qtx11extras/images/bgrContent.png
  13870. share/doc/qt5/qtx11extras/images/btn_next.png
  13871. share/doc/qt5/qtx11extras/images/btn_prev.png
  13872. share/doc/qt5/qtx11extras/images/bullet_dn.png
  13873. share/doc/qt5/qtx11extras/images/bullet_sq.png
  13874. share/doc/qt5/qtx11extras/images/home.png
  13875. share/doc/qt5/qtx11extras/images/ico_note.png
  13876. share/doc/qt5/qtx11extras/images/ico_note_attention.png
  13877. share/doc/qt5/qtx11extras/images/ico_out.png
  13878. share/doc/qt5/qtx11extras/images/logo.png
  13879. share/doc/qt5/qtx11extras/qtx11extras-index.html
  13880. share/doc/qt5/qtx11extras/qtx11extras-module.html
  13881. share/doc/qt5/qtx11extras/qtx11extras.index
  13882. share/doc/qt5/qtx11extras/qtx11extras.qhp
  13883. share/doc/qt5/qtx11extras/qtx11extras.qhp.sha1
  13884. share/doc/qt5/qtx11extras/qx11info-members.html
  13885. share/doc/qt5/qtx11extras/qx11info.html
  13886. share/doc/qt5/qtx11extras/style/offline-simple.css
  13887. share/doc/qt5/qtx11extras/style/offline.css
  13888. share/doc/qt5/qtxml.qch
  13889. share/doc/qt5/qtxml/examples-manifest.xml
  13890. share/doc/qt5/qtxml/images/arrow_bc.png
  13891. share/doc/qt5/qtxml/images/bgrContent.png
  13892. share/doc/qt5/qtxml/images/btn_next.png
  13893. share/doc/qt5/qtxml/images/btn_prev.png
  13894. share/doc/qt5/qtxml/images/bullet_dn.png
  13895. share/doc/qt5/qtxml/images/bullet_sq.png
  13896. share/doc/qt5/qtxml/images/dombookmarks-example.png
  13897. share/doc/qt5/qtxml/images/home.png
  13898. share/doc/qt5/qtxml/images/ico_note.png
  13899. share/doc/qt5/qtxml/images/ico_note_attention.png
  13900. share/doc/qt5/qtxml/images/ico_out.png
  13901. share/doc/qt5/qtxml/images/logo.png
  13902. share/doc/qt5/qtxml/images/saxbookmarks-example.png
  13903. share/doc/qt5/qtxml/images/xmlstreamexample-filemenu.png
  13904. share/doc/qt5/qtxml/images/xmlstreamexample-helpmenu.png
  13905. share/doc/qt5/qtxml/images/xmlstreamexample-screenshot.png
  13906. share/doc/qt5/qtxml/qdomattr-members.html
  13907. share/doc/qt5/qtxml/qdomattr.html
  13908. share/doc/qt5/qtxml/qdomcdatasection-members.html
  13909. share/doc/qt5/qtxml/qdomcdatasection.html
  13910. share/doc/qt5/qtxml/qdomcharacterdata-members.html
  13911. share/doc/qt5/qtxml/qdomcharacterdata.html
  13912. share/doc/qt5/qtxml/qdomcomment-members.html
  13913. share/doc/qt5/qtxml/qdomcomment.html
  13914. share/doc/qt5/qtxml/qdomdocument-members.html
  13915. share/doc/qt5/qtxml/qdomdocument.html
  13916. share/doc/qt5/qtxml/qdomdocumentfragment-members.html
  13917. share/doc/qt5/qtxml/qdomdocumentfragment.html
  13918. share/doc/qt5/qtxml/qdomdocumenttype-members.html
  13919. share/doc/qt5/qtxml/qdomdocumenttype.html
  13920. share/doc/qt5/qtxml/qdomelement-members.html
  13921. share/doc/qt5/qtxml/qdomelement.html
  13922. share/doc/qt5/qtxml/qdomentity-members.html
  13923. share/doc/qt5/qtxml/qdomentity.html
  13924. share/doc/qt5/qtxml/qdomentityreference-members.html
  13925. share/doc/qt5/qtxml/qdomentityreference.html
  13926. share/doc/qt5/qtxml/qdomimplementation-members.html
  13927. share/doc/qt5/qtxml/qdomimplementation.html
  13928. share/doc/qt5/qtxml/qdomnamednodemap-members.html
  13929. share/doc/qt5/qtxml/qdomnamednodemap.html
  13930. share/doc/qt5/qtxml/qdomnode-members.html
  13931. share/doc/qt5/qtxml/qdomnode.html
  13932. share/doc/qt5/qtxml/qdomnodelist-members.html
  13933. share/doc/qt5/qtxml/qdomnodelist.html
  13934. share/doc/qt5/qtxml/qdomnotation-members.html
  13935. share/doc/qt5/qtxml/qdomnotation.html
  13936. share/doc/qt5/qtxml/qdomprocessinginstruction-members.html
  13937. share/doc/qt5/qtxml/qdomprocessinginstruction.html
  13938. share/doc/qt5/qtxml/qdomtext-members.html
  13939. share/doc/qt5/qtxml/qdomtext.html
  13940. share/doc/qt5/qtxml/qtxml-dombookmarks-dombookmarks-pro.html
  13941. share/doc/qt5/qtxml/qtxml-dombookmarks-example.html
  13942. share/doc/qt5/qtxml/qtxml-dombookmarks-main-cpp.html
  13943. share/doc/qt5/qtxml/qtxml-dombookmarks-mainwindow-cpp.html
  13944. share/doc/qt5/qtxml/qtxml-dombookmarks-mainwindow-h.html
  13945. share/doc/qt5/qtxml/qtxml-dombookmarks-xbeltree-cpp.html
  13946. share/doc/qt5/qtxml/qtxml-dombookmarks-xbeltree-h.html
  13947. share/doc/qt5/qtxml/qtxml-index.html
  13948. share/doc/qt5/qtxml/qtxml-module.html
  13949. share/doc/qt5/qtxml/qtxml-saxbookmarks-example.html
  13950. share/doc/qt5/qtxml/qtxml-saxbookmarks-main-cpp.html
  13951. share/doc/qt5/qtxml/qtxml-saxbookmarks-mainwindow-cpp.html
  13952. share/doc/qt5/qtxml/qtxml-saxbookmarks-mainwindow-h.html
  13953. share/doc/qt5/qtxml/qtxml-saxbookmarks-saxbookmarks-pro.html
  13954. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelgenerator-cpp.html
  13955. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelgenerator-h.html
  13956. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelhandler-cpp.html
  13957. share/doc/qt5/qtxml/qtxml-saxbookmarks-xbelhandler-h.html
  13958. share/doc/qt5/qtxml/qtxml-streambookmarks-example.html
  13959. share/doc/qt5/qtxml/qtxml-streambookmarks-main-cpp.html
  13960. share/doc/qt5/qtxml/qtxml-streambookmarks-mainwindow-cpp.html
  13961. share/doc/qt5/qtxml/qtxml-streambookmarks-mainwindow-h.html
  13962. share/doc/qt5/qtxml/qtxml-streambookmarks-streambookmarks-pro.html
  13963. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelreader-cpp.html
  13964. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelreader-h.html
  13965. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelwriter-cpp.html
  13966. share/doc/qt5/qtxml/qtxml-streambookmarks-xbelwriter-h.html
  13967. share/doc/qt5/qtxml/qtxml-xmlstreamlint-example.html
  13968. share/doc/qt5/qtxml/qtxml-xmlstreamlint-main-cpp.html
  13969. share/doc/qt5/qtxml/qtxml-xmlstreamlint-xmlstreamlint-pro.html
  13970. share/doc/qt5/qtxml/qtxml.index
  13971. share/doc/qt5/qtxml/qtxml.qhp
  13972. share/doc/qt5/qtxml/qtxml.qhp.sha1
  13973. share/doc/qt5/qtxml/qtxml.tags
  13974. share/doc/qt5/qtxml/qxmlattributes-members.html
  13975. share/doc/qt5/qtxml/qxmlattributes.html
  13976. share/doc/qt5/qtxml/qxmlcontenthandler-members.html
  13977. share/doc/qt5/qtxml/qxmlcontenthandler.html
  13978. share/doc/qt5/qtxml/qxmldeclhandler-members.html
  13979. share/doc/qt5/qtxml/qxmldeclhandler.html
  13980. share/doc/qt5/qtxml/qxmldefaulthandler-members.html
  13981. share/doc/qt5/qtxml/qxmldefaulthandler.html
  13982. share/doc/qt5/qtxml/qxmldtdhandler-members.html
  13983. share/doc/qt5/qtxml/qxmldtdhandler.html
  13984. share/doc/qt5/qtxml/qxmlentityresolver-members.html
  13985. share/doc/qt5/qtxml/qxmlentityresolver.html
  13986. share/doc/qt5/qtxml/qxmlerrorhandler-members.html
  13987. share/doc/qt5/qtxml/qxmlerrorhandler.html
  13988. share/doc/qt5/qtxml/qxmlinputsource-members.html
  13989. share/doc/qt5/qtxml/qxmlinputsource.html
  13990. share/doc/qt5/qtxml/qxmllexicalhandler-members.html
  13991. share/doc/qt5/qtxml/qxmllexicalhandler.html
  13992. share/doc/qt5/qtxml/qxmllocator-members.html
  13993. share/doc/qt5/qtxml/qxmllocator.html
  13994. share/doc/qt5/qtxml/qxmlnamespacesupport-members.html
  13995. share/doc/qt5/qtxml/qxmlnamespacesupport.html
  13996. share/doc/qt5/qtxml/qxmlparseexception-members.html
  13997. share/doc/qt5/qtxml/qxmlparseexception.html
  13998. share/doc/qt5/qtxml/qxmlreader-members.html
  13999. share/doc/qt5/qtxml/qxmlreader-obsolete.html
  14000. share/doc/qt5/qtxml/qxmlreader.html
  14001. share/doc/qt5/qtxml/qxmlsimplereader-members.html
  14002. share/doc/qt5/qtxml/qxmlsimplereader.html
  14003. share/doc/qt5/qtxml/style/offline-simple.css
  14004. share/doc/qt5/qtxml/style/offline.css
  14005. share/doc/qt5/qtxml/xml-dom-tml.html
  14006. share/doc/qt5/qtxml/xml-namespaces.html
  14007. share/doc/qt5/qtxml/xml-processing.html
  14008. share/doc/qt5/qtxml/xml-sax.html
  14009. share/doc/qt5/qtxml/xml-streaming.html
  14010. share/doc/qt5/qtxml/xml-tools.html
  14011. share/doc/qt5/qtxmlpatterns.qch
  14012. share/doc/qt5/qtxmlpatterns/examples-manifest.xml
  14013. share/doc/qt5/qtxmlpatterns/images/arrow_bc.png
  14014. share/doc/qt5/qtxmlpatterns/images/bgrContent.png
  14015. share/doc/qt5/qtxmlpatterns/images/btn_next.png
  14016. share/doc/qt5/qtxmlpatterns/images/btn_prev.png
  14017. share/doc/qt5/qtxmlpatterns/images/bullet_dn.png
  14018. share/doc/qt5/qtxmlpatterns/images/bullet_sq.png
  14019. share/doc/qt5/qtxmlpatterns/images/filetree_1-example.png
  14020. share/doc/qt5/qtxmlpatterns/images/filetree_2-example.png
  14021. share/doc/qt5/qtxmlpatterns/images/home.png
  14022. share/doc/qt5/qtxmlpatterns/images/ico_note.png
  14023. share/doc/qt5/qtxmlpatterns/images/ico_note_attention.png
  14024. share/doc/qt5/qtxmlpatterns/images/ico_out.png
  14025. share/doc/qt5/qtxmlpatterns/images/logo.png
  14026. share/doc/qt5/qtxmlpatterns/images/patternist-wordProcessor.png
  14027. share/doc/qt5/qtxmlpatterns/images/recipes-example.png
  14028. share/doc/qt5/qtxmlpatterns/images/schema-example.png
  14029. share/doc/qt5/qtxmlpatterns/qabstractmessagehandler-members.html
  14030. share/doc/qt5/qtxmlpatterns/qabstractmessagehandler.html
  14031. share/doc/qt5/qtxmlpatterns/qabstracturiresolver-members.html
  14032. share/doc/qt5/qtxmlpatterns/qabstracturiresolver.html
  14033. share/doc/qt5/qtxmlpatterns/qabstractxmlnodemodel-members.html
  14034. share/doc/qt5/qtxmlpatterns/qabstractxmlnodemodel.html
  14035. share/doc/qt5/qtxmlpatterns/qabstractxmlreceiver-members.html
  14036. share/doc/qt5/qtxmlpatterns/qabstractxmlreceiver.html
  14037. share/doc/qt5/qtxmlpatterns/qsimplexmlnodemodel-members.html
  14038. share/doc/qt5/qtxmlpatterns/qsimplexmlnodemodel.html
  14039. share/doc/qt5/qtxmlpatterns/qsourcelocation-members.html
  14040. share/doc/qt5/qtxmlpatterns/qsourcelocation.html
  14041. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-example.html
  14042. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-filetree-cpp.html
  14043. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-filetree-h.html
  14044. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-filetree-pro.html
  14045. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-forms-mainwindow-ui.html
  14046. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-main-cpp.html
  14047. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-mainwindow-cpp.html
  14048. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-mainwindow-h.html
  14049. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-queries-listcppfiles-xq.html
  14050. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-queries-qrc.html
  14051. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-filetree-queries-wholetree-xq.html
  14052. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-index.html
  14053. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-module.html
  14054. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-example.html
  14055. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-allrecipes-xq.html
  14056. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-cookbook-xml.html
  14057. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-liquidingredientsinsoup-xq.html
  14058. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-mushroomsoup-xq.html
  14059. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-preparationlessthan30-xq.html
  14060. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-files-preparationtimes-xq.html
  14061. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-forms-querywidget-ui.html
  14062. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-main-cpp.html
  14063. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-querymainwindow-cpp.html
  14064. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-querymainwindow-h.html
  14065. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-recipes-pro.html
  14066. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-recipes-recipes-qrc.html
  14067. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-example.html
  14068. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-contact-xml.html
  14069. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-order-xml.html
  14070. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-recipe-xml.html
  14071. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-valid-contact-xml.html
  14072. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-valid-order-xml.html
  14073. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-files-valid-recipe-xml.html
  14074. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-main-cpp.html
  14075. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-mainwindow-cpp.html
  14076. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-mainwindow-h.html
  14077. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-pro.html
  14078. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-qrc.html
  14079. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-schema-schema-ui.html
  14080. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-example.html
  14081. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-globalvariables-globals-cpp.html
  14082. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-globalvariables-reportglobals-xq.html
  14083. share/doc/qt5/qtxmlpatterns/qtxmlpatterns-xquery-xquery-pro.html
  14084. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.index
  14085. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.qhp
  14086. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.qhp.sha1
  14087. share/doc/qt5/qtxmlpatterns/qtxmlpatterns.tags
  14088. share/doc/qt5/qtxmlpatterns/qxmlformatter-members.html
  14089. share/doc/qt5/qtxmlpatterns/qxmlformatter.html
  14090. share/doc/qt5/qtxmlpatterns/qxmlitem-members.html
  14091. share/doc/qt5/qtxmlpatterns/qxmlitem.html
  14092. share/doc/qt5/qtxmlpatterns/qxmlname-members.html
  14093. share/doc/qt5/qtxmlpatterns/qxmlname.html
  14094. share/doc/qt5/qtxmlpatterns/qxmlnamepool-members.html
  14095. share/doc/qt5/qtxmlpatterns/qxmlnamepool.html
  14096. share/doc/qt5/qtxmlpatterns/qxmlnodemodelindex-members.html
  14097. share/doc/qt5/qtxmlpatterns/qxmlnodemodelindex.html
  14098. share/doc/qt5/qtxmlpatterns/qxmlquery-members.html
  14099. share/doc/qt5/qtxmlpatterns/qxmlquery.html
  14100. share/doc/qt5/qtxmlpatterns/qxmlresultitems-members.html
  14101. share/doc/qt5/qtxmlpatterns/qxmlresultitems.html
  14102. share/doc/qt5/qtxmlpatterns/qxmlschema-members.html
  14103. share/doc/qt5/qtxmlpatterns/qxmlschema.html
  14104. share/doc/qt5/qtxmlpatterns/qxmlschemavalidator-members.html
  14105. share/doc/qt5/qtxmlpatterns/qxmlschemavalidator.html
  14106. share/doc/qt5/qtxmlpatterns/qxmlserializer-members.html
  14107. share/doc/qt5/qtxmlpatterns/qxmlserializer.html
  14108. share/doc/qt5/qtxmlpatterns/style/offline-simple.css
  14109. share/doc/qt5/qtxmlpatterns/style/offline.css
  14110. share/doc/qt5/qtxmlpatterns/xmlpattern-examples.html
  14111. share/doc/qt5/qtxmlpatterns/xmlprocessing.html
  14112. share/doc/qt5/qtxmlpatterns/xquery-introduction.html
  14113. Collapse this list.

To install the port: cd /usr/ports/misc/qt5-doc/ && make install clean
To add the package: pkg install qt5-doc

PKGNAME: qt5-doc

distinfo:

TIMESTAMP = 1526163661
SHA256 (KDE/Qt/5.10.1/5.10.1-0-201802092256qt-everywhere-documentation.7z) = 4fa8d7808e9998998e7ec7011f6f7a25fd8801faccdada7d7ab4b535f7e3569c
SIZE (KDE/Qt/5.10.1/5.10.1-0-201802092256qt-everywhere-documentation.7z) = 230768220

Patch dependencies:

  1. 7z : archivers/p7zip

This port is required by:

for Run * - deleted ports are only shown under the This port is required by section. It was harder to do for the Required section. Perhaps later...
Configuration Options
     No options to configure

USES:
7z:p7zip qt:5

Master Sites:
  1. http://master.qt.io/online/qtsdkrepository/linux_x64/desktop/qt5_5101_src_doc_examples/qt.qt5.5101.doc/
  2. http://qtmirror.ics.com/pub/qtproject/online/qtsdkrepository/linux_x64/desktop/qt5_5101_src_doc_examples/qt.qt5.5101.doc/
  3. http://www.nic.funet.fi/pub/mirrors/download.qt-project.org/online/qtsdkrepository/linux_x64/desktop/qt5_5101_src_doc_examples/qt.qt5.5101.doc/
  4. https://download.qt.io/online/qtsdkrepository/linux_x64/desktop/qt5_5101_src_doc_examples/qt.qt5.5101.doc/
  5. https://ftp.jaist.ac.jp/pub/qtproject/online/qtsdkrepository/linux_x64/desktop/qt5_5101_src_doc_examples/qt.qt5.5101.doc/
  6. https://www.mirrorservice.org/sites/download.qt-project.org/online/qtsdkrepository/linux_x64/desktop/qt5_5101_src_doc_examples/qt.qt5.5101.doc/

Number of commits found: 9

Commit History - (may be incomplete: see SVNWeb link above for full details)
DateByDescription
28 Jun 2018 17:39:55
Original commit files touched by this commit  5.10.1
Revision:473503
tcberner search for other commits by this committer
Replace bsd.qt.mk by Uses/qt.mk and Uses/qt-dist.mk

From now on, ports that depend on Qt4 will have to set
	USES=		qt:4
	USE_QT=		foo bar
ports depending on Qt5 will use
	USES=		qt:5
	USE_QT=		foo bar

PR:		229225
Exp-run by:	antoine
Reviewed by:	mat
Approved by:	portmgr (antoine)
Differential Revision:	-https://reviews.freebsd.org/D15540
18 May 2018 12:27:44
Original commit files touched by this commit  5.10.1
Revision:470288
rakuco search for other commits by this committer
Update the Qt5 ports to 5.10.1.

The work was done by tcberner and myself, with thanks to antoine for the
exp-run.

Not a lot to report compared to other Qt5 updates:
* net/qt5-network is still broken with LibreSSL. I said this in a commit
  message ages ago but it bears repeating: upstream is open to adding support
  for LibreSSL, but someone needs to step up to maintain it upstream, otherwise
  things will continue to be broken all the time.
* www/qt5-webengine is a huge monster that is terrible to update, just like
  www/chromium itself is. We (kde@) have decided to keep using the 5.9 series
  for the time being, as it should be compatible with the rest of Qt anyway. It
  was updated to 5.9.5, the latest 5.9 release at the time of writing.

PR:		228213
29 Mar 2018 19:03:18
Original commit files touched by this commit  5.9.4_1
Revision:465911
tcberner search for other commits by this committer
Fix permissions in installed Qt5 header files

For the qt5-* ports bsd.qt.mk sets EXTRACT_AFTER_ARGS, and
thereby does not get the normal default value of
      --no-same-owner --no-same-permissions
passed when extracting. This lead to for example header files
being installed (i.e. copied), with permissions group write
permissions.

Manually append that to the bsd.qt.mk shenanigans (also do the
same in www/qt5-webchannel, which opts out of the bsd.qt.mk value)

PR:		227027
Reported by:	grarpamp@gmail.com
29 Jan 2018 12:37:05
Original commit files touched by this commit  5.9.4
Revision:460296
rakuco search for other commits by this committer
Update Qt5 to 5.9.4.

Announcement:
https://blog.qt.io/blog/2018/01/23/qt-5-9-4-released/

This is a minor update and a lot easier to land than the previous 5.7.1 ->
5.9.3 commit.

Thanks to antoine for the exp-run.

PR:		225436
06 Jan 2018 21:30:33
Original commit files touched by this commit  5.9.3
Revision:458293
rakuco search for other commits by this committer
Update Qt5 ports to 5.9.3.

This took quite a lot of time because Qt's own build system underwent
several changes in 5.8.0 that took a while to adapt to.

And, of course, qt5-webengine is a behemoth that we need to patch like crazy
due to its bundling of Chromium. In fact, most of the Chromium patches in
qt5-webengine have been imported with no changes from www/chromium@433510
("www/chromium: update to 56.0.2924.87").

New port: accessibility/qt5-speech

Bigger changes to Qt5 ports we had to make:
- Qt now allows using a configure.json file to define configuration options
  and specify configuration checks that can be done when qmake is invoked.
(Only the first 15 lines of the commit message are shown above View all of this commit message)
18 Feb 2017 19:48:05
Original commit files touched by this commit  5.7.1
Revision:434380
tcberner search for other commits by this committer
Update Qt5 to 5.7.1, and unify the Qt4 and Qt5 ports some more

* Update Qt5 to 5.7.1
* Move Qt4 binaries to lib/qt4/bin
* Move Qt5 libraries to lib/qt5/lib
  By moving the libraries we should finally be able to get rid of the inplace
  upgrade bug (see ports bugs 194088, 195105 and 198720):  when Qt5's libraries
  were lying in /usr/local/lib, which would often get added by pkgconfig to the
  linker paths via dependencies, the already installed libraries were linked
  against, instead of the ones that were being built. This forced us to make
  sure, that -L${WRKSRC}/lib was always coming before -L/usr/local/lib in the
  linker flags. With this change this should no longer be the case.
* Rename some ports to match the rest (foo-qtX -> qtX-foo)
* Depend on new port misc/qtchooser [see UPDATING & CHANGES]

There are several new Qt5 ports which all have been created by Marie Loise
Nolden
<nolden@kde.org>. Thanks again.

PR:		216797
Exp-Run by:	antoine
Reviewed by:	rakuco, mat, groot_kde.org
Approved by:	rakuco (mentor)
Differential Revision:	https://reviews.freebsd.org/D9213
28 Oct 2016 13:43:14
Original commit files touched by this commit  5.6.2
Revision:424842
tcberner search for other commits by this committer
Update Qt to 5.6.2 [1,2]

Thanks to the upstream work of Marie Loise Nolden, we could get rid of a handful
of patches, as they have been properly upstreamed. The rest of the work is just
some minor plist changes.

I would like to thank Loise <nolden@kde.org> for the upstream work, and Adriaan
<groot@kde.org> for getting the update into shape.

[1] http://blog.qt.io/blog/2016/10/12/qt-5-6-2-released/
[2] http://wiki.qt.io/Qt_5.6.2_Change_Files

PR: 213530
Exp-run by: antoine
Submitted by: Adriaan de Groot <groot@kde.org>
Reviewed by: rakuco, mat, tcberner
Approved by: rakuco (mentor)
Differential Revision: https://reviews.freebsd.org/D8228
17 Sep 2016 09:46:54
Original commit files touched by this commit  5.6.1
Revision:422306
rakuco search for other commits by this committer
Update the Qt5 ports to 5.6.1.

This took longer than expected, but there are quite a few changes to the
existing ports and a few new ones.

General upstream changes:
- Starting with Qt 5.6.2, Qt will fail at configuration time if LibreSSL is
  being used. According to the discussion here:
  https://codereview.qt-project.org/#/c/154800/
  The Qt project is not opposed to LibreSSL, but does not want to mix
  support for it into the OpenSSL backend code, especially as they move
  towards supporting OpenSSL 1.1.
  People interested in LibreSSL support are welcome to submit a separate
  backend upstream, but are expected to maintain it. We (kde@) are not
  opposed to carrying some patches authored by others in the future, as long
(Only the first 15 lines of the commit message are shown above View all of this commit message)
31 May 2016 18:02:42
Original commit files touched by this commit  5.5.1
Revision:416213
pi search for other commits by this committer
New port: misc/qt5-doc

This port builds and installs the Qt5 API documentation for use
with IDEs such as qtcreator or kdevelop in qch file format and HTML
file format.

Limitations: The port is made for Qt 5.5.1 and excludes the
documentation for qtwebkit, qtwebkit-examples and qtwebengine. The
reasons are, webkit is deprecated and should not be used for further
development, it will not be part of the Qt 5.6.x sources by default
and only provided on FreeBSD for backwards compatibility with ports.
API documentation may be later added to the qt5-webkit port (as
well for qtwebkit-examples). The qtwebengine hasn't been ported to
FreeBSD yet, so no documenation can be generated either.
(Only the first 15 lines of the commit message are shown above View all of this commit message)

Number of commits found: 9

Login
User Login
Create account

Servers and bandwidth provided by
New York Internet, SuperNews, and RootBSD

This site
What is FreshPorts?
About the authors
Issues
FAQ
How big is it?
The latest upgrade!
Privacy
Forums
Blog
Contact

Search
Enter Keywords:
 
more...

Latest Vulnerabilities
botan2Aug 17
jenkinsAug 15
jenkins-ltsAug 15
linux-flashplayerAug 14
samba46Aug 14
samba47Aug 14
samba48Aug 14
wpa_supplicantAug 14
chickenAug 12
giteaAug 12
GraphicsMagickAug 11
mbedtlsAug 10
postgresql10-serverAug 10
postgresql93-serverAug 10
postgresql94-serverAug 10

15 vulnerabilities affecting 134 ports have been reported in the past 14 days

* - modified, not new

All vulnerabilities

Last updated:
2018-08-17 23:13:03


Ports
Home
Categories
Deleted ports
Sanity Test Failures
Newsfeeds

Statistics
Graphs
NEW Graphs (Javascript)
Traffic

Calculated hourly:
Port count 35052
Broken 75
Deprecated 94
Ignore 317
Forbidden 3
Restricted 162
No CDROM 74
Vulnerable 32
Expired 6
Set to expire 79
Interactive 0
new 24 hours 8
new 48 hours18
new 7 days64
new fortnight107
new month2608

Servers and bandwidth provided by
New York Internet, SuperNews, and RootBSD
Valid HTML, CSS, and RSS.
Copyright © 2000-2018 Dan Langille. All rights reserved.